Cysteine-rich with EGF-like domains 2

Overview
NameCysteine-rich with EGF-like domains 2
Smed IDSMED30024706
Length (bp)1645
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cysteine-rich with EGF-like domains 2 (SMED30024706) t-SNE clustered cells

Violin plots show distribution of expression levels for Cysteine-rich with EGF-like domains 2 (SMED30024706) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cysteine-rich with EGF-like domains 2 (SMED30024706) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cysteine-rich with EGF-like domains 2 (SMED30024706) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024706

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X2 cellSMED30024706SMESG000042342.1 SmedASXL_011774SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30024706SMESG000042342.1 dd_Smed_v4_4289_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30024706SMESG000042342.1 dd_Smed_v4_4289_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30024706SMESG000042342.1 dd_Smed_v4_4289_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30024706SMESG000042342.1 Contig39900newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30024706SMESG000042342.1 Contig39900uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cysteine-rich with EGF-like domains 2 vs. Ensembl Human
Match: CRELD1 (cysteine rich with EGF like domains 1 [Source:HGNC Symbol;Acc:HGNC:14630])

HSP 1 Score: 225.713 bits (574), Expect = 1.646e-67
Identity = 138/398 (34.67%), Postives = 202/398 (50.75%), Query Frame = 1
Query:  121 CENLVQEFQIGLQKSEKSNFGGGNTAWEEKRLGNYATSETRLVHILEKLCPSSINNREKCQYLRXXXXXXXXXWWFNIFKKDLNGLSLYHYLCVDYLKACCPPNYFGKSCELCHFHNETTGLTCSGHGKCDGNGTRIGNGTCVCYSGYTGTMCNECEFNYFQT-TNDNGYTCTICHNSCVGCHGPGYDECEKCAEGWNQEDSKCVDIDEC-SNATICDVNQYCLNTEGSFKCASCDLSCANCTGFGNDKCVSCNNGYQKINNNCEDINECSADSELCREPGQKCTNLPGSFSCDCIDSYVKQSDGSCKFKEPSKKISSTDKPTNRKTTGGKNKNRKQPKKIWTKKFEREFFKLICCIFLLGITSYFFGYYSLIVIVAALICGYYIYFKSIKLDQIFSK 1308
            C  LV  F  GL+++ + NFGGGNTAWEE+ L  Y  SETRLV +LE +C  S     +C  L E  EE +E WWF+   K      L+ +LC D LK CCP   FG SC  C    E     C G+G+C+G GTR G+G C C +GY G  C +C   YF+   N +   C+ C   C  C GP    C +C +GW     KCVDIDEC +    C  +Q+C+NTEGS++C  C  +C  C G G  +C  C+ GYQ++ + C D++EC  ++E+C    ++C N  G + C C + Y KQ +G C  ++  +      + T  +                    ++ FF +I C            + ++ +   A + GY++  +S ++ + F K
Sbjct:   49 CRGLVDSFNKGLERTIRDNFGGGNTAWEEENLSKYKDSETRLVEVLEGVCSKS---DFECHRLLELSEELVESWWFH---KQQEAPDLFQWLCSDSLKLCCPAGTFGPSCLPCPGGTERP---CGGYGQCEGEGTRGGSGHCDCQAGYGGEACGQCGLGYFEAERNASHLVCSACFGPCARCSGPEESNCLQCKKGWALHHLKCVDIDECGTEGANCGADQFCVNTEGSYECRDCAKACLGCMGAGPGRCKKCSPGYQQVGSKCLDVDEC--ETEVCPGENKQCENTEGGYRCICAEGY-KQMEGICVKEQIPESAGFFSEMTEDELV----------------VLQQMFFGIIICALATLAAKGDLVFTAIFIGAVAAMTGYWLSERSDRVLEGFIK 418          
BLAST of Cysteine-rich with EGF-like domains 2 vs. Ensembl Human
Match: CRELD1 (cysteine rich with EGF like domains 1 [Source:HGNC Symbol;Acc:HGNC:14630])

HSP 1 Score: 225.713 bits (574), Expect = 1.646e-67
Identity = 138/398 (34.67%), Postives = 202/398 (50.75%), Query Frame = 1
Query:  121 CENLVQEFQIGLQKSEKSNFGGGNTAWEEKRLGNYATSETRLVHILEKLCPSSINNREKCQYLRXXXXXXXXXWWFNIFKKDLNGLSLYHYLCVDYLKACCPPNYFGKSCELCHFHNETTGLTCSGHGKCDGNGTRIGNGTCVCYSGYTGTMCNECEFNYFQT-TNDNGYTCTICHNSCVGCHGPGYDECEKCAEGWNQEDSKCVDIDEC-SNATICDVNQYCLNTEGSFKCASCDLSCANCTGFGNDKCVSCNNGYQKINNNCEDINECSADSELCREPGQKCTNLPGSFSCDCIDSYVKQSDGSCKFKEPSKKISSTDKPTNRKTTGGKNKNRKQPKKIWTKKFEREFFKLICCIFLLGITSYFFGYYSLIVIVAALICGYYIYFKSIKLDQIFSK 1308
            C  LV  F  GL+++ + NFGGGNTAWEE+ L  Y  SETRLV +LE +C  S     +C  L E  EE +E WWF+   K      L+ +LC D LK CCP   FG SC  C    E     C G+G+C+G GTR G+G C C +GY G  C +C   YF+   N +   C+ C   C  C GP    C +C +GW     KCVDIDEC +    C  +Q+C+NTEGS++C  C  +C  C G G  +C  C+ GYQ++ + C D++EC  ++E+C    ++C N  G + C C + Y KQ +G C  ++  +      + T  +                    ++ FF +I C            + ++ +   A + GY++  +S ++ + F K
Sbjct:   49 CRGLVDSFNKGLERTIRDNFGGGNTAWEEENLSKYKDSETRLVEVLEGVCSKS---DFECHRLLELSEELVESWWFH---KQQEAPDLFQWLCSDSLKLCCPAGTFGPSCLPCPGGTERP---CGGYGQCEGEGTRGGSGHCDCQAGYGGEACGQCGLGYFEAERNASHLVCSACFGPCARCSGPEESNCLQCKKGWALHHLKCVDIDECGTEGANCGADQFCVNTEGSYECRDCAKACLGCMGAGPGRCKKCSPGYQQVGSKCLDVDEC--ETEVCPGENKQCENTEGGYRCICAEGY-KQMEGICVKEQIPESAGFFSEMTEDELV----------------VLQQMFFGIIICALATLAAKGDLVFTAIFIGAVAAMTGYWLSERSDRVLEGFIK 418          
BLAST of Cysteine-rich with EGF-like domains 2 vs. Ensembl Human
Match: CRELD1 (cysteine rich with EGF like domains 1 [Source:HGNC Symbol;Acc:HGNC:14630])

HSP 1 Score: 225.713 bits (574), Expect = 1.646e-67
Identity = 138/398 (34.67%), Postives = 202/398 (50.75%), Query Frame = 1
Query:  121 CENLVQEFQIGLQKSEKSNFGGGNTAWEEKRLGNYATSETRLVHILEKLCPSSINNREKCQYLRXXXXXXXXXWWFNIFKKDLNGLSLYHYLCVDYLKACCPPNYFGKSCELCHFHNETTGLTCSGHGKCDGNGTRIGNGTCVCYSGYTGTMCNECEFNYFQT-TNDNGYTCTICHNSCVGCHGPGYDECEKCAEGWNQEDSKCVDIDEC-SNATICDVNQYCLNTEGSFKCASCDLSCANCTGFGNDKCVSCNNGYQKINNNCEDINECSADSELCREPGQKCTNLPGSFSCDCIDSYVKQSDGSCKFKEPSKKISSTDKPTNRKTTGGKNKNRKQPKKIWTKKFEREFFKLICCIFLLGITSYFFGYYSLIVIVAALICGYYIYFKSIKLDQIFSK 1308
            C  LV  F  GL+++ + NFGGGNTAWEE+ L  Y  SETRLV +LE +C  S     +C  L E  EE +E WWF+   K      L+ +LC D LK CCP   FG SC  C    E     C G+G+C+G GTR G+G C C +GY G  C +C   YF+   N +   C+ C   C  C GP    C +C +GW     KCVDIDEC +    C  +Q+C+NTEGS++C  C  +C  C G G  +C  C+ GYQ++ + C D++EC  ++E+C    ++C N  G + C C + Y KQ +G C  ++  +      + T  +                    ++ FF +I C            + ++ +   A + GY++  +S ++ + F K
Sbjct:   49 CRGLVDSFNKGLERTIRDNFGGGNTAWEEENLSKYKDSETRLVEVLEGVCSKS---DFECHRLLELSEELVESWWFH---KQQEAPDLFQWLCSDSLKLCCPAGTFGPSCLPCPGGTERP---CGGYGQCEGEGTRGGSGHCDCQAGYGGEACGQCGLGYFEAERNASHLVCSACFGPCARCSGPEESNCLQCKKGWALHHLKCVDIDECGTEGANCGADQFCVNTEGSYECRDCAKACLGCMGAGPGRCKKCSPGYQQVGSKCLDVDEC--ETEVCPGENKQCENTEGGYRCICAEGY-KQMEGICVKEQIPESAGFFSEMTEDELV----------------VLQQMFFGIIICALATLAAKGDLVFTAIFIGAVAAMTGYWLSERSDRVLEGFIK 418          
BLAST of Cysteine-rich with EGF-like domains 2 vs. Ensembl Human
Match: CRELD1 (cysteine rich with EGF like domains 1 [Source:HGNC Symbol;Acc:HGNC:14630])

HSP 1 Score: 218.779 bits (556), Expect = 8.246e-65
Identity = 127/307 (41.37%), Postives = 172/307 (56.03%), Query Frame = 1
Query:  121 CENLVQEFQIGLQKSEKSNFGGGNTAWEEKRLGNYATSETRLVHILEKLCPSSINNREKCQYLRXXXXXXXXXWWFNIFKKDLNGLSLYHYLCVDYLKACCPPNYFGKSCELCHFHNETTGLTCSGHGKCDGNGTRIGNGTCVCYSGYTGTMCNECEFNYFQT-TNDNGYTCTICHNSCVGCHGPGYDECEKCAEGWNQEDSKCVDIDEC-SNATICDVNQYCLNTEGSFKCASCDLSCANCTGFGNDKCVSCNNGYQKINNNCEDINECSADSELCREPGQKCTNLPGSFSCDCIDSYVKQSDGSC 1035
            C  LV  F  GL+++ + NFGGGNTAWEE+ L  Y  SETRLV +LE +C  S     +C  L E  EE +E WWF+   K      L+ +LC D LK CCP   FG SC  C    E     C G+G+C+G GTR G+G C C +GY G  C +C   YF+   N +   C+ C   C  C GP    C +C +GW     KCVDIDEC +    C  +Q+C+NTEGS++C  C  +C  C G G  +C  C+ GYQ++ + C D++EC  ++E+C    ++C N  G + C C + Y KQ +G C
Sbjct:   49 CRGLVDSFNKGLERTIRDNFGGGNTAWEEENLSKYKDSETRLVEVLEGVCSKSDF---ECHRLLELSEELVESWWFH---KQQEAPDLFQWLCSDSLKLCCPAGTFGPSCLPCPGGTERP---CGGYGQCEGEGTRGGSGHCDCQAGYGGEACGQCGLGYFEAERNASHLVCSACFGPCARCSGPEESNCLQCKKGWALHHLKCVDIDECGTEGANCGADQFCVNTEGSYECRDCAKACLGCMGAGPGRCKKCSPGYQQVGSKCLDVDEC--ETEVCPGENKQCENTEGGYRCICAEGY-KQMEGIC 343          
BLAST of Cysteine-rich with EGF-like domains 2 vs. Ensembl Human
Match: CRELD2 (cysteine rich with EGF like domains 2 [Source:HGNC Symbol;Acc:HGNC:28150])

HSP 1 Score: 209.149 bits (531), Expect = 4.990e-62
Identity = 120/305 (39.34%), Postives = 164/305 (53.77%), Query Frame = 1
Query:  121 CENLVQEFQIGLQKSEKSNFGGGNTAWEEKRLGNYATSETRLVHILEKLCPSSINNREKCQYLRXXXXXXXXXWWFNIFKKDLNGLSLYHYLCVDYLKACCPPNYFGKSCELCHFHNETTGLTCSGHGKCDGNGTRIGNGTCVCYSGYTGTMCNECEFNYFQT-TNDNGYTCTICHNSCVGCHGPGYDECEKCAEGWNQEDSKCVDIDECS-NATICDVNQYCLNTEGSFKCASCDLSCANCTGFGNDKCVSCNNGYQKINNNCEDINECSADSELCREPGQKCTNLPGSFSCDCIDSYVKQSDG 1029
            C  LV +F  G+  + K NFGGGNTAWEEK L  Y +SE RL+ ILE LC SS     +C  + E  EE +E WW  +  +  +   L+ + CV  LK CC P  +G  C  C   ++     CSG+G C G+G+R G+G+C C+ GY G +C +C   YF +  N+    CT C  SC  C G    +C +C  GW  ++  CVD+DEC+     C   Q+C N  GS+ C  CD SC  CTG G   C  C +GY + +  C D++ECS   + C    + C N PGS+ C C D + +  D 
Sbjct:   34 CRGLVDKFNQGMVDTAKKNFGGGNTAWEEKTLSKYESSEIRLLEILEGLCESSDF---ECNQMLEAQEEHLEAWWLQLKSEYPD---LFEWFCVKTLKVCCSPGTYGPDCLACQGGSQRP---CSGNGHCSGDGSRQGDGSCRCHMGYQGPLCTDCMDGYFSSLRNETHSICTACDESCKTCSGLTNRDCGECEVGWVLDEGACVDVDECAAEPPPCSAAQFCKNANGSYTCEECDSSCVGCTGEGPGNCKECISGYAREHGQCADVDECSLAEKTCVRKNENCYNTPGSYVCVCPDGFEETEDA 329          
BLAST of Cysteine-rich with EGF-like domains 2 vs. Ensembl Celegans
Match: crld-1 (Cysteine Rich with egf (EGF) Like Domains homolog [Source:UniProtKB/TrEMBL;Acc:A7LPH5])

HSP 1 Score: 160.999 bits (406), Expect = 8.129e-45
Identity = 107/271 (39.48%), Postives = 150/271 (55.35%), Query Frame = 1
Query:   49 RFMKFAIVLLCLTIKSIIGQTYEICEN---LVQEFQIGLQKSEKSNFGGGNTAWEEKRLGNYATSETRLVHILEKLC-PSSINNRE----------KCQYLRXXXXXXXXXWWFNIFKKDLNGLSLYHYLCVDYLKACCPPNYFGKSCELCHFHNETTGLTCSGHGKCDGNGTRIGNGTCVCYSGYTGTMCNECEFNYFQTTND-NGYTCTICHNSCVG-CHGPGYDECEKCAEGWNQEDSKCVDIDECSNATIC-DVNQYCLNTEGSFKC 810
            R +    VL+  T +  +    E C     LV  F  GL+K+ + +F GG+TAWEEK LG Y TSETRL+ +LE +C  SS+ N +          KC    E+ EE IEE+++N   +  N +S  ++LCV+ LK CCP  +FGK+CE C   +E   + C G G C G+G+R G+G C C +GYTG +C  C+  YF+ +    G  C  CH  C+G C       C KC  GW   +  C D++EC N + C   ++ C+NT GSFKC
Sbjct:    3 RILLLLAVLIGATSQKEVTIKNEKCRTCNFLVSTFDEGLKKTARHHFAGGDTAWEEKNLGKYKTSETRLIEVLEGVCKKSSLPNMDNFMGIAEIEFKCSTQLEKHEETIEEFYYN---QQHNNMS--NWLCVEQLKLCCPDGHFGKNCEQCPGLSEKADV-CFGKGSCHGDGSREGSGKCKCETGYTGNLCRYCDIEYFEESRTVQGVVCKKCHEGCLGVCSSESSKGCSKCKNGWKLTEEGCADVNECQNESACTKEHEICVNTVGSFKC 267          
BLAST of Cysteine-rich with EGF-like domains 2 vs. Ensembl Celegans
Match: crld-1 (Cysteine Rich with egf (EGF) Like Domains homolog [Source:UniProtKB/TrEMBL;Acc:A7LPH5])

HSP 1 Score: 159.844 bits (403), Expect = 6.381e-44
Identity = 107/271 (39.48%), Postives = 150/271 (55.35%), Query Frame = 1
Query:   49 RFMKFAIVLLCLTIKSIIGQTYEICEN---LVQEFQIGLQKSEKSNFGGGNTAWEEKRLGNYATSETRLVHILEKLC-PSSINNRE----------KCQYLRXXXXXXXXXWWFNIFKKDLNGLSLYHYLCVDYLKACCPPNYFGKSCELCHFHNETTGLTCSGHGKCDGNGTRIGNGTCVCYSGYTGTMCNECEFNYFQTTND-NGYTCTICHNSCVG-CHGPGYDECEKCAEGWNQEDSKCVDIDECSNATIC-DVNQYCLNTEGSFKC 810
            R +    VL+  T +  +    E C     LV  F  GL+K+ + +F GG+TAWEEK LG Y TSETRL+ +LE +C  SS+ N +          KC    E+ EE IEE+++N   +  N +S  ++LCV+ LK CCP  +FGK+CE C   +E   + C G G C G+G+R G+G C C +GYTG +C  C+  YF+ +    G  C  CH  C+G C       C KC  GW   +  C D++EC N + C   ++ C+NT GSFKC
Sbjct:    3 RILLLLAVLIGATSQKEVTIKNEKCRTCNFLVSTFDEGLKKTARHHFAGGDTAWEEKNLGKYKTSETRLIEVLEGVCKKSSLPNMDNFMGIAEIEFKCSTQLEKHEETIEEFYYN---QQHNNMS--NWLCVEQLKLCCPDGHFGKNCEQCPGLSEKADV-CFGKGSCHGDGSREGSGKCKCETGYTGNLCRYCDIEYFEESRTVQGVVCKKCHEGCLGVCSSESSKGCSKCKNGWKLTEEGCADVNECQNESACTKEHEICVNTVGSFKC 267          
BLAST of Cysteine-rich with EGF-like domains 2 vs. Ensembl Celegans
Match: B0393.5 (pep chromosome:WBcel235:III:4765833:4776342:1 gene:WBGene00007170.1 transcript:B0393.5.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:B0393.5)

HSP 1 Score: 59.3066 bits (142), Expect = 6.777e-9
Identity = 37/118 (31.36%), Postives = 56/118 (47.46%), Query Frame = 1
Query:  694 CAEGWNQEDSKCVDIDECS-NATICDVNQYCLNTEGSFKCASCDLSCANCTGFGNDKCVSCNNGYQKINNNCEDINECSADSELCREP--GQKCTNLPGSFSCDCIDSYVKQSDGSCK 1038
            C+EG+  +  +C D+DEC     +C  +  C NT GSF+C                   +C+ GY+  +  CED++EC    ++C +P  G KC N  G+F C C D Y       C+
Sbjct:  466 CSEGFTGDGFRCYDVDECEIPGAVCRDHSICSNTIGSFEC-------------------TCHGGYRFEDGKCEDVDECRELPKICGDPNKGTKCINKDGTFECLCKDGYEGDPSSECR 564          

HSP 2 Score: 55.4546 bits (132), Expect = 1.005e-7
Identity = 57/190 (30.00%), Postives = 86/190 (45.26%), Query Frame = 1
Query:  502 GKCDGNGTRIGNGTCVCYSGYTGTM-----CNECEFNYFQTTNDNGYTC---TICHNSCVGCHGPGYDECEKCAEGWNQEDSKCVDIDECSN-ATIC-DVNQ--YCLNTEGSFKCASCDLSCANCTGFGNDKCVSCNNGYQ-KINNNCEDINECSADSELCREPGQKCTNLPGSFSCDCIDSYVKQSDGS 1032
             +CD N  +  NG C C  G+TG        +ECE          G  C   +IC N+       G  EC  C  G+  ED KC D+DEC     IC D N+   C+N +G+F+C                    C +GY+   ++ C D+NEC  + + C  P  +CTN  G + C+C+  + + ++G+
Sbjct:  451 ARCDQNA-KCSNGVCTCSEGFTGDGFRCYDVDECEIP--------GAVCRDHSICSNTI------GSFEC-TCHGGYRFEDGKCEDVDECRELPKICGDPNKGTKCINKDGTFECL-------------------CKDGYEGDPSSECRDVNECK-NPDAC-GPNSQCTNTQGGYECECLAGFERIAEGA 603          
BLAST of Cysteine-rich with EGF-like domains 2 vs. Ensembl Celegans
Match: fbl-1 (Fibulin-1 [Source:UniProtKB/Swiss-Prot;Acc:O77469])

HSP 1 Score: 57.7658 bits (138), Expect = 1.722e-8
Identity = 38/115 (33.04%), Postives = 52/115 (45.22%), Query Frame = 1
Query:  694 CAEGWNQEDSKCVDIDECSNATICDVNQYCLNTEGSFKCASCDLSCANCTGFGNDKCVSCNNGYQ--KINNNCEDINECSADSELCREPGQKCTNLPGSFSCDCIDSYVKQSDGS 1032
            C  G+  ++  C DIDEC     C   + C+NT GSF+C                K   C +GY+       CED+NEC+     C    QKC N+PGS+ C C   +    DG+
Sbjct:  330 CPNGYYPKNGMCNDIDECVTGHNCGAGEECVNTPGSFRC--------------QQKGNLCAHGYEVNGATGFCEDVNECTTGIAACE---QKCVNIPGSYQCICDRGFALGPDGT 427          

HSP 2 Score: 50.8322 bits (120), Expect = 2.388e-6
Identity = 35/103 (33.98%), Postives = 49/103 (47.57%), Query Frame = 1
Query:  694 CAEGWNQEDSKCVDIDECS-NATICDVNQYCLNTEGSFKCASCDLSCANCTGFGNDKC--VSCNNGYQKINNNCEDINECSADSELCREPGQKCTNLPGSFSC 993
            C  GW  +   CVD+DEC+  +  C     C NT+GS++C +              +C  ++C NGY   N  C DI+EC          G++C N PGSF C
Sbjct:  268 CPMGWLFQHGHCVDVDECNLGSHDCGPLYQCRNTQGSYRCDAKKCGDGELQNPMTGECTSITCPNGYYPKNGMCNDIDECVTGHNC--GAGEECVNTPGSFRC 368          
BLAST of Cysteine-rich with EGF-like domains 2 vs. Ensembl Celegans
Match: fbl-1 (Fibulin-1 [Source:UniProtKB/Swiss-Prot;Acc:O77469])

HSP 1 Score: 57.3806 bits (137), Expect = 1.910e-8
Identity = 38/115 (33.04%), Postives = 52/115 (45.22%), Query Frame = 1
Query:  694 CAEGWNQEDSKCVDIDECSNATICDVNQYCLNTEGSFKCASCDLSCANCTGFGNDKCVSCNNGYQ--KINNNCEDINECSADSELCREPGQKCTNLPGSFSCDCIDSYVKQSDGS 1032
            C  G+  ++  C DIDEC     C   + C+NT GSF+C                K   C +GY+       CED+NEC+     C    QKC N+PGS+ C C   +    DG+
Sbjct:  330 CPNGYYPKNGMCNDIDECVTGHNCGAGEECVNTPGSFRC--------------QQKGNLCAHGYEVNGATGFCEDVNECTTGIAACE---QKCVNIPGSYQCICDRGFALGPDGT 427          

HSP 2 Score: 50.8322 bits (120), Expect = 2.141e-6
Identity = 35/103 (33.98%), Postives = 49/103 (47.57%), Query Frame = 1
Query:  694 CAEGWNQEDSKCVDIDECS-NATICDVNQYCLNTEGSFKCASCDLSCANCTGFGNDKC--VSCNNGYQKINNNCEDINECSADSELCREPGQKCTNLPGSFSC 993
            C  GW  +   CVD+DEC+  +  C     C NT+GS++C +              +C  ++C NGY   N  C DI+EC          G++C N PGSF C
Sbjct:  268 CPMGWLFQHGHCVDVDECNLGSHDCGPLYQCRNTQGSYRCDAKKCGDGELQNPMTGECTSITCPNGYYPKNGMCNDIDECVTGHNC--GAGEECVNTPGSFRC 368          
BLAST of Cysteine-rich with EGF-like domains 2 vs. Ensembl Fly
Match: CG11377 (gene:FBgn0031217 transcript:FBtr0078104)

HSP 1 Score: 169.859 bits (429), Expect = 2.561e-47
Identity = 109/274 (39.78%), Postives = 146/274 (53.28%), Query Frame = 1
Query:  121 CENLVQEFQIGLQKSEKSNFGGGNTAWEEKRLGNYATSETRLVHILEKLCPS-SINNREKCQYLRXXXXXXXXXWWFNIFKKDLNGLSLYHYLCVDYLKACCPPNYFGKSCELCHFHNETTGLTCSGHGKCDGNGTRIGNGTCVCYSGYTGTMCNECEFNYFQTTNDNG-YTCTICHNSCVGCHGPGY--DECEKCAEGWNQE-DSKCVDIDEC---SNATICDVNQYCLNTEGSFKCASCDLSCANCTGFGNDKCVSCNNGYQKINNNCEDIN 918
            C  LV  F+ GL+++ K    GG+TAWEE++L +Y  SE RLV I EKLC    + N++ C  L  E E  +E+W+ +   K      L  +LC+D L  CCP N +G  C  C          C+G+GKC G+GTR GNG C C  GY G  CNEC   ++++  D     CT CH +C      G     C KC +GW+ + ++ CVDI+EC        C   Q+C+N EGSF C  CD SC  C G G D C  C +GY+     C DI+
Sbjct:   34 CTQLVSSFRAGLERT-KRGHAGGDTAWEEEKLRSYKNSEVRLVEIQEKLCSEGEVINKDHCHNLANEHEALLEDWFIH---KQTESPDLQSWLCIDQLTVCCPLNTYGPDCLTC--------TECNGNGKCKGDGTRKGNGKCKCDPGYAGPNCNECGPEHYESFRDEKKLLCTQCHAACGEGGCTGGGPKSCRKCKKGWSMDSEAGCVDINECLEQQRPNPCRPQQFCVNNEGSFSCLECDRSCDGCDGDGPDMCRKCADGYELKEGKCHDIS 295          
BLAST of Cysteine-rich with EGF-like domains 2 vs. Ensembl Fly
Match: CG11377 (gene:FBgn0031217 transcript:FBtr0330636)

HSP 1 Score: 165.236 bits (417), Expect = 2.613e-46
Identity = 107/270 (39.63%), Postives = 143/270 (52.96%), Query Frame = 1
Query:  121 CENLVQEFQIGLQKSEKSNFGGGNTAWEEKRLGNYATSETRLVHILEKLCPS-SINNREKCQYLRXXXXXXXXXWWFNIFKKDLNGLSLYHYLCVDYLKACCPPNYFGKSCELCHFHNETTGLTCSGHGKCDGNGTRIGNGTCVCYSGYTGTMCNECEFNYFQTTND-NGYTCTICHNSCVGCHGPGY--DECEKCAEGWNQE-DSKCVDIDEC---SNATICDVNQYCLNTEGSFKCASCDLSCANCTGFGNDKCVSCNNGYQKINNNC 906
            C  LV  F+ GL+++ K    GG+TAWEE++L +Y  SE RLV I EKLC    + N++ C  L  E E  +E+W+ +   K      L  +LC+D L  CCP N +G  C  C          C+G+GKC G+GTR GNG C C  GY G  CNEC   ++++  D     CT CH +C      G     C KC +GW+ + ++ CVDI+EC        C   Q+C+N EGSF C  CD SC  C G G D C  C +GY+     C
Sbjct:   34 CTQLVSSFRAGLERT-KRGHAGGDTAWEEEKLRSYKNSEVRLVEIQEKLCSEGEVINKDHCHNLANEHEALLEDWFIH---KQTESPDLQSWLCIDQLTVCCPLNTYGPDCLTC--------TECNGNGKCKGDGTRKGNGKCKCDPGYAGPNCNECGPEHYESFRDEKKLLCTQCHAACGEGGCTGGGPKSCRKCKKGWSMDSEAGCVDINECLEQQRPNPCRPQQFCVNNEGSFSCLECDRSCDGCDGDGPDMCRKCADGYELKEGKC 291          
BLAST of Cysteine-rich with EGF-like domains 2 vs. Ensembl Fly
Match: Ten-m (gene:FBgn0004449 transcript:FBtr0306107)

HSP 1 Score: 61.6178 bits (148), Expect = 1.640e-9
Identity = 79/305 (25.90%), Postives = 105/305 (34.43%), Query Frame = 1
Query:  421 CPPNYFGKSCELCHFHNETTGLTCSGHGKCDGNGTRIGNGTCVCYSGYTGTMCNECEFNYFQTTNDNGYTCTICHNSCVGCHGPGYDECEKCAEGWNQEDSKCVDID------ECSNATICDVNQYCLNTEGSFK---CAS--CDLSCAN---CTG--------FGNDKC------VSCNNGYQKINNNCEDI--------------NECSADSELCREPGQ---KCTNLPG--------SFSCDCIDSYVKQSDGSCKFKEPSKKISSTDKPTNRKTTGGKNKN---RKQPKKIWTKKFEREFF 1167
            C P + GK C L   H+E     CSGHG C        +G C C  GY G  C E +             C   H +C G HG   D    C +GW   D   +D D      +CS     D++      E  +    C+   CDL C     C G        +G + C      V CN   Q  N  C  +              N C+   + CR  G+   +C    G        +   +C DS     DG    ++P    S   K +    +  K  +   RKQP  I    FER  F
Sbjct: 1119 CNPGWKGKECSL--RHDECEVADCSGHGHC-------VSGKCQCMRGYKGKFCEEVD-------------CP--HPNCSG-HGFCADGTCICKKGWKGPDCATMDQDALQCLPDCSGHGTFDLDTQTCTCEAKWSGDDCSKELCDLDCGQHGRCEGDACACDPEWGGEYCNTRLCDVRCNEHGQCKNGTCLCVTGWNGKHCTIEGCPNSCAGHGQ-CRVSGEGQWECRCYEGWDGPDCGIALELNCGDSKDNDKDGLVDCEDPECCASHVCKTSQLCVSAPKPIDVLLRKQPPAITASFFERMKF 1397          

HSP 2 Score: 50.8322 bits (120), Expect = 3.948e-6
Identity = 47/154 (30.52%), Postives = 61/154 (39.61%), Query Frame = 1
Query:  415 AC-CPPNYFGKSC--ELCHFHNETTGLTCSGHGKCDGNGTRIGNGTCVCYSGYTGTMCNECEFNYFQTTNDNGYTCTI--CHNSCVG-----CHGPGYDECEKCAEGW-----------NQEDSKCVDID--------ECSNATICDVNQYCLN 789
            AC C P + G+ C   LC        + C+ HG+C        NGTC+C +G+                  NG  CTI  C NSC G       G G  EC +C EGW           N  DSK  D D        EC  + +C  +Q C++
Sbjct: 1251 ACACDPEWGGEYCNTRLCD-------VRCNEHGQCK-------NGTCLCVTGW------------------NGKHCTIEGCPNSCAGHGQCRVSGEGQWEC-RCYEGWDGPDCGIALELNCGDSKDNDKDGLVDCEDPECCASHVCKTSQLCVS 1371          
BLAST of Cysteine-rich with EGF-like domains 2 vs. Ensembl Fly
Match: Ten-m (gene:FBgn0004449 transcript:FBtr0330159)

HSP 1 Score: 61.6178 bits (148), Expect = 1.656e-9
Identity = 79/305 (25.90%), Postives = 105/305 (34.43%), Query Frame = 1
Query:  421 CPPNYFGKSCELCHFHNETTGLTCSGHGKCDGNGTRIGNGTCVCYSGYTGTMCNECEFNYFQTTNDNGYTCTICHNSCVGCHGPGYDECEKCAEGWNQEDSKCVDID------ECSNATICDVNQYCLNTEGSFK---CAS--CDLSCAN---CTG--------FGNDKC------VSCNNGYQKINNNCEDI--------------NECSADSELCREPGQ---KCTNLPG--------SFSCDCIDSYVKQSDGSCKFKEPSKKISSTDKPTNRKTTGGKNKN---RKQPKKIWTKKFEREFF 1167
            C P + GK C L   H+E     CSGHG C        +G C C  GY G  C E +             C   H +C G HG   D    C +GW   D   +D D      +CS     D++      E  +    C+   CDL C     C G        +G + C      V CN   Q  N  C  +              N C+   + CR  G+   +C    G        +   +C DS     DG    ++P    S   K +    +  K  +   RKQP  I    FER  F
Sbjct: 1119 CNPGWKGKECSL--RHDECEVADCSGHGHC-------VSGKCQCMRGYKGKFCEEVD-------------CP--HPNCSG-HGFCADGTCICKKGWKGPDCATMDQDALQCLPDCSGHGTFDLDTQTCTCEAKWSGDDCSKELCDLDCGQHGRCEGDACACDPEWGGEYCNTRLCDVRCNEHGQCKNGTCLCVTGWNGKHCTIEGCPNSCAGHGQ-CRVSGEGQWECRCYEGWDGPDCGIALELNCGDSKDNDKDGLVDCEDPECCASHVCKTSQLCVSAPKPIDVLLRKQPPAITASFFERMKF 1397          

HSP 2 Score: 50.8322 bits (120), Expect = 3.852e-6
Identity = 47/154 (30.52%), Postives = 61/154 (39.61%), Query Frame = 1
Query:  415 AC-CPPNYFGKSC--ELCHFHNETTGLTCSGHGKCDGNGTRIGNGTCVCYSGYTGTMCNECEFNYFQTTNDNGYTCTI--CHNSCVG-----CHGPGYDECEKCAEGW-----------NQEDSKCVDID--------ECSNATICDVNQYCLN 789
            AC C P + G+ C   LC        + C+ HG+C        NGTC+C +G+                  NG  CTI  C NSC G       G G  EC +C EGW           N  DSK  D D        EC  + +C  +Q C++
Sbjct: 1251 ACACDPEWGGEYCNTRLCD-------VRCNEHGQCK-------NGTCLCVTGW------------------NGKHCTIEGCPNSCAGHGQCRVSGEGQWEC-RCYEGWDGPDCGIALELNCGDSKDNDKDGLVDCEDPECCASHVCKTSQLCVS 1371          
BLAST of Cysteine-rich with EGF-like domains 2 vs. Ensembl Fly
Match: Ten-m (gene:FBgn0004449 transcript:FBtr0078509)

HSP 1 Score: 60.4622 bits (145), Expect = 3.737e-9
Identity = 79/305 (25.90%), Postives = 105/305 (34.43%), Query Frame = 1
Query:  421 CPPNYFGKSCELCHFHNETTGLTCSGHGKCDGNGTRIGNGTCVCYSGYTGTMCNECEFNYFQTTNDNGYTCTICHNSCVGCHGPGYDECEKCAEGWNQEDSKCVDID------ECSNATICDVNQYCLNTEGSFK---CAS--CDLSCAN---CTG--------FGNDKC------VSCNNGYQKINNNCEDI--------------NECSADSELCREPGQ---KCTNLPG--------SFSCDCIDSYVKQSDGSCKFKEPSKKISSTDKPTNRKTTGGKNKN---RKQPKKIWTKKFEREFF 1167
            C P + GK C L   H+E     CSGHG C        +G C C  GY G  C E +             C   H +C G HG   D    C +GW   D   +D D      +CS     D++      E  +    C+   CDL C     C G        +G + C      V CN   Q  N  C  +              N C+   + CR  G+   +C    G        +   +C DS     DG    ++P    S   K +    +  K  +   RKQP  I    FER  F
Sbjct:  562 CNPGWKGKECSL--RHDECEVADCSGHGHC-------VSGKCQCMRGYKGKFCEEVD-------------CP--HPNCSG-HGFCADGTCICKKGWKGPDCATMDQDALQCLPDCSGHGTFDLDTQTCTCEAKWSGDDCSKELCDLDCGQHGRCEGDACACDPEWGGEYCNTRLCDVRCNEHGQCKNGTCLCVTGWNGKHCTIEGCPNSCAGHGQ-CRVSGEGQWECRCYEGWDGPDCGIALELNCGDSKDNDKDGLVDCEDPECCASHVCKTSQLCVSAPKPIDVLLRKQPPAITASFFERMKF 840          

HSP 2 Score: 49.6766 bits (117), Expect = 7.394e-6
Identity = 45/152 (29.61%), Postives = 60/152 (39.47%), Query Frame = 1
Query:  415 AC-CPPNYFGKSCELCHFHNETTGLTCSGHGKCDGNGTRIGNGTCVCYSGYTGTMCNECEFNYFQTTNDNGYTCTI--CHNSCVG-----CHGPGYDECEKCAEGW-----------NQEDSKCVDID--------ECSNATICDVNQYCLN 789
            AC C P + G+ C     +     + C+ HG+C        NGTC+C +G+                  NG  CTI  C NSC G       G G  EC +C EGW           N  DSK  D D        EC  + +C  +Q C++
Sbjct:  694 ACACDPEWGGEYC-----NTRLCDVRCNEHGQCK-------NGTCLCVTGW------------------NGKHCTIEGCPNSCAGHGQCRVSGEGQWEC-RCYEGWDGPDCGIALELNCGDSKDNDKDGLVDCEDPECCASHVCKTSQLCVS 814          
BLAST of Cysteine-rich with EGF-like domains 2 vs. Ensembl Zebrafish
Match: creld2 (cysteine-rich with EGF-like domains 2 [Source:NCBI gene;Acc:393495])

HSP 1 Score: 233.417 bits (594), Expect = 1.284e-71
Identity = 139/322 (43.17%), Postives = 183/322 (56.83%), Query Frame = 1
Query:   52 FMKFAIVLLCLTIKSIIGQTY----EICENLVQEFQIGLQKSEKSNFGGGNTAWEEKRLGNYATSETRLVHILEKLCPSSINNREKCQYLRXXXXXXXXXWWFNIFKKDLNGLSLYHYLCVDYLKACCPPNYFGKSCELCHFHNETTGLTCSGHGKCDGNGTRIGNGTCVCYSGYTGTMCNECEFNYFQT-TNDNGYTCTICHNSCVGCHGPGYDECEKCAEGW-NQEDSKCVDIDEC-SNATICDVNQYCLNTEGSFKCASCDLSCANCTGFGNDKCVSCNNGYQKINNNCEDINECSADSELCREPGQKCTNLPGSFSCD 996
            F  F I+LL L + SI  + +      C  LV +F  GL+K+ K NFGGGNTAWEE++L  Y TSE RL  ILE LC SS     +C ++ EE EE +E WWF   K+      L+ + C++ +K CCP   FG  C  C    +     C G+GKCDG+GTR GNG C C  GY G  C +C   YF +  ND  + C  CH SCVGC G     C++C  GW   ++  C+DI+EC  +   C  +QYCLNT+GSF C +CD+ C  C G G   C++C +GY+     C DI+EC+ D   C +  Q C N  GSFSC+
Sbjct:    8 FRLFCIILL-LQLGSIYTKDFTALCSTCRQLVDDFDKGLEKTAKQNFGGGNTAWEERKLSKYETSEIRLTEILEGLCQSS---NFECSHMLEENEEHLEAWWF---KRKTKHPDLFKWFCIETIKVCCPKGSFGPDCNTCIGGADRP---CHGNGKCDGDGTRAGNGKCSCDEGYDGEFCLDCSDGYFNSLRNDTFFLCKECHESCVGCSGGTNQHCKECRNGWVKDQEGSCIDINECIKDPAPCSDDQYCLNTDGSFSCKACDIRCTGCKGDGASSCLNCADGYKDEEGTCTDIDECTEDPASCSD-NQHCLNTDGSFSCE 318          
BLAST of Cysteine-rich with EGF-like domains 2 vs. Ensembl Zebrafish
Match: creld2 (cysteine-rich with EGF-like domains 2 [Source:NCBI gene;Acc:393495])

HSP 1 Score: 233.417 bits (594), Expect = 1.284e-71
Identity = 139/322 (43.17%), Postives = 183/322 (56.83%), Query Frame = 1
Query:   52 FMKFAIVLLCLTIKSIIGQTY----EICENLVQEFQIGLQKSEKSNFGGGNTAWEEKRLGNYATSETRLVHILEKLCPSSINNREKCQYLRXXXXXXXXXWWFNIFKKDLNGLSLYHYLCVDYLKACCPPNYFGKSCELCHFHNETTGLTCSGHGKCDGNGTRIGNGTCVCYSGYTGTMCNECEFNYFQT-TNDNGYTCTICHNSCVGCHGPGYDECEKCAEGW-NQEDSKCVDIDEC-SNATICDVNQYCLNTEGSFKCASCDLSCANCTGFGNDKCVSCNNGYQKINNNCEDINECSADSELCREPGQKCTNLPGSFSCD 996
            F  F I+LL L + SI  + +      C  LV +F  GL+K+ K NFGGGNTAWEE++L  Y TSE RL  ILE LC SS     +C ++ EE EE +E WWF   K+      L+ + C++ +K CCP   FG  C  C    +     C G+GKCDG+GTR GNG C C  GY G  C +C   YF +  ND  + C  CH SCVGC G     C++C  GW   ++  C+DI+EC  +   C  +QYCLNT+GSF C +CD+ C  C G G   C++C +GY+     C DI+EC+ D   C +  Q C N  GSFSC+
Sbjct:    8 FRLFCIILL-LQLGSIYTKDFTALCSTCRQLVDDFDKGLEKTAKQNFGGGNTAWEERKLSKYETSEIRLTEILEGLCQSS---NFECSHMLEENEEHLEAWWF---KRKTKHPDLFKWFCIETIKVCCPKGSFGPDCNTCIGGADRP---CHGNGKCDGDGTRAGNGKCSCDEGYDGEFCLDCSDGYFNSLRNDTFFLCKECHESCVGCSGGTNQHCKECRNGWVKDQEGSCIDINECIKDPAPCSDDQYCLNTDGSFSCKACDIRCTGCKGDGASSCLNCADGYKDEEGTCTDIDECTEDPASCSD-NQHCLNTDGSFSCE 318          
BLAST of Cysteine-rich with EGF-like domains 2 vs. Ensembl Zebrafish
Match: creld1b (cysteine-rich with EGF-like domains 1b [Source:ZFIN;Acc:ZDB-GENE-161219-1])

HSP 1 Score: 228.794 bits (582), Expect = 4.587e-69
Identity = 130/418 (31.10%), Postives = 211/418 (50.48%), Query Frame = 1
Query:   67 IVLLCLTIKSIIGQTYEICENLVQEFQIGLQKSEKSNFGGGNTAWEEKRLGNYATSETRLVHILEKLCPSSINNREKCQYLRXXXXXXXXXWWFNIFKKDLNGLSLYHYLCVDYLKACCPPNYFGKSCELCHFHNETTGLTCSGHGKCDGNGTRIGNGTCVCYSGYTGTMCNECEFNYFQ--TTNDNGYTCTICHNSCVGCHGPGYDECEKCAEGWNQEDSKCVDIDEC-SNATICDVNQYCLNTEGSFKCASCDLSCANCTGFGNDKCVSCNNGYQKINNNCEDINECSADSELCREPGQKCTNLPGSFSCDCIDSYVKQSDGSCKFKEPSKKISST-DKPTNRKTTGGKNKNRKQPKKIWTKKFEREFFKLICCIFLLGITSYFFGYYSLIVIVAALICGYYIYFKSIKLDQIFSK 1308
            ++L  L+++++   + + C  L   F  GL+++   NFGGGNTAWEE++L  YA SETRL+ I+E  C  S     +C  L E++E+++E WWF+   +      L+ +LC++ L+ CCP  ++G  C  C          C G G+C+G GTR+G+G CVC  GY G +C EC   Y++  ++N     C+ CH+SC  C GP   +C+ C  GW    S+C+D+DEC +    C  N YC NT+GS++C  CD +C  C G G  +C  C  G++     C DI+EC   +  C    + C N  GS+ C+C D ++++     +   P+       D  T+ +                    ++ FF ++ C            + ++ +   A + GY++  K  ++   F K
Sbjct:   12 LLLFSLSVETLSSSSCQTCRKLSHSFIKGLERTANKNFGGGNTAWEEEKLAKYARSETRLLEIVEAACDKS---DFECNRLLEQIEDQVETWWFH---RQQEAPDLFEWLCIEELRLCCPAGHYGPQCAEC---PSGPAGVCGGLGRCEGEGTRLGDGDCVCDPGYAGVLCQECADGYYREKSSNHTQPPCSACHHSCKVCSGPLEKQCQLCKSGWILHSSRCIDVDECGTELARCPSNTYCFNTDGSYECRGCDQACVGCMGSGPARCKKCARGFRLTGAKCLDIDECLERTIACPGLNEACVNEEGSYRCECADGFIRRDSICVENLTPAGPEKGLFDDMTDDEVL----------------VLQQMFFGVVICALATLAAKGDMVFTAIFIGGVAAMAGYWLSEKGDRVLDGFLK 404          
BLAST of Cysteine-rich with EGF-like domains 2 vs. Ensembl Zebrafish
Match: creld1a (cysteine-rich with EGF-like domains 1a [Source:ZFIN;Acc:ZDB-GENE-120111-4])

HSP 1 Score: 92.4337 bits (228), Expect = 1.202e-20
Identity = 50/154 (32.47%), Postives = 76/154 (49.35%), Query Frame = 1
Query:  640 CHNSCVGCHGPGYDECEKCAEGWNQEDSKCVDIDEC-SNATICDVNQYCLNTEGSFKCASCDLSCANCTGFGNDKCVSCNNGYQKINNNCEDINECSADSELCREPGQKCTNLPGSFSCDCIDSYVKQSDGSCKFKEPSKKISSTDKPTNRKTT 1098
            C + C  C GP  ++C +C  G+   D+ CVDIDEC ++   C  N YC NT GS++C  CD +C  C G G  +C  C  GY+     C D++EC  +   C      C N  GSF C C + + ++     + +   ++I    +  N K +
Sbjct:   98 CSDHCKACGGPENNQCLQCQTGFILHDNLCVDIDECGTDLDQCPHNTYCFNTRGSYECKGCDKACVGCMGGGAARCKKCAPGYRSSGLRCMDVDECGEEVLACAGLNVFCVNTEGSFQCQCAEGFTRREQNCERQQTSGRRIIPLLQVFNSKRS 251          

HSP 2 Score: 64.6994 bits (156), Expect = 3.273e-11
Identity = 32/83 (38.55%), Postives = 46/83 (55.42%), Query Frame = 1
Query:  568 GTMCNECEFNYFQTTNDNGYTCTICHNSCVGCHGPGYDECEKCAEGWNQEDSKCVDIDECSNATI--CDVNQYCLNTEGSFKC 810
            GT  ++C  N +       Y C  C  +CVGC G G   C+KCA G+     +C+D+DEC    +    +N +C+NTEGSF+C
Sbjct:  134 GTDLDQCPHNTYCFNTRGSYECKGCDKACVGCMGGGAARCKKCAPGYRSSGLRCMDVDECGEEVLACAGLNVFCVNTEGSFQC 216          
BLAST of Cysteine-rich with EGF-like domains 2 vs. Ensembl Zebrafish
Match: creld1a (cysteine-rich with EGF-like domains 1a [Source:ZFIN;Acc:ZDB-GENE-120111-4])

HSP 1 Score: 91.2781 bits (225), Expect = 2.122e-20
Identity = 65/224 (29.02%), Postives = 108/224 (48.21%), Query Frame = 1
Query:  640 CHNSCVGCHGPGYDECEKCAEGWNQEDSKCVDIDEC-SNATICDVNQYCLNTEGSFKCASCDLSCANCTGFGNDKCVSCNNGYQKINNNCEDINECSADSELCREPGQKCTNLPGSFSCDCIDSYVKQSDGSCKFKEPSKKISSTDKPTNRKTTGGKNKNRKQPKKIWTKKFEREFFKLICCIFLLGITSYFFGYYSLIVIVAALICGYYIYFKSIKLDQIFSK 1308
            C + C  C GP  ++C +C  G+   D+ CVDIDEC ++   C  N YC NT GS++C  CD +C  C G G  +C  C  GY+     C D++EC  +   C      C N  GSF C C + + ++ + +C+ ++ S   +S +K        G   + ++ + +  ++    FF ++ C            + S+ +  AA + GY++  KS +L   F K
Sbjct:   24 CSDHCKACGGPENNQCLQCQTGFILHDNLCVDIDECGTDLDQCPHNTYCFNTRGSYECKGCDKACVGCMGGGAARCKKCAPGYRSSGLRCMDVDECGEEVLACAGLNVFCVNTEGSFQCQCAEGFTRR-EQNCERQQTS---ASAEK--------GLFDDIQEDELMVLQQM---FFGVVLCALATLAAKGDLVFTSIFMGAAAAMAGYWLSDKSDRLIDTFMK 232          

HSP 2 Score: 63.929 bits (154), Expect = 4.728e-11
Identity = 32/83 (38.55%), Postives = 46/83 (55.42%), Query Frame = 1
Query:  568 GTMCNECEFNYFQTTNDNGYTCTICHNSCVGCHGPGYDECEKCAEGWNQEDSKCVDIDECSNATI--CDVNQYCLNTEGSFKC 810
            GT  ++C  N +       Y C  C  +CVGC G G   C+KCA G+     +C+D+DEC    +    +N +C+NTEGSF+C
Sbjct:   60 GTDLDQCPHNTYCFNTRGSYECKGCDKACVGCMGGGAARCKKCAPGYRSSGLRCMDVDECGEEVLACAGLNVFCVNTEGSFQC 142          
BLAST of Cysteine-rich with EGF-like domains 2 vs. Ensembl Xenopus
Match: CRELD2 (cysteine rich with EGF-like domains 2 [Source:NCBI gene;Acc:100497878])

HSP 1 Score: 234.572 bits (597), Expect = 1.131e-71
Identity = 141/354 (39.83%), Postives = 205/354 (57.91%), Query Frame = 1
Query:   64 AIVLLCLTIKSIIG--QTYEICENLVQEFQIGLQKSEKSNFGGGNTAWEEKRLGNYATSETRLVHILEKLCPSSINNREKCQYLRXXXXXXXXXWWFNIFKKDLNGLSLYHYLCVDYLKACCPPNYFGKSCELCHFHNETTGLTCSGHGKCDGNGTRIGNGTCVCYSGYTGTMCNECEFNYFQT-TNDNGYTCTICHNSCVGCHGPGYDECEKCAEGWNQEDSKCVDIDEC-SNATICDVNQYCLNTEGSFKCASCDLSCANCTGFGNDKCVSCNNGYQKINNNCEDINECSADSELCREPGQKCTNLPGSFSCDCIDSYVKQSDGSC-KFKEPSKKISSTDKPTNRKTTGGKN 1110
            A +L C+   + +   ++ E C  LV  F  GL+ + K NFGGGNTAWEEK L  Y +SE RLV I+E LC S+     +C ++ EE EE+IE+WWF + KK  +   L  + C++ +K CCPP  +G  C  C   +E     C  +G C G+GTRIG+G+C C + YTG  C EC   Y+ +  ND   TCT C+ +C  C+GP  ++C++C  GW ++  KCVD++EC S  + C  NQYCLNTEGSF C  CD SC +C+G G + C  C  GY  ++  C D++EC A   +C    + C N  GS+ C C + + +  DG+C K  E   ++ +++   N   T  ++
Sbjct:   11 AWLLFCVFCSAAVAKKESCETCRQLVDRFHKGLEDTRKKNFGGGNTAWEEKTLSKYESSEIRLVEIIENLCDST---DFECNHMVEEHEEQIEKWWFKMKKKYPD---LLKWFCIETIKVCCPPGTYGPDCLACLGGSERP---CHNNGFCTGDGTRIGDGSCHCKAEYTGPFCLECADGYYSSERNDTHSTCTACNQACQTCNGPSNEDCKECKNGWLKDGGKCVDLNECASEESPCKDNQYCLNTEGSFLCKGCDKSCISCSGEGPENCKDCATGYVLLDGICIDVDECDASENICVRENETCLNTAGSYKCICSEGF-EDKDGNCVKVMETEGEMGTSESDINILETAHED 354          
BLAST of Cysteine-rich with EGF-like domains 2 vs. Ensembl Xenopus
Match: aven (apoptosis, caspase activation inhibitor [Source:Xenbase;Acc:XB-GENE-6456683])

HSP 1 Score: 235.728 bits (600), Expect = 1.839e-71
Identity = 142/403 (35.24%), Postives = 207/403 (51.36%), Query Frame = 1
Query:  106 QTYEICENLVQEFQIGLQKSEKSNFGGGNTAWEEKRLGNYATSETRLVHILEKLCPSSINNREKCQYLRXXXXXXXXXWWFNIFKKDLNGLSLYHYLCVDYLKACCPPNYFGKSCELCHFHNETTGLTCSGHGKCDGNGTRIGNGTCVCYSGYTGTMCNECEFNYF-QTTNDNGYTCTICHNSCVGCHGPGYDECEKCAEGWNQEDSKCVDIDEC-SNATICDVNQYCLNTEGSFKCASCDLSCANCTGFGNDKCVSCNNGYQKINNNCEDINECSADSELCREPGQKCTNLPGSFSCDCIDSYVKQSDGSCKFKEPSKKISSTDKPTNRKTTGGKNKNRKQPKKIWTKKFEREFFKLICCIFLLGITSYFFGYYSLIVIVAALICGYYIYFKSIKLDQIFSK 1308
            Q  + C+NLV     G++K+   NFGGGNTAWEE++L  Y  SETRL+ ++E  C  S  +   C  + E+ EE +E WWF   KK      L+ +LC+D L+ CCP   FG  C  C    E     CSG+G+C+G+GTR G G C CY+ Y G +C +C   Y+ Q  N++   C+ C+ +C  C GPG D+C  C  GW   D KC+DIDEC +    C  NQ+C NT+GS++C  CD SC  C G G  +C  CN GY +    C D++EC ++   C+   ++C N  GSF+C C   Y +  DG C+   P    S+ +K      T  +               ++ FF ++ C            + ++ +   A + GY++  K  +    F K
Sbjct:   30 QLCQTCQNLVTNVLKGIEKTAGLNFGGGNTAWEEEKLSKYEISETRLLEVIETACDKSDFD---CNKMLEQNEEHMESWWF---KKQKEQPDLFQWLCMDTLRLCCPKGRFGADCLSCPGGTEKP---CSGNGQCNGDGTRFGTGVCDCYTSYGGPVCMDCALGYYEQARNESHLVCSECYRACSKCIGPGDDQCVLCKRGWLLHDGKCIDIDECGTEKDHCKSNQFCFNTDGSYECRECDKSCIGCMGGGPARCKKCNKGYYRDGVKCLDVDECDSELPKCKGSHEECVNTEGSFTCVCEKDYSR-IDGMCR---PDSYDSNAEKGLFDDITDDE-----------VVVLQQMFFGVVICALATLAAKGDMVFTAIFIGAVAAMAGYWLSEKGDRALDSFMK 408          
BLAST of Cysteine-rich with EGF-like domains 2 vs. Ensembl Xenopus
Match: aven (apoptosis, caspase activation inhibitor [Source:Xenbase;Acc:XB-GENE-6456683])

HSP 1 Score: 230.335 bits (586), Expect = 4.366e-69
Identity = 138/403 (34.24%), Postives = 206/403 (51.12%), Query Frame = 1
Query:  106 QTYEICENLVQEFQIGLQKSEKSNFGGGNTAWEEKRLGNYATSETRLVHILEKLCPSSINNREKCQYLRXXXXXXXXXWWFNIFKKDLNGLSLYHYLCVDYLKACCPPNYFGKSCELCHFHNETTGLTCSGHGKCDGNGTRIGNGTCVCYSGYTGTMCNECEFNYF-QTTNDNGYTCTICHNSCVGCHGPGYDECEKCAEGWNQEDSKCVDIDEC-SNATICDVNQYCLNTEGSFKCASCDLSCANCTGFGNDKCVSCNNGYQKINNNCEDINECSADSELCREPGQKCTNLPGSFSCDCIDSYVKQSDGSCKFKEPSKKISSTDKPTNRKTTGGKNKNRKQPKKIWTKKFEREFFKLICCIFLLGITSYFFGYYSLIVIVAALICGYYIYFKSIKLDQIFSK 1308
            Q  + C+NLV     G++K+   NFGGGNTAWEE++L  Y  SETRL+ ++E  C  S  +   C  + E+ EE +E WWF   KK      L+ +LC+D L+ CCP   FG  C  C    E     CSG+G+C+G+GTR G G C CY+ Y G +C +C   Y+ Q  N++   C+ C+ +C  C GPG D+C  C  GW   D KC+DIDEC +    C  NQ+C NT+GS++C  CD SC  C G G  +C  CN GY +    C D++EC ++   C+   ++C N  GSF+C C   Y +    S         I+   + +    + G   +    + +     ++ FF ++ C            + ++ +   A + GY++  K  +    F K
Sbjct:   55 QLCQTCQNLVTNVLKGIEKTAGLNFGGGNTAWEEEKLSKYEISETRLLEVIETACDKSDFD---CNKMLEQNEEHMESWWF---KKQKEQPDLFQWLCMDTLRLCCPKGRFGADCLSCPGGTEKP---CSGNGQCNGDGTRFGTGVCDCYTSYGGPVCMDCALGYYEQARNESHLVCSECYRACSKCIGPGDDQCVLCKRGWLLHDGKCIDIDECGTEKDHCKSNQFCFNTDGSYECRECDKSCIGCMGGGPARCKKCNKGYYRDGVKCLDVDECDSELPKCKGSHEECVNTEGSFTCVCEKDYSRIDGISLPL-----PITPISQNSVYLYSFGLFDDITDDEVV---VLQQMFFGVVICALATLAAKGDMVFTAIFIGAVAAMAGYWLSEKGDRALDSFMK 440          
BLAST of Cysteine-rich with EGF-like domains 2 vs. Ensembl Xenopus
Match: CRELD2 (cysteine rich with EGF-like domains 2 [Source:NCBI gene;Acc:100497878])

HSP 1 Score: 218.779 bits (556), Expect = 1.047e-65
Identity = 131/307 (42.67%), Postives = 184/307 (59.93%), Query Frame = 1
Query:  154 LQKSEKSNFGGGNTAWEEKRLGNYATSETRLVHILEKLCPSSINNREKCQYLRXXXXXXXXXWWFNIFKKDLNGLSLYHYLCVDYLKACCPPNYFGKSCELCHFHNETTGLTCSGHGKCDGNGTRIGNGTCVCYSGYTGTMCNECEFNYFQT-TNDNGYTCTICHNSCVGCHGPGYDECEKCAEGWNQEDSKCVDIDEC-SNATICDVNQYCLNTEGSFKCASCDLSCANCTGFGNDKCVSCNNGYQKINNNCEDINECSADSELCREPGQKCTNLPGSFSCDCIDSYVKQSDGSC-KFKEPSKKIS 1065
            L+ + K NFGGGNTAWEEK L  Y +SE RLV I+E LC S+     +C ++ EE EE+IE+WWF + KK  +   L  + C++ +K CCPP  +G  C  C   +E     C  +G C G+GTRIG+G+C C + YTG  C EC   Y+ +  ND   TCT C+ +C  C+GP  ++C++C  GW ++  KCVD++EC S  + C  NQYCLNTEGSF C  CD SC +C+G G + C  C  GY  ++  C D++EC A   +C    + C N  GS+ C C + + +  DG+C K  E  K ++
Sbjct:   37 LKDTRKKNFGGGNTAWEEKTLSKYESSEIRLVEIIENLCDST---DFECNHMVEEHEEQIEKWWFKMKKKYPD---LLKWFCIETIKVCCPPGTYGPDCLACLGGSERP---CHNNGFCTGDGTRIGDGSCHCKAEYTGPFCLECADGYYSSERNDTHSTCTACNQACQTCNGPSNEDCKECKNGWLKDGGKCVDLNECASEESPCKDNQYCLNTEGSFLCKGCDKSCISCSGEGPENCKDCATGYVLLDGICIDVDECDASENICVRENETCLNTAGSYKCICSEGF-EDKDGNCVKVMETGKTLN 333          
BLAST of Cysteine-rich with EGF-like domains 2 vs. Ensembl Xenopus
Match: CRELD2 (cysteine rich with EGF-like domains 2 [Source:NCBI gene;Acc:100497878])

HSP 1 Score: 216.468 bits (550), Expect = 4.183e-65
Identity = 130/306 (42.48%), Postives = 183/306 (59.80%), Query Frame = 1
Query:  157 QKSEKSNFGGGNTAWEEKRLGNYATSETRLVHILEKLCPSSINNREKCQYLRXXXXXXXXXWWFNIFKKDLNGLSLYHYLCVDYLKACCPPNYFGKSCELCHFHNETTGLTCSGHGKCDGNGTRIGNGTCVCYSGYTGTMCNECEFNYFQT-TNDNGYTCTICHNSCVGCHGPGYDECEKCAEGWNQEDSKCVDIDEC-SNATICDVNQYCLNTEGSFKCASCDLSCANCTGFGNDKCVSCNNGYQKINNNCEDINECSADSELCREPGQKCTNLPGSFSCDCIDSYVKQSDGSC-KFKEPSKKIS 1065
            + + K NFGGGNTAWEEK L  Y +SE RLV I+E LC S+     +C ++ EE EE+IE+WWF + KK  +   L  + C++ +K CCPP  +G  C  C   +E     C  +G C G+GTRIG+G+C C + YTG  C EC   Y+ +  ND   TCT C+ +C  C+GP  ++C++C  GW ++  KCVD++EC S  + C  NQYCLNTEGSF C  CD SC +C+G G + C  C  GY  ++  C D++EC A   +C    + C N  GS+ C C + + +  DG+C K  E  K ++
Sbjct:   20 EDTRKKNFGGGNTAWEEKTLSKYESSEIRLVEIIENLCDST---DFECNHMVEEHEEQIEKWWFKMKKKYPD---LLKWFCIETIKVCCPPGTYGPDCLACLGGSERP---CHNNGFCTGDGTRIGDGSCHCKAEYTGPFCLECADGYYSSERNDTHSTCTACNQACQTCNGPSNEDCKECKNGWLKDGGKCVDLNECASEESPCKDNQYCLNTEGSFLCKGCDKSCISCSGEGPENCKDCATGYVLLDGICIDVDECDASENICVRENETCLNTAGSYKCICSEGF-EDKDGNCVKVMETGKTLN 315          
BLAST of Cysteine-rich with EGF-like domains 2 vs. Ensembl Mouse
Match: Creld1 (cysteine-rich with EGF-like domains 1 [Source:MGI Symbol;Acc:MGI:2152539])

HSP 1 Score: 226.868 bits (577), Expect = 4.153e-68
Identity = 137/398 (34.42%), Postives = 202/398 (50.75%), Query Frame = 1
Query:  121 CENLVQEFQIGLQKSEKSNFGGGNTAWEEKRLGNYATSETRLVHILEKLCPSSINNREKCQYLRXXXXXXXXXWWFNIFKKDLNGLSLYHYLCVDYLKACCPPNYFGKSCELCHFHNETTGLTCSGHGKCDGNGTRIGNGTCVCYSGYTGTMCNECEFNYFQT-TNDNGYTCTICHNSCVGCHGPGYDECEKCAEGWNQEDSKCVDIDEC-SNATICDVNQYCLNTEGSFKCASCDLSCANCTGFGNDKCVSCNNGYQKINNNCEDINECSADSELCREPGQKCTNLPGSFSCDCIDSYVKQSDGSCKFKEPSKKISSTDKPTNRKTTGGKNKNRKQPKKIWTKKFEREFFKLICCIFLLGITSYFFGYYSLIVIVAALICGYYIYFKSIKLDQIFSK 1308
            C  LV  F  GL+++ + NFGGGNTAWEE++L  Y  SETRLV +LE +C  S     +C  L E  EE +E WWF+   +      L+ +LC D LK CCP   FG SC  C    E     C G+G+C+G GTR G+G C C +GY G  C +C   YF+   N +   C+ C   C  C GP    C +C +GW     KCVDIDEC +    C  +Q+C+NTEGS++C  C  +C  C G G  +C  C+ GYQ++ + C D++EC  ++ +C    +KC N  G + C C + Y +Q DG C  ++  +      + T  +                    ++ FF +I C            + ++ +   A + GY++  +S ++ + F K
Sbjct:   49 CRALVDNFNKGLERTIRDNFGGGNTAWEEEKLSKYKDSETRLVEVLEGVCSRSDF---ECHRLLELSEELVENWWFH---RQQEAPDLFQWLCSDSLKLCCPSGTFGPSCLPCPGGTERP---CGGYGQCEGEGTRGGSGHCDCQAGYGGEACGQCGLGYFEAERNSSHLVCSACFGPCARCTGPEESHCLQCKKGWALHHLKCVDIDECGTEQATCGADQFCVNTEGSYECRDCAKACLGCMGAGPGRCKKCSRGYQQVGSKCLDVDEC--ETVVCPGENEKCENTEGGYRCVCAEGY-RQEDGICVKEQVPESAGFFAEMTEDEMV----------------VLQQMFFGVIICALATLAAKGDLVFTAIFIGAVAAMTGYWLSERSDRVLEGFIK 418          
BLAST of Cysteine-rich with EGF-like domains 2 vs. Ensembl Mouse
Match: Creld2 (cysteine-rich with EGF-like domains 2 [Source:MGI Symbol;Acc:MGI:1923987])

HSP 1 Score: 216.468 bits (550), Expect = 4.879e-65
Identity = 128/326 (39.26%), Postives = 180/326 (55.21%), Query Frame = 1
Query:  121 CENLVQEFQIGLQKSEKSNFGGGNTAWEEKRLGNYATSETRLVHILEKLCPSSINNREKCQYLRXXXXXXXXXWWFNIFKKDLNGLSLYHYLCVDYLKACCPPNYFGKSCELCHFHNETTGLTCSGHGKCDGNGTRIGNGTCVCYSGYTGTMCNECEFNYFQ-TTNDNGYTCTICHNSCVGCHGPGYDECEKCAEGWNQEDSKCVDIDECSNAT-ICDVNQYCLNTEGSFKCASCDLSCANCTGFGNDKCVSCNNGYQKINNNCEDINECSADSELCREPGQKCTNLPGSFSCDCIDSYVKQSDGSCKFKEPSKKISSTDKPTNRK 1092
            C  LV +F  G+  + + NFGGGNTAWEEK L  Y  SE RL+ I+E LC SS     +C  L E+ EE++E WW  + K+  N   L+ + CV  LKACC P  +G  C+ C   +E     CSG+G C G+G+R G+G+C C++GY G +C +C   +F    N+    C+ C  SC  C GP   +C +C  GW + +  CVD+DEC+  T  C   QYC N  GS+ C  CD +C  CTG G   C  C  GY K +  C DI+ECS + + C+   + C N+PGSF C C + + +  D   +  E      +  +P +R+
Sbjct:   32 CRTLVDKFNQGMANTARKNFGGGNTAWEEKTLSKYEFSEIRLLEIMEGLCDSS---DFECNQLLEQQEEQLEAWWQTLKKEHPN---LFEWFCVHTLKACCLPGTYGPDCQECQGGSE---RPCSGNGYCSGDGSRQGDGSCQCHTGYKGPLCIDCTDGFFSLQRNETHSICSACDESCKTCSGPSNKDCIQCEVGWARVEDACVDVDECAAETSPCSDGQYCENVNGSYTCEDCDSTCVGCTGKGPANCKECIAGYTKESGQCTDIDECSLEEKACKRKNENCYNVPGSFVCVCPEGFEETEDACVQTAEGKVTEENPTQPPSRE 348          
BLAST of Cysteine-rich with EGF-like domains 2 vs. Ensembl Mouse
Match: Hmcn1 (hemicentin 1 [Source:MGI Symbol;Acc:MGI:2685047])

HSP 1 Score: 77.7962 bits (190), Expect = 2.544e-14
Identity = 65/210 (30.95%), Postives = 84/210 (40.00%), Query Frame = 1
Query:  463 FHNETTGLTCSGHGKCDGNG-------TRIGNGTCVCYSGYT--GTMC---NECEFNYFQTTNDNGYTCTICH--NSCVGCHGPGYDECEKCAEGWNQ-EDSKCVDIDECSNAT-ICDVNQYCLNTEGSFKCASCDLSCANCTGFGNDKCVSCNNGY--QKINNNCEDINECSADSELCREPGQKCTNLPGSFSCDCIDSYVKQSDG-SC 1035
            F   + GL+C    +C  +          IG+  C C +GY   G  C   NEC  N             +C     C    G GY   + C  G  + E+  C+DIDEC + T  C  NQ C NT GS++CA                   C  GY  Q +   C DINEC    + C     +C+N PGSF C C+       DG SC
Sbjct: 5180 FRRTSDGLSCQDINECQESSPCHQRCFNVIGSFHCGCEAGYQLKGRKCIDVNECRQN-------------VCRPDQHCKNTRG-GYKCIDLCPSGMTKAENGTCIDIDECKDGTHQCRYNQICENTRGSYRCA-------------------CPRGYRSQGVGRPCIDINECEQVPKPC---AHQCSNSPGSFKCICLPGQQLLGDGKSC 5353          

HSP 2 Score: 55.0694 bits (131), Expect = 2.556e-7
Identity = 33/104 (31.73%), Postives = 45/104 (43.27%), Query Frame = 1
Query:  688 EKCAEGWNQEDSKCVDIDECSNATICDVNQYCLNTEGSFKCASCDLSCANCTGFGNDKCVSCNNGYQKINN--NCEDINECSADSELCREPGQKCTNLPGSFSC 993
            + C EG       CVDIDEC N   C     C NT GS++C                    C  GY+ + N   C+D++EC   +  C  P + C N+ GS+ C
Sbjct: 5416 KTCPEGSEANHETCVDIDECQNRDTC--QHECKNTIGSYQCV-------------------CPPGYRLMLNGKTCQDVDECLEQNVRC-GPNRMCFNMRGSYQC 5497          
BLAST of Cysteine-rich with EGF-like domains 2 vs. Ensembl Mouse
Match: Hmcn1 (hemicentin 1 [Source:MGI Symbol;Acc:MGI:2685047])

HSP 1 Score: 72.7886 bits (177), Expect = 7.970e-13
Identity = 63/219 (28.77%), Postives = 89/219 (40.64%), Query Frame = 1
Query:  463 FHNETTGLTCSGHGKCDGNG-------TRIGNGTCVCYSGYT--GTMC---NECEFNYFQTTNDNGYTCTICH--NSCVGCHGPGYDECEKCAEGWNQ-EDSKCVDIDECSNAT-ICDVNQYCLNTEGSFKCA------------------------SCDLSCANCTGFGNDKCVSCNNGYQKINN--NCEDINECSADSELCREPGQKCTNLPGSFSC 993
            F   + GL+C    +C  +          IG+  C C +GY   G  C   NEC  N             +C     C    G GY   + C  G  + E+  C+DIDEC + T  C  NQ C NT GS++CA                        +C   C N    G+ +CV C  GY+ + N   C+D++EC   +  C  P + C N+ GS+ C
Sbjct: 5180 FRRTSDGLSCQDINECQESSPCHQRCFNVIGSFHCGCEAGYQLKGRKCIDVNECRQN-------------VCRPDQHCKNTRG-GYKCIDLCPSGMTKAENGTCIDIDECKDGTHQCRYNQICENTRGSYRCACPRGYRSQGVGRPCIDIDECQNRDTCQHECKNT--IGSYQCV-CPPGYRLMLNGKTCQDVDECLEQNVRC-GPNRMCFNMRGSYQC 5380          

HSP 2 Score: 72.4034 bits (176), Expect = 1.086e-12
Identity = 68/222 (30.63%), Postives = 90/222 (40.54%), Query Frame = 1
Query:  481 GLTCSGHGKCDGNGTRIGNGTCVCYSGYTGTMCNECEFNYFQTTNDNGYTC---------TICHNSCVGCHGPGYDECEKCAEGWNQEDSKCVDIDECSNATICDVNQYCLNTEGSFKCASCDLSCANCTGFGNDKCVSCNNGYQKINN-NCEDINECSADSELCREPGQKCTNLPGSFSCDCIDSYVKQSDGSCKFKEPSKKISSTDKPTNRKTTGGKNKN 1116
            G TC     CD     IG+  CV + G TG          F+ T+D G +C         + CH  C    G  +  CE    G+  +  KC+D++EC    +C  +Q+C NT G +KC   DL               C +G  K  N  C DI+EC   +  CR   Q C N  GS+ C C   Y  Q  G      P   I   D+  NR T   + KN
Sbjct: 5154 GHTCRAGQDCDNT---IGSYRCVVHCG-TG----------FRRTSD-GLSCQDINECQESSPCHQRCFNVIGSFHCGCEA---GYQLKGRKCIDVNECRQ-NVCRPDQHCKNTRGGYKC--IDL---------------CPSGMTKAENGTCIDIDECKDGTHQCRY-NQICENTRGSYRCACPRGYRSQGVG-----RPCIDI---DECQNRDTCQHECKN 5330          

HSP 3 Score: 59.6918 bits (143), Expect = 9.523e-9
Identity = 47/162 (29.01%), Postives = 68/162 (41.98%), Query Frame = 1
Query:  640 CHNSCVGCHGPGYDECEK----CAEGWNQEDSKCVDIDECS-NATICDVNQYCLNTEGSFKCASCDLSCANCTGFGNDKCVSCNNGYQKINN--NCEDINECSADSELCREPGQKCTNLPGSFSCDCIDSYVKQSDGSCKFKEPSKKISSTDKPTNRKTTGG 1104
            C ++C    G  Y  C K     A+G       C DIDEC+     C   Q C NT GS++C                  V C  G+++ ++  +C+DINEC  +S  C    Q+C N+ GSF C C   Y  +        E  + +   D+   + T GG
Sbjct: 5116 CSHTCHNAIGAYYCSCPKGLTIAADG-----RTCQDIDECALGGHTCRAGQDCDNTIGSYRCV-----------------VHCGTGFRRTSDGLSCQDINECQ-ESSPCH---QRCFNVIGSFHCGCEAGYQLKGRKCIDVNECRQNVCRPDQHC-KNTRGG 5250          
BLAST of Cysteine-rich with EGF-like domains 2 vs. Ensembl Mouse
Match: Hmcn2 (hemicentin 2 [Source:MGI Symbol;Acc:MGI:2677838])

HSP 1 Score: 72.0182 bits (175), Expect = 1.412e-12
Identity = 46/136 (33.82%), Postives = 64/136 (47.06%), Query Frame = 1
Query:  694 CAEGWNQEDSKCVDIDECSNATICDVNQYCLNTEGSFKCASCDLSCANCTGFGNDKCVSCNNGYQKI--NNNCEDINECSADSELCREPGQKCTNLPGSFSC---DCIDSYVK-QSDGSCKFKEPSKKISSTDKPT 1083
            C  G+ ++D  C D+DEC   ++C     C NTEGS+ C                    C +GY+ +    NC+DINEC  D   C  PGQ C N  GSF C    C  +Y +  S G+C F+  S+  S++   T
Sbjct: 4891 CPPGFIRQDGVCADLDECRVRSLC--QHACQNTEGSYYCL-------------------CPSGYRLLPSGKNCQDINECEEDGIEC-GPGQMCFNTRGSFQCVDTPCPTTYRQGSSPGTC-FRRCSQDCSASGPST 5003          

HSP 2 Score: 63.1586 bits (152), Expect = 8.213e-10
Identity = 40/134 (29.85%), Postives = 59/134 (44.03%), Query Frame = 1
Query:  640 CHNSCVGCHGPGYDECEKCAEG----WNQEDSKCVDIDECS-NATICDVNQYCLNTEGSFKCASCDLSCANCTGFGNDKCVSCNNGYQKI--NNNCEDINECSADSELCREPGQKCTNLPGSFSCDCIDSYVKQ 1020
            C ++C   + PG+  C  C  G    W+  +  C D+DEC+ N  +C   Q C+N  GS+ C +                 SC  G++     +NCED++EC    + C    Q C N PG   C C   Y +Q
Sbjct: 4679 CSHTCR--NAPGHFSCS-CPTGFSLAWDHRN--CRDVDECAGNTHLCQEEQRCVNLLGSYNCLA-----------------SCRPGFRVTADGSNCEDVDECLEQLDECHY-NQLCENTPGGHHCGCPRGYRQQ 4789          

HSP 3 Score: 59.3066 bits (142), Expect = 1.302e-8
Identity = 37/119 (31.09%), Postives = 55/119 (46.22%), Query Frame = 1
Query:  694 CAEGW--NQEDSKCVDIDECSNATICDVNQYCLNTEGSFKCASCDLSCANCTGFGNDKCVSCNNGYQKI--NNNCEDINECSADSELCREPGQKCTNLPGSFSC--DCIDSYVKQSDGS 1032
            C EG+  + + + CVD DECS       +  C N  G F C                   SC  G+     + NC D++EC+ ++ LC+E  Q+C NL GS++C   C   +   +DGS
Sbjct: 4653 CPEGFEPDVQGAFCVDKDECSGGP-SPCSHTCRNAPGHFSC-------------------SCPTGFSLAWDHRNCRDVDECAGNTHLCQEE-QRCVNLLGSYNCLASCRPGFRVTADGS 4750          
BLAST of Cysteine-rich with EGF-like domains 2 vs. UniProt/SwissProt
Match: sp|Q7SXF6|CREL2_DANRE (Cysteine-rich with EGF-like domain protein 2 OS=Danio rerio OX=7955 GN=creld2 PE=2 SV=2)

HSP 1 Score: 233.417 bits (594), Expect = 9.696e-71
Identity = 139/322 (43.17%), Postives = 183/322 (56.83%), Query Frame = 1
Query:   52 FMKFAIVLLCLTIKSIIGQTY----EICENLVQEFQIGLQKSEKSNFGGGNTAWEEKRLGNYATSETRLVHILEKLCPSSINNREKCQYLRXXXXXXXXXWWFNIFKKDLNGLSLYHYLCVDYLKACCPPNYFGKSCELCHFHNETTGLTCSGHGKCDGNGTRIGNGTCVCYSGYTGTMCNECEFNYFQT-TNDNGYTCTICHNSCVGCHGPGYDECEKCAEGW-NQEDSKCVDIDEC-SNATICDVNQYCLNTEGSFKCASCDLSCANCTGFGNDKCVSCNNGYQKINNNCEDINECSADSELCREPGQKCTNLPGSFSCD 996
            F  F I+LL L + SI  + +      C  LV +F  GL+K+ K NFGGGNTAWEE++L  Y TSE RL  ILE LC SS     +C ++ EE EE +E WWF   K+      L+ + C++ +K CCP   FG  C  C    +     C G+GKCDG+GTR GNG C C  GY G  C +C   YF +  ND  + C  CH SCVGC G     C++C  GW   ++  C+DI+EC  +   C  +QYCLNT+GSF C +CD+ C  C G G   C++C +GY+     C DI+EC+ D   C +  Q C N  GSFSC+
Sbjct:    8 FRLFCIILL-LQLGSIYTKDFTALCSTCRQLVDDFDKGLEKTAKQNFGGGNTAWEERKLSKYETSEIRLTEILEGLCQSS---NFECSHMLEENEEHLEAWWF---KRKTKHPDLFKWFCIETIKVCCPKGSFGPDCNTCIGGADRP---CHGNGKCDGDGTRAGNGKCSCDEGYDGEFCLDCSDGYFNSLRNDTFFLCKECHESCVGCSGGTNQHCKECRNGWVKDQEGSCIDINECIKDPAPCSDDQYCLNTDGSFSCKACDIRCTGCKGDGASSCLNCADGYKDEEGTCTDIDECTEDPASCSD-NQHCLNTDGSFSCE 318          
BLAST of Cysteine-rich with EGF-like domains 2 vs. UniProt/SwissProt
Match: sp|Q4V7M2|CRE2B_XENLA (Cysteine-rich with EGF-like domain protein 2-B OS=Xenopus laevis OX=8355 GN=creld2-b PE=2 SV=1)

HSP 1 Score: 233.417 bits (594), Expect = 2.061e-70
Identity = 138/343 (40.23%), Postives = 202/343 (58.89%), Query Frame = 1
Query:   64 AIVLLCLTIKSIIGQ--TYEICENLVQEFQIGLQKSEKSNFGGGNTAWEEKRLGNYATSETRLVHILEKLCPSSINNREKCQYLRXXXXXXXXXWWFNIFKKDLNGLSLYHYLCVDYLKACCPPNYFGKSCELCHFHNETTGLTCSGHGKCDGNGTRIGNGTCVCYSGYTGTMCNECEFNYFQT-TNDNGYTCTICHNSCVGCHGPGYDECEKCAEGWNQEDSKCVDIDEC-SNATICDVNQYCLNTEGSFKCASCDLSCANCTGFGNDKCVSCNNGYQKINNNCEDINECSADSELCREPGQKCTNLPGSFSCDCIDSYVKQSDGSCKFKEPSKKISSTDKP 1080
            A +LLCL+  + + +  + E C  LV+ F  GL+ + K NFGGGNTAWEEK L  Y +SE RLV I+E +C SS     +C ++ EE EE+IE+WWF + +K  +   L  + C++ +K CCP   +G  C  C   +E     C G+G C G+GTR G+G+C C + YTG+ C EC   Y+ +  ND    C  C+ +C  C+GP  ++C++C  GW ++D KCVD++EC S  + C  +QYCLNTEGSF C  CD SC+ C+G G + C  C  G+  ++  C D++EC A  +LC    + C N  GS+ C C + + +  +G+C       KI  T+ P
Sbjct:   11 AWLLLCLSCSAAVARKDSCETCTKLVERFHKGLENTAKKNFGGGNTAWEEKTLSKYESSEIRLVEIIENICDSS---DFECNHMVEEHEEQIEKWWFKMKQKYPD---LLKWFCIEAIKVCCPSGSYGPDCLACLGGSERP---CHGNGFCSGDGTRSGDGSCRCKAEYTGSFCLECSDGYYSSERNDTHAVCIACNQACKTCNGPSNEDCKECNNGWVKDDGKCVDLNECASEESPCKDSQYCLNTEGSFLCKECDGSCSGCSGEGPESCKDCATGFVMLSGKCTDVDECDASEKLCLRENEVCLNTAGSYKCTCSEGF-EDKEGNC------VKIMETENP 337          
BLAST of Cysteine-rich with EGF-like domains 2 vs. UniProt/SwissProt
Match: sp|Q5XH36|CRE2A_XENLA (Cysteine-rich with EGF-like domain protein 2-A OS=Xenopus laevis OX=8355 GN=creld2-a PE=2 SV=1)

HSP 1 Score: 232.261 bits (591), Expect = 5.644e-70
Identity = 133/309 (43.04%), Postives = 185/309 (59.87%), Query Frame = 1
Query:  115 EICENLVQEFQIGLQKSEKSNFGGGNTAWEEKRLGNYATSETRLVHILEKLCPSSINNREKCQYLRXXXXXXXXXWWFNIFKKDLNGLSLYHYLCVDYLKACCPPNYFGKSCELCHFHNETTGLTCSGHGKCDGNGTRIGNGTCVCYSGYTGTMCNECEFNYFQTTNDNGYT-CTICHNSCVGCHGPGYDECEKCAEGWNQEDSKCVDIDEC-SNATICDVNQYCLNTEGSFKCASCDLSCANCTGFGNDKCVSCNNGYQKINNNCEDINECSADSELCREPGQKCTNLPGSFSCDCIDSYVKQSDGSC 1035
            E C  LV  F  GL+ + K NFGGGNTAWEEK L  Y +SE RLV I+E LC SS     +C ++ EE EE+IE+WWF + KK  +   L  + C++ +K CCPP  +G  C  C   +E     C G+G C+G+GTR G+G C C + YTG  C EC   YF +  ++ Y+ CT C+ +C  C GP  ++C++C  GW ++D KCVD++EC S  + C  +QYCLNTEGSF C  CD SC  C+G G + C  C  GY  +   C D++EC A  ++C    + C N  GS+ C C + + +  +G+C
Sbjct:   30 ETCRKLVDRFHKGLENTAKKNFGGGNTAWEEKTLSKYESSEIRLVEIIENLCDSS---DFECNHMVEEHEEQIEKWWFKMKKKYPD---LLKWFCIETIKVCCPPGTYGPDCLACLGGSERP---CHGNGFCNGDGTRSGDGLCRCEAEYTGPFCLECADEYFSSERNDTYSLCTACNQACKTCDGPSNEDCKECKNGWIKDDGKCVDLNECASEESPCKDSQYCLNTEGSFLCKECDGSCLGCSGEGPENCKDCATGYVLLAEKCTDVDECDASEQVCSRENETCLNTAGSYKCTCSEGF-EDKEGNC 328          
BLAST of Cysteine-rich with EGF-like domains 2 vs. UniProt/SwissProt
Match: sp|Q5EA46|CREL1_BOVIN (Protein disulfide isomerase CRELD1 OS=Bos taurus OX=9913 GN=CRELD1 PE=2 SV=1)

HSP 1 Score: 228.024 bits (580), Expect = 9.402e-68
Identity = 140/398 (35.18%), Postives = 201/398 (50.50%), Query Frame = 1
Query:  121 CENLVQEFQIGLQKSEKSNFGGGNTAWEEKRLGNYATSETRLVHILEKLCPSSINNREKCQYLRXXXXXXXXXWWFNIFKKDLNGLSLYHYLCVDYLKACCPPNYFGKSCELCHFHNETTGLTCSGHGKCDGNGTRIGNGTCVCYSGYTGTMCNECEFNYFQT-TNDNGYTCTICHNSCVGCHGPGYDECEKCAEGWNQEDSKCVDIDEC-SNATICDVNQYCLNTEGSFKCASCDLSCANCTGFGNDKCVSCNNGYQKINNNCEDINECSADSELCREPGQKCTNLPGSFSCDCIDSYVKQSDGSCKFKEPSKKISSTDKPTNRKTTGGKNKNRKQPKKIWTKKFEREFFKLICCIFLLGITSYFFGYYSLIVIVAALICGYYIYFKSIKLDQIFSK 1308
            C  LV  F  GL+++ + NFGGGNTAWEE++L  Y  SETRLV +LE +C  S     +C  L E  EE +E WWF+   K      L+ +LC D LK CCP   FG SC  C    E     C G+G C+G GTR G+G C C +GY G  C +C   YF+   N +   C+ C   C  C GP    C +C +GW     KCVDIDEC +    C  +Q+C+NTEGS++C  C  +C  C G G  +C  C+ GYQ++ + C D++EC  ++ +C    Q+C N  GS+ C C D Y KQ +G C   +  +      + T  +                    ++ FF +I C            + ++ +   A + GY++  +S ++ + F K
Sbjct:   49 CRGLVDSFNKGLERTIRDNFGGGNTAWEEEKLSKYKDSETRLVEVLEGVCSKS---DFECHRLLELSEELVESWWFH---KQQEAPDLFQWLCSDSLKLCCPSGTFGPSCLPCPGGAERP---CGGYGHCEGEGTRGGSGHCDCQAGYGGEACGQCGLGYFEAERNASHLVCSACFGPCARCSGPEESHCLQCKKGWALHHLKCVDIDECGTERASCGADQFCVNTEGSYECRDCAKACLGCMGAGPGRCKKCSPGYQQVGSKCLDVDEC--ETAVCPGENQQCENTEGSYRCICADGY-KQMEGICVKDQIPESAGFFSEMTEDELV----------------VLQQMFFGVIICALATLAAKGDLVFTAIFIGAVAAMTGYWLSERSDRVLEGFIK 418          
BLAST of Cysteine-rich with EGF-like domains 2 vs. UniProt/SwissProt
Match: sp|Q2KIT5|CREL2_BOVIN (Protein disulfide isomerase CRELD2 OS=Bos taurus OX=9913 GN=CRELD2 PE=2 SV=1)

HSP 1 Score: 225.328 bits (573), Expect = 1.932e-67
Identity = 134/327 (40.98%), Postives = 182/327 (55.66%), Query Frame = 1
Query:  121 CENLVQEFQIGLQKSEKSNFGGGNTAWEEKRLGNYATSETRLVHILEKLCPSSINNREKCQYLRXXXXXXXXXWWFNIFKKDLNGLSLYHYLCVDYLKACCPPNYFGKSCELCHFHNETTGLTCSGHGKCDGNGTRIGNGTCVCYSGYTGTMCNECEFNYFQT-TNDNGYTCTICHNSCVGCHGPGYDECEKCAEGWNQEDSKCVDIDECS-NATICDVNQYCLNTEGSFKCASCDLSCANCTGFGNDKCVSCNNGYQKINNNCEDINECSADSELCREPGQKCTNLPGSFSCDCIDSYVKQSDGSCKFKEPSKKISSTDKPTNRKT 1095
            C  LV +F  G+  + K NFGGGNTAWEEK L  Y  SE RL+ I+E LC +S     +C  L EE EE +E WW  + KK  +   L+ + CV  LKACC P  +G  C  C   +E     CSG+G C G+GTR G+G+C C+ GY G +C++C   YF++ T++    C+ C  +C  C GP   +C +C  GW ++D  CVD+DEC+     C+  QYC N  GSF C  CD +C  CTG G  +C  C  GY K +  CEDI+ECS   + C    + C N PGSF C C D + +  D +C    P+   ++   PT   +
Sbjct:   31 CRELVDKFNQGMVDTAKKNFGGGNTAWEEKTLSKYEFSEVRLLEIVEGLCEASDF---ECNQLLEEQEELLEAWWLRLKKKHPD---LFEWFCVQTLKACCSPGTYGPDCLACQGGSERP---CSGNGHCVGDGTREGDGSCQCHLGYQGPLCSDCMDGYFRSPTSETHSICSACDEACKTCVGPTNRDCGQCEVGWVRQDDACVDVDECAAEPPPCEDTQYCENVNGSFVCEECDPTCMGCTGKGPTQCRECIAGYSKESGQCEDIDECSLAEKPCLRDNENCYNTPGSFVCVCPDGFEEAED-TCVQTRPAGAEATEASPTQPPS 347          
BLAST of Cysteine-rich with EGF-like domains 2 vs. TrEMBL
Match: A0A1Z1R2P1 (Cysteine rich with EGF-like domain (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 805.053 bits (2078), Expect = 0.000e+0
Identity = 407/412 (98.79%), Postives = 408/412 (99.03%), Query Frame = 1
Query:   85 TIKSIIGQTYEICENLVQEFQIGLQKSEKSNFGGGNTAWEEKRLGNYATSETRLVHILEKLCPSSINNREKCQYLRXXXXXXXXXWWFNIFKKDLNGLSLYHYLCVDYLKACCPPNYFGKSCELCHFHNETTGLTCSGHGKCDGNGTRIGNGTCVCYSGYTGTMCNECEFNYFQTTNDNGYTCTICHNSCVGCHGPGYDECEKCAEGWNQEDSKCVDIDECSNATICDVNQYCLNTEGSFKCASCDLSCANCTGFGNDKCVSCNNGYQKINNNCEDINECSADSELCREPGQKCTNLPGSFSCDCIDSYVKQSDGSCKFKEPSKKISSTDKPTNRKTTGGKNKNRKQPKKIWTKKFEREFFKLICCIFLLGITSYFFGYYSLIVIVAALICGYYIYFKSIKLDQIFSKSFVV 1320
            TIKSIIGQT EICENLVQEFQIGLQKSEKSNFGGGNTAWEEKRLGNYATSETRLVHILEKLCPSSINNREKCQYLR+EVEEKIEEWWFNIFKKDLNGLSLYHYLCVDYLKACCPPNYFGKSCELCHFHNETTGLTCSGHGKCDGNGTRIGNGTCVCYSGYTGTMCNECEFNYFQTTNDNGYTCTICHNSCVGCHGP YDECEKCAEGWNQEDSKCVDIDECSNATICDVNQYCLNTEGSFKC SCDLSCANCTGFGNDKCVSCNNGYQKINNNCEDINECSADSELCREPGQKCTNLPGSFSCDCIDSYVKQSDGSCKFKEPSKKISSTDKPTNRKTTGGKNKNRKQPKKIWTKKFEREFFKLICCIFLLGITSYF GYYSLIVIVAALICGYYIYFKSIKLDQIFSKSFVV
Sbjct:    1 TIKSIIGQTCEICENLVQEFQIGLQKSEKSNFGGGNTAWEEKRLGNYATSETRLVHILEKLCPSSINNREKCQYLRKEVEEKIEEWWFNIFKKDLNGLSLYHYLCVDYLKACCPPNYFGKSCELCHFHNETTGLTCSGHGKCDGNGTRIGNGTCVCYSGYTGTMCNECEFNYFQTTNDNGYTCTICHNSCVGCHGPSYDECEKCAEGWNQEDSKCVDIDECSNATICDVNQYCLNTEGSFKCGSCDLSCANCTGFGNDKCVSCNNGYQKINNNCEDINECSADSELCREPGQKCTNLPGSFSCDCIDSYVKQSDGSCKFKEPSKKISSTDKPTNRKTTGGKNKNRKQPKKIWTKKFEREFFKLICCIFLLGITSYFLGYYSLIVIVAALICGYYIYFKSIKLDQIFSKSFVV 412          
BLAST of Cysteine-rich with EGF-like domains 2 vs. TrEMBL
Match: A0A3Q0KQR3 (Cysteine-rich with egf-like domains protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 277.715 bits (709), Expect = 3.144e-84
Identity = 165/434 (38.02%), Postives = 232/434 (53.46%), Query Frame = 1
Query:   52 FMKFAIVLL----CLTIKSIIGQTYEICENLVQEFQIGLQKSEKSNFGGGNTAWEEKRLGNYATSETRLVHILEKLCPSSINNREKCQYLRXXXXXXXXXWWFNIFKKDLNGLSLYHY-LCVDYLKACCPPNYFGKSC---ELCHFHNETTGLTCSGHGKCDGNGTRIGNGTCVCYSGYTGTMCNECEF-NYFQTTNDNGYTCTICHNSCV-GCHGPGYDECEKCAEGWNQEDSK----CVDIDECSNATICDVNQYCLNTEGSFKCASCDLSCANCTGFGNDKCVSCNNGYQKINNN-CEDINECSADSELCREPGQKCTNLPGSFSCDCIDSYVKQSDGSCKFKEPSKKISSTDKPTNRKTTGGKN-KNRKQPKKIWTKKFEREFFKLICCIFLLGITSYFFGYYSLIVIVAALICGYYIYFKSIKLDQIFS 1305
             +   +VLL    C T+    G     C +  + F +G  KS   NFGGGN+ WEEK LG+Y+ SE R   I+E +C S +    KC    E +E  +E+WW   ++   N +  +   LCV   K CCP N FG SC     C+F            G+CDGNGTR G G+C+C  GYTG +C++C F  +FQ+ ND+  +C  CH SC  GC GP  + C  CA GW + DS     CVDI+EC ++       +CLN  GS++C  C  +C  C+G   + C SC +GYQ+ N + CEDINEC+ADS +C   G+ CTN  GSF CDC   Y + S G     +P K   ++DK   + T    N +NR   + IWT  + +EF K    +   G   +F   +   ++ A+L+ G Y+YF+SI  D +F+
Sbjct:    1 MLPLLVVLLNSIICPTLTIYPGDDCNKCRHAAKSFILGFHKSAGKNFGGGNSLWEEKHLGSYSVSEVRYHDIVEGIC-SDVKQAVKCHEFMESIEHHLEDWWLRDYRSYANKIEGFEEDLCVTRTKFCCPSNSFGNSCLPCPPCYFSG----------GRCDGNGTRSGTGSCICNDGYTGELCDKCTFETHFQSHNDSSISCLRCHLSCSSGCSGPYPENCSACASGWTEMDSGDQRGCVDINECVDSPCNRSTHFCLNKPGSYECVPCHSACNKCSGPTANDCESCASGYQRGNGDVCEDINECNADSNICNSEGELCTNTVGSFKCDCKSGYKRTSSGCVLAVKPEKGSKTSDKFETKSTVHNINSRNRNTQRIIWTVTYTKEFLKYSASLAAFGTFCWFAKGHPFAIMFASLLIGLYVYFQSINFDFVFT 423          
BLAST of Cysteine-rich with EGF-like domains 2 vs. TrEMBL
Match: A0A183NBE4 (Uncharacterized protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS25619 PE=4 SV=1)

HSP 1 Score: 272.707 bits (696), Expect = 3.008e-82
Identity = 161/423 (38.06%), Postives = 230/423 (54.37%), Query Frame = 1
Query:   73 LLCLTIKSIIGQTYEICENLVQEFQIGLQKSEKSNFGGGNTAWEEKRLGNYATSETRLVHILEKLCPSSINNREKCQYLRXXXXXXXXXWWFNIFKKDLNGLSLYHY-LCVDYLKACCPPNYFGKSCELCH---FHNETTGLTCSGHGKCDGNGTRIGNGTCVCYSGYTGTMCNECEF-NYFQTTNDNGYTCTICHNSCVG-CHGPGYDECEKCAEGWNQEDSK----CVDIDECSNATICDVNQYCLNTEGSFKCASCDLSCANCTGFGNDKCVSCNNGYQKINNN-CEDINECSADSELCREPGQKCTNLPGSFSCDCIDSYVKQSDGSCKFKEPSKKISSTDKPTNRKTTGGKN-KNRKQPKKIWTKKFEREFFKLICCIFLLGITSYFFGYYSLIVIVAALICGYYIYFKSIKLDQIFS 1305
            ++C T+          C++  + F +G  KS   NFGGGN+ WEEK LG+Y+ SE R   I+E +C S +    KC    E +E  +E+WW   ++ D N +  +   LCV   K CCP N FG SC  CH   F            G+CDGNGTR G G C+C  GYTG +C++C F  +FQ+ +D   +CT CH SC G C GP  + C  CA GW + DS     CVDI+EC ++       +CLN  GS++C  C  +C  C+G   + C SC +GYQ+ N + CEDINEC+ADS +C   G+ CTN  GSF CDC   Y + S+G     +P K   ++DK  ++ T    N +NR   + IWT  + +EF K    +       +F   +   ++ A+L+ G ++YF+SI  D +F+
Sbjct:   12 IICPTLAIYPDDDCNKCKHAAKSFILGFHKSAGKNFGGGNSLWEEKHLGSYSVSEARYHDIVEGIC-SDVKQAVKCHEFLESIEHHLEDWWLREYRSDSNKVEGFEEDLCVTRTKFCCPANSFGDSCLPCHPCYFFG----------GRCDGNGTRSGTGNCICNDGYTGELCDKCTFETHFQSHSDFPISCTRCHLSCSGGCSGPFPENCSACAAGWIKVDSGDQRGCVDINECIDSPCNRSTHFCLNKPGSYECVPCHPACNKCSGSTANDCESCASGYQRGNGDVCEDINECNADSNICNSEGESCTNTVGSFKCDCKSGYKRTSNGCVLDVKPRKGSQTSDKYESQSTVHNINSRNRNTQRIIWTVTYTKEFLKYSASLAAFATFCWFARGHPFAILFASLLIGSFVYFQSINFDFVFA 423          
BLAST of Cysteine-rich with EGF-like domains 2 vs. TrEMBL
Match: A0A183RJS5 (Uncharacterized protein OS=Schistosoma rodhaini OX=6188 PE=4 SV=1)

HSP 1 Score: 270.011 bits (689), Expect = 2.769e-81
Identity = 163/433 (37.64%), Postives = 231/433 (53.35%), Query Frame = 1
Query:   67 IVLLCLTIKSIIGQTYEI--------CENLVQEFQIGLQKSEKSNFGGGNTAWEEKRLGNYATSETRLVHILEKLCPSSINNREKCQYLRXXXXXXXXXWWFNIFKKDLNGLSLYHY-LCVDYLKACCPPNYFGKSC---ELCHFHNETTGLTCSGHGKCDGNGTRIGNGTCVCYSGYTGTMCNECEF-NYFQTTNDNGYTCTICHNSCVG-CHGPGYDECEKCAEGWNQEDSK----CVDIDECSNATICDVNQYCLNTEGSFKCASCDLSCANCTGFGNDKCVSCNNGYQKINNN-CEDINECSADSELCREPGQKCTNLPGSFSCDCIDSYVKQSDGSCKFKEPSKKISSTDKPTNRKTTGGKN-KNRKQPKKIWTKKFEREFFKLICCIFLLGITSYFFGYYSLIVIVAALICGYYIYFKSIKLDQIFS 1305
            + LL + + SII  T  I        C +  + F +G  KS   NFGGGN+ WEEK LG+Y+ SE R   I+E +C S +    KC    E +E  +E+WW   ++   N +  +   LCV   K CCP + FG SC     C+F            G+CDGNGTR G G+C+C  GYTG +C++C F  +FQ+ ND+  +C  CH SC G C GP  + C  CA GW + DS     CVDI+EC ++       +CLN  GS++C  C  +C  C+G   + C SC +GYQ+ N + CEDINEC+ADS +C   G+ CTN  GSF CDC   Y + S G     +  K   ++DK   + T    N +NR   + IWT  + +EF K    +   G   +F   +   ++ A+L+ G Y+Y +SI  D +F+
Sbjct:    2 LPLLAVLLNSIICPTLTIYPGDDCNKCRHAAKSFILGFHKSAGKNFGGGNSLWEEKHLGSYSVSEVRYHDIVEGIC-SDVKQAVKCHEFLESIEHHLEDWWLKDYRSYANKIEGFEEDLCVTRTKFCCPSSSFGNSCLPCPPCYFPG----------GRCDGNGTRSGTGSCICNDGYTGELCDKCTFETHFQSHNDSSISCLRCHLSCSGGCSGPFPENCSACASGWTEMDSGDQRGCVDINECVDSPCNRSTHFCLNKPGSYECVPCHSACNKCSGPTANDCESCASGYQRGNGDVCEDINECNADSNICNSEGELCTNTVGSFKCDCKSGYKRTSSGCVLAVKSEKGSKTSDKFETKSTVHNINSRNRNTQRIIWTVTYTKEFLKYSASLAAFGTFCWFAKGHPFAIMFASLLIGLYVYLQSINFDFVFT 423          
BLAST of Cysteine-rich with EGF-like domains 2 vs. TrEMBL
Match: A0A183NHU2 (Uncharacterized protein OS=Schistosoma mattheei OX=31246 GN=SMTD_LOCUS1678 PE=4 SV=1)

HSP 1 Score: 269.626 bits (688), Expect = 4.109e-81
Identity = 159/407 (39.07%), Postives = 224/407 (55.04%), Query Frame = 1
Query:  121 CENLVQEFQIGLQKSEKSNFGGGNTAWEEKRLGNYATSETRLVHILEKLCPSSINNREKCQYLRXXXXXXXXXWWFNIFKKDLNGLSLYHY-LCVDYLKACCPPNYFGKSCELCH---FHNETTGLTCSGHGKCDGNGTRIGNGTCVCYSGYTGTMCNECEF-NYFQTTNDNGYTCTICHNSCVG-CHGPGYDECEKCAEGWNQEDSK----CVDIDECSNATICDVNQYCLNTEGSFKCASCDLSCANCTGFGNDKCVSCNNGYQKINNN-CEDINECSADSELCREPGQKCTNLPGSFSCDCIDSYVKQSDGSCKFKEPSKKISSTDKPTNRKTTGGKN-KNRKQPKKIWTKKFEREFFKLICCIFLLGITSYFFGYYSLIVIVAALICGYYIYFKSIKLDQIFS 1305
            C++  + F +G  KS   NFGGGN+ WEEK LG+Y+ SE R   I+E +C S +    KC    E +E  +E+WW   ++ D N +  +   LCV   K CCP N FG SC  CH   F            G+CDGNGTR G G C+C  GYTG +C++C F  +FQ+ +D   +CT CH SC G C GP  + C  CA GW + DS     CVDI+EC ++       +CLN  GS++C  C  +C  C+G   + C SC +GYQ+ N + CEDINEC+ADS +C   G+ CTN  GSF CDC   Y + S G     +P K   ++ K  ++ T    N +NR   + IWT  + +EF K    +   G   +F   +   ++ A+L+ G ++YF+SI  D +F+
Sbjct:   28 CKHAAKSFILGFHKSAGKNFGGGNSLWEEKHLGSYSVSEVRYHDIVEGIC-SDVKQAVKCHEFLESIEHHLEDWWLREYRIDSNKVERFEEDLCVTRTKFCCPANSFGNSCLPCHPCYFFG----------GRCDGNGTRSGTGNCICNDGYTGELCDKCTFETHFQSHSDFPISCTRCHLSCSGGCSGPFPENCSACAAGWVKVDSGDQRGCVDINECIDSPCNRSTHFCLNKPGSYECVPCHPACNKCSGSTANDCESCASGYQRGNGDVCEDINECNADSNICNSEGESCTNTVGSFKCDCKSGYKRTSSGCVLDVKPRKGSQTSGKFESQSTVHNINSRNRNTQRIIWTVTYTKEFLKYSASLAAFGTFCWFAKGHPFAILFASLLIGSFVYFQSINFDFVFA 423          
BLAST of Cysteine-rich with EGF-like domains 2 vs. Ensembl Cavefish
Match: creld1b (cysteine rich with EGF like domains 1 [Source:NCBI gene;Acc:103029136])

HSP 1 Score: 223.787 bits (569), Expect = 3.369e-67
Identity = 133/400 (33.25%), Postives = 201/400 (50.25%), Query Frame = 1
Query:  115 EICENLVQEFQIGLQKSEKSNFGGGNTAWEEKRLGNYATSETRLVHILEKLCPSSINNREKCQYLRXXXXXXXXXWWFNIFKKDLNGLSLYHYLCVDYLKACCPPNYFGKSCELCHFHNETTGLTCSGHGKCDGNGTRIGNGTCVCYSGYTGTMCNECEFNYFQTTNDNG--YTCTICHNSCVGCHGPGYDECEKCAEGWNQEDSKCVDIDEC-SNATICDVNQYCLNTEGSFKCASCDLSCANCTGFGNDKCVSCNNGYQKINNNCEDINECSADSELCREPGQKCTNLPGSFSCDCIDSYVKQSDGSCKFKEPSKKISSTDKPTNRKTTGGKNKNRKQPKKIWTKKFEREFFKLICCIFLLGITSYFFGYYSLIVIVAALICGYYIYFKSIK-LDQIF 1302
            + C  L + F  GL+++   NFGGGNTAWEE++L  YA SETRL+ I+E  C  S     +C  L E++E+++E WWF+   +      L+ +LC++ L+ CCPP  FG  C  C              G+C+G GTR+G+G CVC  GY+G +C EC   Y++  + NG    C+ C+++C  C GP   +C  C  GW   D+KCVD+DEC +    C  N YC NT+GS++C  CD +C  C G G  +C  C+ GY+     C D+NEC   +  C    + C N  GSF C+C + ++++ D  C                N   TG +               ++ FF ++ C            + ++ +   A + GY++  K  + LD I 
Sbjct:   28 QTCRKLTENFIKGLERTANKNFGGGNTAWEEEKLAKYARSETRLLEIVEAACEKSDF---ECNRLLEQIEDQVETWWFH---RQQEAPDLFEWLCIEELRLCCPPGRFGPECSECPLGAGGVCGG---LGRCEGEGTRLGDGECVCDPGYSGPLCQECADGYYREKSSNGTRAPCSACYHACKKCSGPQEYKCLDCKPGWIHHDNKCVDVDECGTELARCPSNTYCFNTDGSYECRGCDQACVGCMGSGPARCKKCSRGYRLNGAKCLDVNECKEKAIACPGLNEACINEEGSFRCECAEGFIRR-DSICV--------------ENLPPTGPEKGLFDDMTDDEVLVLQQMFFGVVICALATLAAKGDMVFTAIFIGGVAAMAGYWLSEKGDRVLDGIL 403          
BLAST of Cysteine-rich with EGF-like domains 2 vs. Ensembl Cavefish
Match: creld2 (cysteine rich with EGF like domains 2 [Source:NCBI gene;Acc:103043646])

HSP 1 Score: 196.052 bits (497), Expect = 2.981e-57
Identity = 137/360 (38.06%), Postives = 188/360 (52.22%), Query Frame = 1
Query:   67 IVLLCLTIKSIIGQTYE------ICENLVQEFQIGLQKSEKSNFGGGNTAWEEKRLGNYATSETRLVHILEKLCPSSINNREKCQYLRXXXXXXXXXWWFNIFKKDLNGLSLYHYLCVDYLKACCPPNYFGKSCELCHFHNETTGLTCSGHGKCDGNGTRIGNGTCVCYSGYTGTMCNEC-EFNYFQTTNDNGYTCTICHNSCVGCHGPGYDECEKCAEGWNQ-EDSKCVDIDECSNATI-CDVNQYCLNTEGSFKCASCDLSCANCTGFGNDKCVSCNNGYQKINNNCEDINECSADSELCREPGQKCTNLPGSFSCDCIDSYVKQSDGSCKFKEP-------SKKISSTDKPTNRKTT 1098
            +  L L + +  G T E       C  +V  F  G +++   NFGGGNTAWEE++L  Y TSE RLV ILE LC S      +C ++ EE EE  E WWF   K+      L  + C++ +K CCP   FG  C  C    E     C G+G+CDG+GTR G+G C C  GY G  C +C E  Y +  ND    C  C+ SC  C G    +CE+C +GW + ++  CVDIDECS+    C   +YCLN +GS+ C+ CD  C+ C G G   C++C+ GY+     C D++EC    ++C E  Q+C N  GS+ C C +S  ++ DG C   +P            + D PT  K T
Sbjct:   10 LFCLILVLAAGSGSTREHKDLCSTCRQIVDNFNKGFERTANKNFGGGNTAWEERKLSKYETSEIRLVEILEGLCDSGSF---ECNHMVEEHEEHFETWWF---KRKTKHPDLLKWFCIETIKVCCPKGTFGPDCNTCVGGAERP---CHGNGRCDGDGTRGGDGKCSCDDGYEGDFCLDCAERFYNEERNDTFSLCKECYPSCTKCSGGTAQDCEECRDGWEEDQEGTCVDIDECSSDPFPCKEKEYCLNNDGSYSCSVCDSRCSGCKGPGPGNCLACSEGYKDEEGTCTDVDECELPDKVCTEEHQECVNTKGSYKCLC-ESGFQEQDGVC-VPQPETEESEEEPASDTEDSPTTDKVT 358          
BLAST of Cysteine-rich with EGF-like domains 2 vs. Ensembl Cavefish
Match: creld2 (cysteine rich with EGF like domains 2 [Source:NCBI gene;Acc:103043646])

HSP 1 Score: 194.897 bits (494), Expect = 6.048e-57
Identity = 131/332 (39.46%), Postives = 180/332 (54.22%), Query Frame = 1
Query:   67 IVLLCLTIKSIIGQTYE------ICENLVQEFQIGLQKSEKSNFGGGNTAWEEKRLGNYATSETRLVHILEKLCPSSINNREKCQYLRXXXXXXXXXWWFNIFKKDLNGLSLYHYLCVDYLKACCPPNYFGKSCELCHFHNETTGLTCSGHGKCDGNGTRIGNGTCVCYSGYTGTMCNEC-EFNYFQTTNDNGYTCTICHNSCVGCHGPGYDECEKCAEGWNQ-EDSKCVDIDECSNATI-CDVNQYCLNTEGSFKCASCDLSCANCTGFGNDKCVSCNNGYQKINNNCEDINECSADSELCREPGQKCTNLPGSFSCDCIDSYVKQSDGSC 1035
            +  L L + +  G T E       C  +V  F  G +++   NFGGGNTAWEE++L  Y TSE RLV ILE LC S      +C ++ EE EE  E WWF   K+      L  + C++ +K CCP   FG  C  C    E     C G+G+CDG+GTR G+G C C  GY G  C +C E  Y +  ND    C  C+ SC  C G    +CE+C +GW + ++  CVDIDECS+    C   +YCLN +GS+ C+ CD  C+ C G G   C++C+ GY+     C D++EC    ++C E  Q+C N  GS+ C C +S  ++ DG C
Sbjct:   10 LFCLILVLAAGSGSTREHKDLCSTCRQIVDNFNKGFERTANKNFGGGNTAWEERKLSKYETSEIRLVEILEGLCDS---GSFECNHMVEEHEEHFETWWF---KRKTKHPDLLKWFCIETIKVCCPKGTFGPDCNTCVGGAERP---CHGNGRCDGDGTRGGDGKCSCDDGYEGDFCLDCAERFYNEERNDTFSLCKECYPSCTKCSGGTAQDCEECRDGWEEDQEGTCVDIDECSSDPFPCKEKEYCLNNDGSYSCSVCDSRCSGCKGPGPGNCLACSEGYKDEEGTCTDVDECELPDKVCTEEHQECVNTKGSYKCLC-ESGFQEQDGVC 331          
BLAST of Cysteine-rich with EGF-like domains 2 vs. Ensembl Cavefish
Match: adgre5b.3 (adhesion G protein-coupled receptor E5b, duplicate 3 [Source:ZFIN;Acc:ZDB-GENE-121214-275])

HSP 1 Score: 61.2326 bits (147), Expect = 1.882e-9
Identity = 51/162 (31.48%), Postives = 76/162 (46.91%), Query Frame = 1
Query:  634 TICHNSCVGCHGPGYDECEKC------AEGWNQEDSKCVDIDECSNATICDVNQYCLNTEGSFKCASCDLSCANCTGFGNDKCVSCNNGYQKIN-NNCEDINECSADSELCREPGQKCTNLPGSFSCDCIDSYVKQSDGSCKFKEPSKKISSTDKPTNRKTT 1098
            ++CHN+     G  Y  C++       A+ +     +C DI+EC  ++ C  N YC NT GSF C                   +C  G+QK + + C DI+EC     +C E G  C N PGS+SC+C   Y   + G+ K K   K+I + D+  N+  T
Sbjct:   47 SLCHNT----DGSYYCSCQQGFHTRSGAQNFTATKDQCKDINECMTSSPCSENSYCSNTLGSFTC-------------------TCLPGFQKQSGSKCTDIDECDKMEHICGENG-SCRNSPGSYSCECNPGY--SNYGNKKTKCTGKRIRTPDQRLNQSET 182          
BLAST of Cysteine-rich with EGF-like domains 2 vs. Ensembl Cavefish
Match: fbln2 (fibulin 2 [Source:ZFIN;Acc:ZDB-GENE-060711-1])

HSP 1 Score: 60.8474 bits (146), Expect = 1.885e-9
Identity = 41/112 (36.61%), Postives = 57/112 (50.89%), Query Frame = 1
Query:  688 EKCAEGWNQE-DSKCVDIDECSNAT-ICDVNQYCLNTEGSFKCASCDLSCANCTGFGNDKCVSCNNGYQKINN--NCEDINECSADSELCREPGQKCTNLPGSFSCDCIDSY 1011
            ++C  G+ Q+  S C+DIDECS  +  C     C+NT GS+ C                K V+C+ G+   N+   C D++EC+  +  C E GQ C N PGSF CDC   Y
Sbjct:  149 QRCLTGFTQDTHSNCIDIDECSVLSDACTAGFNCINTVGSYTC--------------QRKVVTCSRGFHSSNDGTRCVDVDECAMGTHTCGE-GQVCHNTPGSFRCDCQTGY 245          

HSP 2 Score: 52.373 bits (124), Expect = 1.064e-6
Identity = 40/118 (33.90%), Postives = 51/118 (43.22%), Query Frame = 1
Query:  694 CAEGWNQED--SKCVDIDECSNAT-ICDVNQYCLNTEGSFKCASCDLSCANCTGFGNDKCVSCNNGYQ--KINNNCEDINEC-SADSELCREPGQKCTNLPGSFSCDCIDSYVKQSDG 1029
            C+ G++  +  ++CVD+DEC+  T  C   Q C NT GSF+C                    C  GYQ       C DINEC      LC    Q C N PGS+ C C   +    DG
Sbjct:  198 CSRGFHSSNDGTRCVDVDECAMGTHTCGEGQVCHNTPGSFRC-------------------DCQTGYQYDSARRTCLDINECWRFPGRLC---AQSCENTPGSYQCSCTSGFSLAFDG 293          
BLAST of Cysteine-rich with EGF-like domains 2 vs. Ensembl Sea Lamprey
Match: creld2 (cysteine-rich with EGF-like domains 2 [Source:NCBI gene;Acc:393495])

HSP 1 Score: 221.861 bits (564), Expect = 2.029e-67
Identity = 138/397 (34.76%), Postives = 198/397 (49.87%), Query Frame = 1
Query:  118 ICENLVQEFQIGLQKSEKSNFGGGNTAWEEKRLGNYATSETRLVHILEKLCPSSINNREKCQYLRXXXXXXXXXWWFNIFKKDLNGLSLYHYLCVDYLKACCPPNYFGKSCELCHFHNETTGLTCSGHGKCDGNGTRIGNGTCVCYSGYTGTMCNECEFN--YFQTTNDNGYTCTICHNSCVGCHGPGYDECEKCAEGWNQEDSK--CVDIDEC-SNATICDVNQYCLNTEGSFKCASCDLSCANCTGFGNDKCVSCNNGYQKINNNCEDINECSAD-SELCREPGQKCTNLPGSFSCDCIDSYVKQSDGSCKFKEPSKKISSTDKPTNRKTTGGKNKNRKQPKKIWTKKFEREFFKLICCIFLLGITSYFFGYYSLIVIVAALICGYYIYFKSIKL 1290
            +C  +V+ F+ G + + K NFGGGNTAWE +R+  Y  SETRLV ILE LC  +      C  + E+ EE +E+WWF+   K      LY + CV+  K CCP   FG  C  C    E T   C+G+G+CDG+GTR G G CVC+ GY G++C ECE    Y    ND    C+ CH++C  C GP +  C  C  G+ ++D +  CVD+DEC S  T C  +Q+C NTEGS+ C  CD +C  C   G D C  C  GY + +  C D+NEC    +  C    + C N  G + C+C   +  ++ G+CK  +P  +    D+ +  +                     +    ++ C            Y SL +  AA   GY++  +  +L
Sbjct:    4 MCRGIVENFKKGKENTAKKNFGGGNTAWEAERVAKYEQSETRLVEILESLCDKTAY---ACHAMLEQHEEHLEKWWFH---KQRAHPDLYSWFCVEMAKVCCPAGSFGPDCNQC--QGEAT-RPCAGNGRCDGDGTRRGTGLCVCHPGYVGSLCLECEEEGFYLAQHNDTHALCSACHSACKTCSGPQHTNCGDCRPGYAKQDEEGGCVDVDECASEPTPCHGSQFCSNTEGSYVCKVCDPACEGCKAAGPDSCHKCLRGYTERDGVCVDVNECEEGLATQCVRENEVCVNTEGGYRCECGPGFHDRA-GACKLVKPPGEQGLFDEISEDELV----------------VLRQMAVGVVLCALATLAAKGDMVYTSLFIGAAAATAGYWLSERGDRL 374          
BLAST of Cysteine-rich with EGF-like domains 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010139.1 (pep scaffold:Pmarinus_7.0:GL476784:79088:131893:1 gene:ENSPMAG00000009155.1 transcript:ENSPMAT00000010139.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.7734 bits (151), Expect = 1.708e-10
Identity = 49/145 (33.79%), Postives = 66/145 (45.52%), Query Frame = 1
Query:  670 PGYDECEKCAEGWNQEDSKCVDIDECSNATICDVNQYCLNTEGSFKCASCDL---------------SCANCTGFGNDKCVS--------CNNGYQKIN--NNCEDINECSADSELCREPGQKCTNLPGSFSCDCIDSYVKQSDG 1029
            PG  EC +C  G+   +  C+D+DEC++  +C  N  C NTEGS+ C  C                  C N    G   CV+        C  GY   +  + CEDINEC ++S +C EP   C N  GSF C C   Y   ++G
Sbjct:  847 PGSYECVRCPSGFEGRNGHCIDVDECADGNVCS-NGICANTEGSYSCTPCGTGFRLTSNGKACEDIDECQNGIVCGGGDCVNTRGSFQCECQPGYHLSSGGDQCEDINECLSES-VC-EPHGDCLNTDGSFYCVCHHGYKSSANG 988          

HSP 2 Score: 51.2174 bits (121), Expect = 5.479e-7
Identity = 36/107 (33.64%), Postives = 51/107 (47.66%), Query Frame = 1
Query:  688 EKCAEGWN-QEDSKCVDIDECSNATICDVNQYCLNTEGSFKCASCDLSCANCTGFGNDKCVSCNNGYQKINN--NCEDINECSADSELCREPGQKCTNLPGSFSCDC 999
            + C  G+     ++C DIDEC + T+C  N +C NTEGSF+C                    C+ GY  + +   C D+NEC   S +C +    C N+ GSF C C
Sbjct: 1062 QACDRGYRLSSTAECQDIDECLDDTVCGRNGFCENTEGSFRCL-------------------CDQGYHDLQDGQECIDVNECEMFSSVCGD-DALCENVEGSFLCIC 1148          
BLAST of Cysteine-rich with EGF-like domains 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008854.1 (pep scaffold:Pmarinus_7.0:GL476328:1008604:1022137:1 gene:ENSPMAG00000008009.1 transcript:ENSPMAT00000008854.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.077 bits (144), Expect = 9.764e-10
Identity = 40/116 (34.48%), Postives = 54/116 (46.55%), Query Frame = 1
Query:  691 KCAEGWNQEDSKCVDIDECSNATICDVNQYCLNTEGSFKCASCDLSCANCTGFGNDKCVSCNNGYQKINNNCEDINECSADSELCREPGQKCTNLPGSFSCDCIDSYVKQSDGSCK 1038
            +C  G+    + C D+DEC     C VN  CLNT GS+ C                    C  GY  +NN C D+NECS+ +     P  KC N  GS+SC C+  Y +   G+C+
Sbjct:  401 QCKAGYTGNGTVCTDVDECVKKP-CPVNTVCLNTFGSYTC-------------------QCAAGYIYLNNTCTDLNECSSVNLFSCPPNSKCVNAIGSYSCQCVPGY-QDVKGACQ 495          
BLAST of Cysteine-rich with EGF-like domains 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006555.1 (pep scaffold:Pmarinus_7.0:GL476370:200676:210822:-1 gene:ENSPMAG00000005922.1 transcript:ENSPMAT00000006555.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 59.6918 bits (143), Expect = 1.137e-9
Identity = 55/189 (29.10%), Postives = 84/189 (44.44%), Query Frame = 1
Query:  529 IGNGTCVCYSGYTG--TMCNECEFNYFQTTNDNGYTCTICHNSCVGCHGPGYDECEKCAEGWNQEDSKCVDIDEC--SNATICDVNQYCLNTEGSFKCA----------------SCDLSCANCTG-------FGNDKCVSCNNGYQKINNNCEDINECSADSELCREPGQKCTNLPGSFSCDCIDSYV 1014
            +G+  C C +GY G  T+C + +     + N +  +   C N+      PG  +C+ C  G+ +   KCVD++EC  S +  C    YC+NT GS+ C                  C L   NC+         G+ +C  C+ G+QK    C D+NEC         PG  C N  GS++C C+  Y+
Sbjct:  180 VGSYNCPCLAGYIGNGTVCLDVDECLLPSNNCSANS--TCKNT------PGSFQCQ-CDAGFQKTGEKCVDVNECQTSGSAACGPGAYCVNTVGSYNCPCLAGYIGNGTVCLDVDECLLPSNNCSANSTCKNTPGSFQC-QCDAGFQKTGEKCVDVNECQTSGSAACGPGAYCVNTVGSYNCLCLAGYI 358          

HSP 2 Score: 58.9214 bits (141), Expect = 1.973e-9
Identity = 55/189 (29.10%), Postives = 84/189 (44.44%), Query Frame = 1
Query:  529 IGNGTCVCYSGYTG--TMCNECEFNYFQTTNDNGYTCTICHNSCVGCHGPGYDECEKCAEGWNQEDSKCVDIDEC--SNATICDVNQYCLNTEGSFKCA----------------SCDLSCANCTG-------FGNDKCVSCNNGYQKINNNCEDINECSADSELCREPGQKCTNLPGSFSCDCIDSYV 1014
            +G+  C C +GY G  T+C + +     + N +  +   C N+      PG  +C+ C  G+ +   KCVD++EC  S +  C    YC+NT GS+ C                  C L   NC+         G+ +C  C+ G+QK    C D+NEC         PG  C N  GS++C C+  Y+
Sbjct:  732 VGSYNCPCLAGYIGNGTLCLDVDECLLPSNNCSANS--TCKNT------PGSFQCQ-CDAGFQKTGEKCVDVNECHTSGSAACGPGAYCVNTVGSYNCPCLAGYIGNGTLCLDVDECLLPSNNCSANSTCKNTPGSFQC-QCDAGFQKTGEKCVDVNECQTFGSAACGPGAYCVNTVGSYNCLCLAGYI 910          

HSP 3 Score: 57.3806 bits (137), Expect = 6.928e-9
Identity = 60/209 (28.71%), Postives = 85/209 (40.67%), Query Frame = 1
Query:  472 ETTGLTCSGHGKCDGNGTRIGNGTCVCYSGYTG--TMCNECEFNYFQTTN-DNGYTCTICHNSCVGCHGPGYDECEKCAEGWNQEDSKCVDIDECS--NATICDVNQYCLNTEGSFKCA----------------SCDLSCANCTG-------FGNDKCVSCNNGYQKINNNCEDINECSADSELCREPGQKCTNLPGSFSCDCIDSYV 1014
            E  G    GHG    N   +G+  C C  GY G  T+C + +     + N     TCT         + PG  +C+ C  G+ +    C D+DEC    +  C    YC+NT GS+ C                  C L   NC+         G+ +C  C+ G+QK    C D+NEC         PG  C N  GS++C C+  Y+
Sbjct:   80 EKAGSALCGHGAYCAN--TLGSYACRCLVGYVGNGTVCLDVDECLLPSNNCSANSTCT---------NTPGSYQCQ-CDAGFQKTGEMCTDVDECLKFGSAACGQGAYCVNTVGSYNCPCLAGYIGNGTVCLDVDECLLPSNNCSANSTCKNTPGSFQC-QCDAGFQKTGEKCVDVNECQTSGSAACGPGAYCVNTVGSYNCPCLAGYI 275          

HSP 4 Score: 51.9878 bits (123), Expect = 3.143e-7
Identity = 54/196 (27.55%), Postives = 84/196 (42.86%), Query Frame = 1
Query:  529 IGNGTCVCYSGYTG--TMCNECEFNYFQTTNDNGYTCTICHNSCVGCHGPGYDECEKCAEGWNQEDSKCVDIDEC--SNATICDVNQYCLNTEGSFKCA----------------SCDLSCANCTG-------FGNDKCVSCNNGYQKI-------NNNCEDINECSADSELCREPGQKCTNLPGSFSCDCIDSYV 1014
            +G+  C C +GY G  T+C + +     + N +  +   C N+      PG  +C+ C  G+ +   KCVD++EC  S +  C    YC+NT GS+ C                  C L   NC+         G+ +C  C+ G+Q +          C D+NEC         PG  C N  GS++C C+  Y+
Sbjct:  263 VGSYNCPCLAGYIGNGTVCLDVDECLLPSNNCSANS--TCKNT------PGSFQCQ-CDAGFQKTGEKCVDVNECQTSGSAACGPGAYCVNTVGSYNCLCLAGYIGNGTVCLDVDECLLPSNNCSANSTCKNTPGSFQC-QCDAGFQNVFPPPSETGEKCVDVNECHTSGSAACGPGAYCVNTVGSYNCLCLAGYI 448          

HSP 5 Score: 51.2174 bits (121), Expect = 5.040e-7
Identity = 55/188 (29.26%), Postives = 81/188 (43.09%), Query Frame = 1
Query:  529 IGNGTCVCYSGYTG--TMCNECEFNYFQTTNDNGYTCTICHNSCVGCHGPGYDECEKCAEGWNQEDSKCVDIDECSN--ATICDVNQYCLNTEGSFKCA----------------SCDLSCANCTG-------FGNDKCVSCNNGYQKINNNCEDINECSADSELCREPGQKCTNLPGSFSCDCIDSY 1011
            +G+  C C +GY G  T+C + +     + N +  +   C N+      PG  +C+ C  G+ +   KCVD++EC    +  C    YC+NT GS+ C                  C L   NC+         G+ +C  C+ G+Q     CEDINEC     +C   G  C N  GS+ C C   Y
Sbjct:  815 VGSYNCPCLAGYIGNGTLCLDVDECLLPSNNCSANS--TCKNT------PGSFQCQ-CDAGFQKTGEKCVDVNECQTFGSAACGPGAYCVNTVGSYNCLCLAGYIGNGTVCLDVDECLLPSNNCSANSTCKNTPGSFQC-QCDAGFQSNATVCEDINECGRVPAVCGL-GTVCENTVGSYRCPCAPGY 991          
BLAST of Cysteine-rich with EGF-like domains 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000017.1 (pep scaffold:Pmarinus_7.0:GL477746:39241:65692:1 gene:ENSPMAG00000000015.1 transcript:ENSPMAT00000000017.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.5362 bits (140), Expect = 3.306e-9
Identity = 64/227 (28.19%), Postives = 93/227 (40.97%), Query Frame = 1
Query:  424 PPNYFGKSCELCHFHNE--TTGLTCSGHGKCDGNGTRIGNGTCVCYSGYTG--TMCNECEFNYFQTTN-DNGYTCTICHNSCVGCHGPGYDECEKCAEGWNQEDSKCVDIDECS--NATICDVNQYCLNTEGSFKCA----------------SCDLSCANCTG-------FGNDKCVSCNNGYQKINNNCEDINECSADSELCREPGQKCTNLPGSFSCDCIDSYV 1014
            PP    +S E C   +E    G    GHG    N   +G+  C C  GY G  T+C + +     + N     TCT         + PG+ +C+ C  G+ +    C D+DEC    + +C    YC+N  GS+ C                  C L   NC+         G+ +C  C+ G+QK    C D+NEC         PG  C N  GS++C C+  Y+
Sbjct:  515 PPPQPPESGETCIDVDECQKAGSALCGHGAYCAN--TLGSYACRCLVGYVGNGTVCLDVDECLLPSNNCSANSTCT---------NTPGFYQCQ-CDAGFQKTGEMCTDVDECLKFGSAVCGQGAYCVNMVGSYNCPCLAGYIGNGTVCLDVDECQLPSNNCSANSTCKNTPGSFQC-QCDAGFQKTAEICVDVNECQTSGSAACGPGAYCVNTVGSYNCQCLAGYI 728          

HSP 2 Score: 57.7658 bits (138), Expect = 5.490e-9
Identity = 54/176 (30.68%), Postives = 75/176 (42.61%), Query Frame = 1
Query:  529 IGNGTCVCYSGYTGTMC------------NECEFNYFQTTNDNGYTCTICHNSCVGCHGPGYDECEKCAEGWNQEDSKCVDIDECSNATICDVN-QYCLNTEGSFKCASCDLSCANCTGFGNDKCVSCNNGYQKINNNCEDINECSADSELCREPGQKCTNLPGSFSCDCIDSYVK 1017
            IG+ +C+C SGY GT C            N C  N   T     YTC             GY+       GWN     C DIDEC     C+ N   C+NT+GS+ C                   +C  G+      C DINEC+A+  LC++  ++C N  GS+ C+C+  Y++
Sbjct:   70 IGSYSCICTSGYNGTTCEVTDINECISGQNNCPVNANCTNTIGSYTCAC---------KLGYE-----GNGWN-----CKDIDECMTGNHCNSNGSECMNTDGSYYC-------------------TCALGFTGNGTYCADINECTANPYLCQDT-EECMNGIGSYKCECLPGYIR 206          

HSP 3 Score: 52.373 bits (124), Expect = 2.663e-7
Identity = 58/216 (26.85%), Postives = 92/216 (42.59%), Query Frame = 1
Query:  526 RIGNGTCVCYSGYTGTMCNECEFNYFQTTNDNGYTCTICHNSCVGCHGPGYDECEKCAEGWNQEDSKCVDIDEC--SNATICDVNQYCLNTEGSFKCA----------------SCDLSCANCTG-------FGNDKCVSCNNGYQKINNNCEDINECSADSELCREPGQKCTNLPGSFSCDCIDSYVKQSDGSCKFKEPSKKISSTDKPTNRKTT 1098
             +G+  C C +GY G      + +  Q  ++N    + C N+      PG  +C+ C  G+ +    CVD++EC  S +  C    YC+NT GS+ C                  C L   NC+         G+ +C  C+ G+Q     CEDI+EC     +C   G  C N  GS+ C C   Y + ++ +    E S   + T+ P +R + 
Sbjct:  632 MVGSYNCPCLAGYIGNGTVCLDVDECQLPSNNCSANSTCKNT------PGSFQCQ-CDAGFQKTAEICVDVNECQTSGSAACGPGAYCVNTVGSYNCQCLAGYIGNGTVCLDVDECLLPSNNCSANSTCKNTPGSFQC-QCDAGFQSNATVCEDIDECGRVPTVCGL-GTVCENTVGSYRCPCAPGYQRNTNHT--ILETSFLYTFTNVPYHRASV 836          
BLAST of Cysteine-rich with EGF-like domains 2 vs. Ensembl Nematostella
Match: EDO45427 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RT96])

HSP 1 Score: 194.126 bits (492), Expect = 5.041e-58
Identity = 113/258 (43.80%), Postives = 154/258 (59.69%), Query Frame = 1
Query:  151 GLQKSEKSNFGGGNTAWEEKRLGNYATSETRLVHILEKLCPSSINNREKCQYLRXXXXXXXXXWWFNIFKKDLNGLSLYHYLCVDYLKACCPPNYFGKSCELCHFHNETTGLTCSGHGKCDGNGTRIGNGTCVCYSGYTGTMCNECEFNYFQTTNDNG-YTCTICHNSCV-GCHGPGYDECEKCAEGWNQ-EDSKCVDIDECSNAT---ICDVNQYCLNTEGSFKCASCDLSCANCTGFGNDKCVSCNNGYQKINNNC 906
            G++K+ K+NFGGGNT WEE++LG+YA SETRLV I+E LC SS     +C  + EE EE +E+WWF +  KD +   L  + C++ +K CCP   +G  C+ C     +    C+ HG C G GTR G+G C C+SGY G  C+EC  +Y++   D+G  +C  CH SC  GCHG    +C  C  GW Q E+  C D DEC+  T   +C   +YC N+ GSF+C +CD +C  C G G   C  C+ GYQ  +N C
Sbjct:    9 GMEKTVKANFGGGNTDWEERKLGSYARSETRLVEIVESLCGSS---EVRCHAMVEEHEEALEKWWFKLQDKDKD---LKVWFCINEIKVCCPNGTYGAECKECPGGKSS---PCNEHGDCQGAGTRSGSGKCDCHSGYEGDACDECTDDYYEDKGDDGKMSCKACHESCFGGCHGGTAKDCSACKSGWEQSEEEGCKDYDECAADTSNSLCSPGEYCKNSPGSFECKACDPACETCIGDGPGSCSKCSVGYQMKDNKC 257          
BLAST of Cysteine-rich with EGF-like domains 2 vs. Ensembl Nematostella
Match: EDO49409 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGE3])

HSP 1 Score: 61.6178 bits (148), Expect = 7.758e-12
Identity = 38/118 (32.20%), Postives = 61/118 (51.69%), Query Frame = 1
Query:  664 HGPGYDECEKCAEGWNQEDSKCVDIDECSNAT-ICDVNQYCLNTEGSFKCASCDLSCANCTGFGNDKCVSCNNGYQKINNNCEDINECSADSELCREPGQKCTNLPGSFSCDCIDSYV 1014
            + PG  +C KC +G+  +   C+D+DEC++ T +C +   CLNT GSF+C                   +C  G+      C+D+NEC  D   C +P  KC N+ GS++C C + ++
Sbjct:    3 NAPGSYDC-KCNKGFKGDGKTCLDVDECADGTAMCALKASCLNTLGSFRC-------------------NCIKGFTGDGKTCQDVNECGRDPSPC-DPNAKCINMMGSYACRCNEGFL 99          
BLAST of Cysteine-rich with EGF-like domains 2 vs. Ensembl Nematostella
Match: EDO39003 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBC0])

HSP 1 Score: 66.6254 bits (161), Expect = 1.454e-11
Identity = 66/200 (33.00%), Postives = 89/200 (44.50%), Query Frame = 1
Query:  505 KCDGNGT---RIGNGTCVCYSGYTGTMCNECEFNYFQTTNDNGYTC---TICHNSCVGCHGPGYDECEKCAEGWNQEDSKCVDIDECSNATI-CDVNQYCLNTEGSFKCA----------------SCDLS------CANCTGFGNDKCVSCNNGYQKINNNCEDINECSADSELCREPGQKCTNLPGSFSCDCIDSYVK 1017
            +C  N T    IG  TC C  G+TG   +  E N  +  +D  + C    IC N+       G   C  C +G++   + C D+DEC++A   C  +  C+NT GSF C+                 C LS       A+C+        SCN+G+Q     C DINEC   S  CR  G  C N  GSF+C C D YV+
Sbjct:  629 QCHSNATCNNTIGEYTCTCNVGFTG---DGYECNDTKECDDGSHLCDKHAICTNTL------GRFNC-TCVDGFHGNGTHCKDVDECAHALHNCHTHAICINTVGSFNCSCEAGFHGNGIDCKDMDECALSHHACHALASCSNTIGSYTCSCNDGFQGDGRYCGDINECMEKSHDCRT-GSICINKHGSFTCPCRDGYVR 817          
BLAST of Cysteine-rich with EGF-like domains 2 vs. Ensembl Nematostella
Match: EDO41904 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S357])

HSP 1 Score: 60.4622 bits (145), Expect = 1.054e-9
Identity = 42/133 (31.58%), Postives = 57/133 (42.86%), Query Frame = 1
Query:  694 CAEGWNQEDSKCVDIDECS-NATICDVNQYCLNTEGSFKCASCDLSCANCTGFGNDKCVSCNNGYQKINNNCEDINECSADSELCREPGQKCTNLPGSFSCDCIDSYVKQSDGSCKFKEPSKKISSTDKPTNR 1089
            C  G+   ++ C DIDEC  N + C  N+YC+N +GS+ C                    C  GY  +NN C D+NEC+    +C      C N  GSF C C   Y  +   +    E    IS+   P NR
Sbjct:   79 CKPGYTHVNNTCEDIDECKLNISTCPANRYCVNNDGSYTC-------------------RCKPGYTLVNNTCIDVNECTETPYVCSGENSICENTDGSFKCSCKPGYTPKFSKAVDIDECKLNISTC--PANR 190          

HSP 2 Score: 57.3806 bits (137), Expect = 1.144e-8
Identity = 66/228 (28.95%), Postives = 95/228 (41.67%), Query Frame = 1
Query:  532 GNGTCVCYSGYT-----GTMCNECEFNYFQTTNDNGYTCTICHNSCVGCHGPGYDECEKCAEGWNQEDSKCVDIDECS-NATICDVNQYCLNTEGSFKCASCDLSCANCTGFGNDKCVSCNNGYQKINNNCEDINECSADSELCREPGQKCTNLPGSFSCDCIDSYVKQSDGSCKFKEPSKKISSTDKPTNRKTTGGKNKNRKQPKKIWTKKFEREFFKLICCIFLLG 1197
            G+ TC C  GYT      T  NEC    +  + +N    +IC N+       G  +C  C  G+  + SK VDIDEC  N + C  N+YC+N +GS+ C                    C  GY  +NN CEDINEC+     C      C N  GS++C C   +   ++ +CK        +  + P   + T G  K + +P  I           +  C  +LG
Sbjct:  369 GSYTCRCKRGYTLVNKTCTDVNECTETPYVCSGEN----SICENT------DGSFKCS-CKPGYTPKFSKAVDIDECKLNISTCPANRYCVNNDGSYTC-------------------KCKPGYTLVNNTCEDINECALGVANCPASAD-CVNNNGSYTCRCKPGFTLVNN-TCKDINECADPADNNCPQECENTLGGYKCKCRPGYISIVTSSMNPLDINECDPILG 564          
BLAST of Cysteine-rich with EGF-like domains 2 vs. Ensembl Nematostella
Match: EDO50055 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RF87])

HSP 1 Score: 58.151 bits (139), Expect = 1.141e-9
Identity = 52/174 (29.89%), Postives = 66/174 (37.93%), Query Frame = 1
Query:  532 GNGTCVCYSGYTGTM------------CNECEFNYFQTTNDNGYTCTICHNSCVGCHGPGYDECEKCAEGWNQEDSKCVDIDECS-NATICDVNQYCLNTEGSFKCASCDLSCANCTGFGNDKCVSCNNGYQKINNNCEDINECSADSELCREPGQKCTNLPGSFSCDCIDSYV 1014
            G+ TC C  GYT T              + C  N +   ND  YTC                   KC  G+   ++ C DIDEC+     C  +  C+N +GS+ C                    C  GY   NN CED+NEC+ D   C E    CTN  GS+ C C   Y 
Sbjct:   73 GSFTCSCKPGYTPTFSGPVNIDECKLNISTCPANRYCVNNDGSYTC-------------------KCKPGYTLVNNTCEDIDECALGVATCPASADCVNNDGSYTC-------------------RCKRGYTLKNNECEDVNECARDPRPCHE-NAACTNTKGSYLCRCNSGYT 207          

HSP 2 Score: 49.6766 bits (117), Expect = 8.509e-7
Identity = 38/120 (31.67%), Postives = 48/120 (40.00%), Query Frame = 1
Query:  733 DIDECS-NATICDVNQYCLNTEGSFKCASCDLSCANCTGFGNDKCVSCNNGYQKINNNCEDINECSADSELCREPGQKCTNLPGSFSCDCIDSYVKQSDGSCKFKEPSKKISSTDKPTNR 1089
            DIDEC+     C  +  C+N +GS+ C                    C  GY+  NN CED+NEC     +C      C N  GSF+C C   Y     G     E    IS+   P NR
Sbjct:    9 DIDECALGVATCPASADCVNNDGSYTC-------------------RCKRGYELNNNECEDLNECVETPYVCSGDNSICQNTEGSFTCSCKPGYTPTFSGPVNIDECKLNISTC--PANR 107          
BLAST of Cysteine-rich with EGF-like domains 2 vs. Ensembl Medaka
Match: creld2 (cysteine rich with EGF like domains 2 [Source:NCBI gene;Acc:101171624])

HSP 1 Score: 236.113 bits (601), Expect = 1.611e-72
Identity = 137/360 (38.06%), Postives = 194/360 (53.89%), Query Frame = 1
Query:   46 FRFMKFAIVLL---CLTIKSIIGQTYEICENLVQEFQIGLQKSEKSNFGGGNTAWEEKRLGNYATSETRLVHILEKLCPSSINNREKCQYLRXXXXXXXXXWWFNIFKKDLNGLSLYHYLCVDYLKACCPPNYFGKSCELCHFHNETTGLTCSGHGKCDGNGTRIGNGTCVCYSGYTGTMCNECEFNYFQT-TNDNGYTCTICHNSCVGCHGPGYDECEKCAEGWNQEDSK-CVDIDECS-NATICDVNQYCLNTEGSFKCASCDLSCANCTGFGNDKCVSCNNGYQKINNNCEDINECSADSELCREPGQKCTNLPGSFSCDCIDSYVKQSDGSCKFKEPSKKISSTDKPTNRKTTGGK 1107
             R +    +LL    +  K  +      C  +   F  G  ++ K NFGGGNTAWEE++L  Y TSE RLV ILE+LC SS     +C  + EE EE  E WWF   K+      L+ + CV+ LK CCP   FG  C  C   +E     C G G CDG+GTR GNG C C  GY G  C +C   +F    ND    C  CH +C  C G    +C++C EGW ++D + CVD++EC+ + + C   +YCLN+EGS+ C +CD +C+ C+G G+D+C +C NGY+ +  +C+DI+ECS    +C +  Q+C N  GS+ C C   +  Q DG C   +   +      P   + + G+
Sbjct:    9 LRLLSCVTILLVFHAVVAKKDLKSACSTCRQITDNFNKGFDRTAKQNFGGGNTAWEERKLSKYETSEIRLVEILEELCESSSF---ECNQMVEENEELFETWWF---KRKTKNPDLHKWFCVETLKVCCPKGTFGPDCTACVGGSEKP---CHGRGACDGDGTRGGNGKCSCDHGYKGDHCLDCTDGFFNAERNDTFSLCAECHAACKTCDGASSQDCDECKEGWEEDDQEACVDVNECARDPSPCKEEEYCLNSEGSYSCKACDEACSGCSGAGSDECQACANGYRHVEGSCKDIDECSEPEAVCTQEHQECLNTHGSYRCLCSAGFQDQ-DGECVQTQDQDQTEEPGSPDAAENSHGE 358          
BLAST of Cysteine-rich with EGF-like domains 2 vs. Ensembl Medaka
Match: creld1b (cysteine rich with EGF like domains 1 [Source:NCBI gene;Acc:101170184])

HSP 1 Score: 223.402 bits (568), Expect = 1.276e-66
Identity = 134/424 (31.60%), Postives = 209/424 (49.29%), Query Frame = 1
Query:   46 FRFMKFAIVLLCLTIKSIIGQTYEICENLVQEFQIGLQKSEKSNFGGGNTAWEEKRLGNYATSETRLVHILEKLCPSSINNREKCQYLRXXXXXXXXXWWFNIFKKDLNGLSLYHYLCVDYLKACCPPNYFGKSCELCHFHNETTGLTCSGHGKCDGNGTRIGNGTCVCYSGYTGTMCNECEFNYFQ--TTNDNGYTCTICHNSCVGCHGPGYDECEKCAEGWNQEDSKCVDIDEC-SNATICDVNQYCLNTEGSFKCASCDLSCANCTGFGNDKCVSCNNGYQKINNNCEDINECSADSELCREPGQKCTNLPGSFSCDCIDSYVKQSDGSCKFKEPSKKISSTDKPTNRKTTGGKNKNRKQPKKIWTKKFEREFFKLICCIFLLGITSYFFGYYSLIVIVAALICGYYIYFKSIKLDQIFSK 1308
            + F+   ++   L++  +     + C+ L +    GL+++   NFGGGNTAWEE++L  YA SETRL+ I+E  C  +     +C  L E++E+++E WWF+   +      L+ +LC++ L  CCPP  FG  C+ C              G+C+G GTR+G+G C+C  GY+G +C  C   Y++  ++ND+   C  C+ SC  C GP   +C  C  GW   D+KCVDIDEC +    C  N YC NTEGS++C  CD +C  C G G  +C  C  GY+     C DI+EC+  +  C    + C N  GSF CDC D ++++             I   +KP      G  +        +     ++ FF ++ C            + ++ +   A + GY++  K   +   F K
Sbjct:   38 WPFLPALMLFSELSVIKVQTAPCQTCKKLTESLITGLERTANKNFGGGNTAWEEEKLAKYARSETRLLEIVESACEKA---DFECNRLLEQIEDQVETWWFH---RQQEAPDLFEWLCIEELSLCCPPGRFGPECKECPSGPGGVCGG---LGRCEGEGTRLGDGECICDPGYSGQLCQNCADGYYREKSSNDSAGACAACYRSCRKCSGPEDYKCLACKPGWILHDNKCVDIDECGTELARCPSNTYCHNTEGSYECRGCDQACVGCMGSGPARCKKCARGYRLKGAKCLDIDECNERAIACPGLNEACINEEGSFHCDCADGFIRRD-----------SICVENKPPAGPEKGLFDDMTDDEVLV----LQQMFFGVVICALATLAAKGDMVFTAIFIGGVAAMAGYWLTEKGDYMLDGFLK 437          
BLAST of Cysteine-rich with EGF-like domains 2 vs. Ensembl Medaka
Match: ENSORLT00000000411.2 (latent-transforming growth factor beta-binding protein 1 [Source:NCBI gene;Acc:101168560])

HSP 1 Score: 62.7734 bits (151), Expect = 7.965e-10
Identity = 39/122 (31.97%), Postives = 57/122 (46.72%), Query Frame = 1
Query:  673 GYDECEKCAEGWNQEDSKCVDIDECSNATICDVNQYCLNTEGSFKCASCDLSCANCTGFGNDKCVSCNNGYQ--KINNNCEDINECSADSELCREPGQKCTNLPGSFSCDCIDSYVKQSDGS 1032
            G   C  C  G+   + +C D+DEC +A  C+ ++ C+NT GSF+C                    C  GYQ   +   C DINEC  + + C   G +C N PGS+ C C   +   S+G+
Sbjct: 1060 GSYRCVSCRSGYKLTNRQCTDVDECESAAACEADRRCVNTAGSFRC-------------------ECLPGYQASSLGRQCRDINEC-LEGDFCFS-GGECLNTPGSYMCVCSQGFTLSSNGT 1160          

HSP 2 Score: 52.373 bits (124), Expect = 1.349e-6
Identity = 39/119 (32.77%), Postives = 51/119 (42.86%), Query Frame = 1
Query:  670 PGYDECEKCAEGWNQEDSKCVDIDECSNATICDVNQYCLNTEGSFKCASCDLSCANCTGFGNDKCVSCNNGYQKINNNCEDINECSADSELCREPGQKCTNLPGSFSCDCIDSYVKQSD 1026
            PG   C  C  G+    + C D+DEC +   C   Q C+NT GS++C                   SC  GY  +N  C DI+EC      C     +C N PGS+ C C   Y  Q+D
Sbjct:  942 PGSYRC-VCRHGYRLSGNTCTDVDECVDPLRCP-GQECVNTLGSYRC------------------TSCQPGYGLLNGLCTDIDECRQSP--CSN--ARCENTPGSYRCVCRPGYRLQND 1036          
BLAST of Cysteine-rich with EGF-like domains 2 vs. Ensembl Medaka
Match: fbln2 (fibulin 2 [Source:ZFIN;Acc:ZDB-GENE-060711-1])

HSP 1 Score: 60.8474 bits (146), Expect = 2.338e-9
Identity = 46/121 (38.02%), Postives = 60/121 (49.59%), Query Frame = 1
Query:  670 PGYDEC---EKCAEGWNQE-DSKCVDIDECSN-ATICDVNQYCLNTEGSFKCASCDLSCANCTGFGNDKCVSCNNGYQKINN--NCEDINECSADSELCREPGQKCTNLPGSFSCDCIDSY 1011
            PG  +C   +KC  G+ Q+    CVDI+ECS+ A  C  +  C+NT GSF C                K + CN GY    +  +C D++EC   S  C   GQ C NLPGS+ CDC   Y
Sbjct:  183 PGSFKCTPKQKCLSGFTQDAHGNCVDINECSSLAQPCSSSFACVNTVGSFSC--------------QQKVLVCNRGYHTSPDGASCVDVDECQMGSHACGV-GQICHNLPGSYRCDCQTGY 288          
BLAST of Cysteine-rich with EGF-like domains 2 vs. Ensembl Medaka
Match: hmcn2 (hemicentin-1 [Source:NCBI gene;Acc:101165068])

HSP 1 Score: 61.2326 bits (147), Expect = 2.689e-9
Identity = 59/180 (32.78%), Postives = 70/180 (38.89%), Query Frame = 1
Query:  529 IGNGTCVCYSGY--TGTMC--NECEFNYFQTTNDNGYTCTIC--HNSCVGCHGPGYDECEKCAEGWNQ-EDSKCVDIDECSNAT-ICDVNQYCLNTEGSFKCASCDLSCANCTGFGNDKCVSCNNGY--QKINNNCEDINECSADSELCREPGQKCTNLPGSFSCDCIDSYVKQSDG-SC 1035
            +G+  CVC+ GY   G  C  NEC  N             IC  H  C    G GY   + C  G    ED  CV IDEC + + +C   Q C NT G + C                    C  GY  Q +   C  INEC      C     +C N+PGSF C C    V   DG SC
Sbjct: 3653 LGSYRCVCHPGYQQAGHRCIINECMRN-------------ICPAHQQCRNTEG-GYTCFDSCPAGMTTAEDGVCV-IDECQDGSHMCRYTQICQNTVGGYACI-------------------CPRGYRSQGVGLPCL-INECLQTPNPC---AHQCRNVPGSFRCLCPPGTVLLGDGRSC 3794          

HSP 2 Score: 58.151 bits (139), Expect = 2.464e-8
Identity = 46/178 (25.84%), Postives = 74/178 (41.57%), Query Frame = 1
Query:  529 IGNGTCVCYSGYT-GTMCNECEFNYFQTTNDNGYTCTICHNSCVGCHGPGYDECE-KCAEGWNQEDSKCV-DIDECSNATICDVNQYCLNTEGSFKCASCDLSCANCTGFGNDKCVSCNNGYQKINNNCEDINECSADSELCREPGQKCTNLPGSFSC--DCIDSYVKQSDGSCKFKE 1047
            +G  +C C SG+T  T  N C+ +      +      +CH +    +  G   C+ KC  G+    +  + ++DEC  +++      CLNT GS++C                    C+ GYQ+  + C  INEC  +  +C    Q+C N  G ++C   C        DG C   E
Sbjct: 3568 MGGFSCSCPSGFTISTETNMCQID------ECSQGSHMCHYNQQCVNTVGTYRCQAKCGAGFKPSITGTICEVDECQESSVSPCQHQCLNTLGSYRCV-------------------CHPGYQQAGHRC-IINECMRN--IC-PAHQQCRNTEGGYTCFDSCPAGMTTAEDGVCVIDE 3716          
BLAST of Cysteine-rich with EGF-like domains 2 vs. Planmine SMEST
Match: SMESG000042342.1 (SMESG000042342.1)

HSP 1 Score: 651.358 bits (1679), Expect = 0.000e+0
Identity = 330/340 (97.06%), Postives = 335/340 (98.53%), Query Frame = 1
Query:   55 MKFAIVLLCLTIKSIIGQTYEICENLVQEFQIGLQKSEKSNFGGGNTAWEEKRLGNYATSETRLVHILEKLCPSSINNREKCQYLRXXXXXXXXXWWFNIFKKDLNGLSLYHYLCVDYLKACCPPNYFGKSCELCHFHNETTGLTCSGHGKCDGNGTRIGNGTCVCYSGYTGTMCNECEFNYFQTTNDNGYTCTICHNSCVGCHGPGYDECEKCAEGWNQEDSKCVDIDECSNATICDVNQYCLNTEGSFKCASCDLSCANCTGFGNDKCVSCNNGYQKINNNCEDINECSADSELCREPGQKCTNLPGSFSCDCIDSYVKQSDGSCKFKEPSKKISSTD 1074
            MKFAIVLLCLTIKSIIGQT EICENLVQEFQIGLQKSEKSNFGGGNTAWEEKRLGNYATSETRLVHILEKLCPSSINNREKCQYLREEVEEKIEEWWFNIFKKDLNGLSLYHYLCVDYLKACCPPNYFGKSCELCHFHNETTGLTCSGHGKCDGNGTRIGNGTC+CYSGY GTMCNECEFNYFQTTNDNGYTCTICHNSCVGCHGPGYDECEKCAEGWNQEDSKCVDIDECSNATICDVNQYCLNTEGSFKCASCDLSCANCTGFGNDKCVSCNNGYQKINNNCEDINECSADSELCREPGQKCTNLPGSFSCDCIDSYVKQSDGSCKFKEPS  +++ +
Sbjct:    1 MKFAIVLLCLTIKSIIGQTCEICENLVQEFQIGLQKSEKSNFGGGNTAWEEKRLGNYATSETRLVHILEKLCPSSINNREKCQYLREEVEEKIEEWWFNIFKKDLNGLSLYHYLCVDYLKACCPPNYFGKSCELCHFHNETTGLTCSGHGKCDGNGTRIGNGTCICYSGYMGTMCNECEFNYFQTTNDNGYTCTICHNSCVGCHGPGYDECEKCAEGWNQEDSKCVDIDECSNATICDVNQYCLNTEGSFKCASCDLSCANCTGFGNDKCVSCNNGYQKINNNCEDINECSADSELCREPGQKCTNLPGSFSCDCIDSYVKQSDGSCKFKEPSHPLANDE 340          
BLAST of Cysteine-rich with EGF-like domains 2 vs. Planmine SMEST
Match: SMESG000034758.1 (SMESG000034758.1)

HSP 1 Score: 59.6918 bits (143), Expect = 4.795e-9
Identity = 36/92 (39.13%), Postives = 47/92 (51.09%), Query Frame = 1
Query:  727 CVDIDECSNATICDVNQYCLNTEGSFKCASCDLSCANCTGFGNDKCVSCNNGYQKINNN-CEDINECSADSELCREPGQKCTNLPGSFSCDC 999
            CVDIDEC ++ IC  N  C N  GS++CA                   C+NGY+ + +  C DI+EC A  +LC+     C N PGSF C C
Sbjct:  928 CVDIDECRDSKICSGNGICQNMIGSYRCA-------------------CHNGYEYVEDKGCIDIDECQASKKLCQGDNVVCQNTPGSFKCVC 1000          
BLAST of Cysteine-rich with EGF-like domains 2 vs. Planmine SMEST
Match: SMESG000076582.1 (SMESG000076582.1)

HSP 1 Score: 59.6918 bits (143), Expect = 5.410e-9
Identity = 65/201 (32.34%), Postives = 92/201 (45.77%), Query Frame = 1
Query:  508 CDGNG---TRIGNGTCVCYSGYTGTMCNECEFNYFQTTNDNG-YTCTICHNSCVGCHG--PGYDECEKCAEGW--NQEDSKCVDIDECSN-ATICD-VNQYCLNTEGSFKC-------------------------ASCDLSCANCTGFGNDKCVSCNNGYQKINNNCEDINECSADSELCREPGQKCTNLPGSFSCDCID 1005
            CD N      IG+ +C C  G+ G        N    TN N  Y  + C N+   C    PGY EC +C +G+  N     C D +EC++   +CD V+  C NT GS++C                           CD + A CT        +C++GYQ    NC DI+ECS++ ++C+ P   C NLPGS+ C C+D
Sbjct: 3218 CDSNAFCKNTIGSFSCSCKEGFEG--------NGVTCTNINECYPLSPCDNATEECFDKVPGY-EC-RCQKGFMKNTTTGNCDDRNECADTGNLCDRVSTNCNNTFGSYRCDCKYGFRPSPIDSFVCTDVNECNLVHECDKNYAKCTNTPGSYYCTCDSGYQGDGRNCTDIDECSSN-KVCQRPDATCVNLPGSYECRCLD 3407          

HSP 2 Score: 56.225 bits (134), Expect = 6.785e-8
Identity = 43/128 (33.59%), Postives = 60/128 (46.88%), Query Frame = 1
Query:  694 CAEGWNQEDSKCVDIDECSNATI-CDVNQYCLNTEGSFKCASCDLSCANCTGFGNDKCVSCNNGYQKINN-----NCEDINECSADSELCREPGQKCTNLPGSFSCDCIDSYVKQSDGSCKFKEPSKK 1059
            C  G+  +   CVD+DECSN  + C  N +C N +GSF CA                   CN G+Q++ N     +C DI+EC   SE C   G+ C N  GSF C+C D ++      C+     +K
Sbjct: 4133 CDSGYYGDGELCVDVDECSNGDVSCPNNSFCQNKDGSFHCA-------------------CNVGFQRLENALVTDSCTDIDECLL-SESCATNGE-CQNTIGSFKCECKDGFIGDGKYDCRIDSKCEK 4239          

HSP 3 Score: 51.6026 bits (122), Expect = 1.594e-6
Identity = 46/140 (32.86%), Postives = 57/140 (40.71%), Query Frame = 1
Query:  694 CAEGWNQEDSKCVDIDECSNAT-ICDVNQYCLNTEGSFKCA----------------------SCDLSCANCTGFGNDKCVSCNNGYQK--INNNCEDINECSADSELCREPGQKCTNLPGSFSCDC--------IDSYV 1014
            C  G+  +   C DIDECSN T +CD N +C NT GSF C+                       CD +   C          C  G+ K     NC+D NEC+    LC      C N  GS+ CDC        IDS+V
Sbjct: 3194 CKNGFMGDGIMCKDIDECSNNTSVCDSNAFCKNTIGSFSCSCKEGFEGNGVTCTNINECYPLSPCDNATEECFDKVPGYECRCQKGFMKNTTTGNCDDRNECADTGNLCDRVSTNCNNTFGSYRCDCKYGFRPSPIDSFV 3333          

HSP 4 Score: 51.2174 bits (121), Expect = 2.186e-6
Identity = 36/97 (37.11%), Postives = 46/97 (47.42%), Query Frame = 1
Query:  712 QEDSKCVDIDECSNATICDVNQYCLNTEGSFKCASCDLSCANCTGFGNDKCVSCNNGYQKINNNCEDINECSADSELC-REPGQKCTNLPGSFSCDC 999
            +  +KCVDIDEC     C ++  C N  GSF+C                    CN GY  +N  C DINECS +S++C  +    C N  GSF C C
Sbjct: 5282 ENSTKCVDIDECQFPNSC-LDGLCNNLPGSFECL-------------------CNIGYDLVNGKCTDINECSNNSQICGPQAAGICINAAGSFQCKC 5358          
BLAST of Cysteine-rich with EGF-like domains 2 vs. Planmine SMEST
Match: SMESG000021248.1 (SMESG000021248.1)

HSP 1 Score: 58.5362 bits (140), Expect = 1.262e-8
Identity = 78/258 (30.23%), Postives = 107/258 (41.47%), Query Frame = 1
Query:  355 FKKDLNGLSLYHYLCVDYLKACCPPNY-FGKSCELCHFHNETTGLTCSGHGKCDGN-GTRIGNGTCVCYSGYT----GTMC---NECEFNYFQTTNDNGYTCTICHNSCVGCHGPGYDECE-KCAEGWNQEDSK--CVDIDEC-SNATICDVNQYCLNTEGSFKCA----------------SCDLSCANCTGFGNDKCVS----------CNNGYQKINNNCEDINECSADSELCREPGQKCTNLPGSFSCDCIDSY 1011
              K +   S+   +  D     CPP +   KS   C   NE          KCD      +    C C SG+     G  C   NEC        + N   C+  ++ C+  + PG   C+ KCA G  +   K  C DI+EC     ICD +Q C+NT GS+ C                  C L  A C G  + KC +          C +GYQ IN  C D++ECS+ +  C +    CTNLPGS+ C+C D +
Sbjct: 3617 LPKGMLEFSVSSLIAEDDDSKSCPPGFTLIKSQRFCEDVNECKNAKLH---KCDQICENTVPRFKCNCRSGFMLSSDGKSCQDINEC--------SKNISPCSEPNHECI--NTPGSYMCKPKCAPGLRRSFDKLTCGDINECVEKPNICD-SQLCINTHGSYYCLCRHGYKKMKNSCIDIDECSLGIAKC-GL-HQKCRNTPGSFFCENLCYDGYQLINEQCYDLDECSSGTANCSK-SSTCTNLPGSYRCECNDGF 3857          

HSP 2 Score: 51.2174 bits (121), Expect = 2.471e-6
Identity = 46/151 (30.46%), Postives = 67/151 (44.37%), Query Frame = 1
Query:  652 CVGCHGPGYDECEKCAEGWNQEDSKCVDIDECS-NATICDVNQYCLNTEGSFKCAS------------------CDLSCANCTGF-------GNDKCVSCNNGYQKINNNCEDINECSADSELCREPGQKCTNLPGSFSCDCIDSYVKQSD 1026
            C+  HG  Y  C  C  G+ +  + C+DIDECS     C ++Q C NT GSF C +                  C    ANC+         G+ +C  CN+G+    + C D+NEC  +S  C      C N  GS+ C C  ++++  D
Sbjct: 3758 CINTHGSYY--C-LCRHGYKKMKNSCIDIDECSLGIAKCGLHQKCRNTPGSFFCENLCYDGYQLINEQCYDLDECSSGTANCSKSSTCTNLPGSYRC-ECNDGFYTSGSTCIDVNECQTNSSQCI---YGCKNTYGSYECICPPNFIQSRD 3901          
BLAST of Cysteine-rich with EGF-like domains 2 vs. Planmine SMEST
Match: SMESG000068883.1 (SMESG000068883.1)

HSP 1 Score: 54.299 bits (129), Expect = 2.909e-7
Identity = 67/225 (29.78%), Postives = 98/225 (43.56%), Query Frame = 1
Query:  409 LKACCPPNYFGKSCELCHFHNETTGLTCSGHGKCDGNGTR----IGNGTCVCYSGYTGTMCNECEFNYFQTTNDNGYTCTIC-HNSCVGCHGPGYDECEKCA--EGWNQEDSK---CVDIDECSNATI-CDVNQY--CLNTEGSFKCASCDLSCANCTGFGNDKCVSCNNGYQKINNNCEDINECSADSELCREPGQKCTNLPGSFSCDCIDSYVKQSDGSCKFK 1044
             K  CP N+ GK C      NE   ++ + HG C  NG R    IG+  CVC   ++G +CN    N    +  N     IC H +C   H P   +  KC    GW+ +        DIDEC      C ++ +  C+NT G  +C  C +      GF         NG+      C DINEC A++  C  P ++C N  G++ C C+    + S+  C+ +
Sbjct:  156 FKCICPQNFKGKHC--TEDVNECLQISGTIHG-CQ-NGARCENTIGSFRCVCSGKWSGVLCN-IPIN----SCSNASNTDICGHGTCYPDHSPTNPKPFKCLCDSGWSLDPVTKTCIADIDECRVGKYPCSIHPFVACVNTPGDVRCEDCPI------GFEG-------NGF-----TCLDINEC-ANAYTC-GPNEECVNGFGTYQCKCVQGMKRGSNNMCQLE 351          
The following BLAST results are available for this feature:
BLAST of Cysteine-rich with EGF-like domains 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CRELD11.646e-6734.67cysteine rich with EGF like domains 1 [Source:HGNC... [more]
CRELD11.646e-6734.67cysteine rich with EGF like domains 1 [Source:HGNC... [more]
CRELD11.646e-6734.67cysteine rich with EGF like domains 1 [Source:HGNC... [more]
CRELD18.246e-6541.37cysteine rich with EGF like domains 1 [Source:HGNC... [more]
CRELD24.990e-6239.34cysteine rich with EGF like domains 2 [Source:HGNC... [more]
back to top
BLAST of Cysteine-rich with EGF-like domains 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
crld-18.129e-4539.48Cysteine Rich with egf (EGF) Like Domains homolog ... [more]
crld-16.381e-4439.48Cysteine Rich with egf (EGF) Like Domains homolog ... [more]
B0393.56.777e-931.36pep chromosome:WBcel235:III:4765833:4776342:1 gene... [more]
fbl-11.722e-833.04Fibulin-1 [Source:UniProtKB/Swiss-Prot;Acc:O77469... [more]
fbl-11.910e-833.04Fibulin-1 [Source:UniProtKB/Swiss-Prot;Acc:O77469... [more]
back to top
BLAST of Cysteine-rich with EGF-like domains 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG113772.561e-4739.78gene:FBgn0031217 transcript:FBtr0078104[more]
CG113772.613e-4639.63gene:FBgn0031217 transcript:FBtr0330636[more]
Ten-m1.640e-925.90gene:FBgn0004449 transcript:FBtr0306107[more]
Ten-m1.656e-925.90gene:FBgn0004449 transcript:FBtr0330159[more]
Ten-m3.737e-925.90gene:FBgn0004449 transcript:FBtr0078509[more]
back to top
BLAST of Cysteine-rich with EGF-like domains 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
creld21.284e-7143.17cysteine-rich with EGF-like domains 2 [Source:NCBI... [more]
creld21.284e-7143.17cysteine-rich with EGF-like domains 2 [Source:NCBI... [more]
creld1b4.587e-6931.10cysteine-rich with EGF-like domains 1b [Source:ZFI... [more]
creld1a1.202e-2032.47cysteine-rich with EGF-like domains 1a [Source:ZFI... [more]
creld1a2.122e-2029.02cysteine-rich with EGF-like domains 1a [Source:ZFI... [more]
back to top
BLAST of Cysteine-rich with EGF-like domains 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CRELD21.131e-7139.83cysteine rich with EGF-like domains 2 [Source:NCBI... [more]
aven1.839e-7135.24apoptosis, caspase activation inhibitor [Source:Xe... [more]
aven4.366e-6934.24apoptosis, caspase activation inhibitor [Source:Xe... [more]
CRELD21.047e-6542.67cysteine rich with EGF-like domains 2 [Source:NCBI... [more]
CRELD24.183e-6542.48cysteine rich with EGF-like domains 2 [Source:NCBI... [more]
back to top
BLAST of Cysteine-rich with EGF-like domains 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Creld14.153e-6834.42cysteine-rich with EGF-like domains 1 [Source:MGI ... [more]
Creld24.879e-6539.26cysteine-rich with EGF-like domains 2 [Source:MGI ... [more]
Hmcn12.544e-1430.95hemicentin 1 [Source:MGI Symbol;Acc:MGI:2685047][more]
Hmcn17.970e-1328.77hemicentin 1 [Source:MGI Symbol;Acc:MGI:2685047][more]
Hmcn21.412e-1233.82hemicentin 2 [Source:MGI Symbol;Acc:MGI:2677838][more]
back to top
BLAST of Cysteine-rich with EGF-like domains 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7SXF6|CREL2_DANRE9.696e-7143.17Cysteine-rich with EGF-like domain protein 2 OS=Da... [more]
sp|Q4V7M2|CRE2B_XENLA2.061e-7040.23Cysteine-rich with EGF-like domain protein 2-B OS=... [more]
sp|Q5XH36|CRE2A_XENLA5.644e-7043.04Cysteine-rich with EGF-like domain protein 2-A OS=... [more]
sp|Q5EA46|CREL1_BOVIN9.402e-6835.18Protein disulfide isomerase CRELD1 OS=Bos taurus O... [more]
sp|Q2KIT5|CREL2_BOVIN1.932e-6740.98Protein disulfide isomerase CRELD2 OS=Bos taurus O... [more]
back to top
BLAST of Cysteine-rich with EGF-like domains 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1Z1R2P10.000e+098.79Cysteine rich with EGF-like domain (Fragment) OS=S... [more]
A0A3Q0KQR33.144e-8438.02Cysteine-rich with egf-like domains protein OS=Sch... [more]
A0A183NBE43.008e-8238.06Uncharacterized protein OS=Schistosoma margrebowie... [more]
A0A183RJS52.769e-8137.64Uncharacterized protein OS=Schistosoma rodhaini OX... [more]
A0A183NHU24.109e-8139.07Uncharacterized protein OS=Schistosoma mattheei OX... [more]
back to top
BLAST of Cysteine-rich with EGF-like domains 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
creld1b3.369e-6733.25cysteine rich with EGF like domains 1 [Source:NCBI... [more]
creld22.981e-5738.06cysteine rich with EGF like domains 2 [Source:NCBI... [more]
creld26.048e-5739.46cysteine rich with EGF like domains 2 [Source:NCBI... [more]
adgre5b.31.882e-931.48adhesion G protein-coupled receptor E5b, duplicate... [more]
fbln21.885e-936.61fibulin 2 [Source:ZFIN;Acc:ZDB-GENE-060711-1][more]
back to top
BLAST of Cysteine-rich with EGF-like domains 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
creld22.029e-6734.76cysteine-rich with EGF-like domains 2 [Source:NCBI... [more]
ENSPMAT00000010139.11.708e-1033.79pep scaffold:Pmarinus_7.0:GL476784:79088:131893:1 ... [more]
ENSPMAT00000008854.19.764e-1034.48pep scaffold:Pmarinus_7.0:GL476328:1008604:1022137... [more]
ENSPMAT00000006555.11.137e-929.10pep scaffold:Pmarinus_7.0:GL476370:200676:210822:-... [more]
ENSPMAT00000000017.13.306e-928.19pep scaffold:Pmarinus_7.0:GL477746:39241:65692:1 g... [more]
back to top
BLAST of Cysteine-rich with EGF-like domains 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cysteine-rich with EGF-like domains 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO454275.041e-5843.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO494097.758e-1232.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO390031.454e-1133.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO419041.054e-931.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO500551.141e-929.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Cysteine-rich with EGF-like domains 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
creld21.611e-7238.06cysteine rich with EGF like domains 2 [Source:NCBI... [more]
creld1b1.276e-6631.60cysteine rich with EGF like domains 1 [Source:NCBI... [more]
ENSORLT00000000411.27.965e-1031.97latent-transforming growth factor beta-binding pro... [more]
fbln22.338e-938.02fibulin 2 [Source:ZFIN;Acc:ZDB-GENE-060711-1][more]
hmcn22.689e-932.78hemicentin-1 [Source:NCBI gene;Acc:101165068][more]
back to top
BLAST of Cysteine-rich with EGF-like domains 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000042342.10.000e+097.06SMESG000042342.1[more]
SMESG000034758.14.795e-939.13SMESG000034758.1[more]
SMESG000076582.15.410e-932.34SMESG000076582.1[more]
SMESG000021248.11.262e-830.23SMESG000021248.1[more]
SMESG000068883.12.909e-729.78SMESG000068883.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024706 ID=SMED30024706|Name=Cysteine-rich with EGF-like domains 2|organism=Schmidtea mediterranea sexual|type=transcript|length=1645bp
GTACATAATTAAATTATTTTTTTTTGCAAAATAGTTTAATAATATTTTAG
GTTTATGAAATTTGCTATCGTCTTATTGTGTTTAACTATTAAATCAATTA
TTGGTCAGACATATGAAATTTGTGAAAATTTAGTCCAAGAATTTCAAATA
GGTTTACAAAAATCAGAAAAAAGTAATTTTGGAGGTGGTAATACAGCTTG
GGAAGAAAAACGTCTGGGTAACTACGCAACAAGTGAAACTCGTCTAGTAC
ATATTTTAGAAAAATTGTGCCCATCTTCAATTAATAATAGAGAAAAATGT
CAATATTTACGCGAAGAAGTTGAAGAGAAAATTGAAGAATGGTGGTTTAA
TATATTCAAAAAAGATCTTAATGGGCTTAGTTTGTATCATTATTTATGCG
TTGACTATTTAAAGGCATGCTGTCCTCCAAATTATTTTGGTAAATCTTGT
GAGTTGTGCCACTTTCACAATGAAACGACTGGATTAACTTGCTCAGGTCA
TGGCAAATGTGATGGTAATGGAACTCGGATAGGCAACGGAACTTGTGTGT
GTTATAGTGGATACACGGGAACAATGTGTAATGAATGTGAATTTAATTAT
TTTCAAACTACTAATGATAATGGATACACTTGTACAATATGCCACAATTC
TTGCGTCGGTTGTCATGGGCCGGGCTATGATGAATGTGAAAAATGTGCTG
AAGGATGGAATCAAGAAGACTCTAAATGTGTCGATATTGACGAATGCTCA
AACGCAACAATTTGTGATGTGAATCAATATTGTTTGAATACCGAAGGATC
ATTCAAATGTGCTTCGTGTGATTTATCTTGTGCCAATTGTACGGGCTTTG
GGAATGATAAGTGTGTATCGTGCAACAACGGTTATCAGAAAATCAATAAC
AACTGTGAAGACATAAATGAGTGCAGTGCTGATAGTGAATTGTGTCGTGA
ACCTGGTCAAAAGTGTACAAATCTTCCAGGCTCATTTAGCTGTGATTGTA
TCGATAGCTATGTCAAACAGTCAGACGGTAGCTGCAAATTCAAAGAGCCA
AGTAAGAAAATTTCATCTACTGATAAACCTACCAACCGTAAAACAACTGG
AGGTAAAAATAAAAACCGAAAACAGCCGAAAAAAATTTGGACTAAGAAGT
TTGAGAGAGAATTTTTTAAATTAATTTGCTGCATTTTTTTGTTGGGTATC
ACGAGTTACTTTTTTGGGTATTACTCATTAATTGTCATCGTCGCTGCGCT
GATTTGTGGCTATTACATTTATTTCAAAAGCATTAAGCTAGATCAAATAT
TTTCCAAAAGTTTTGTCGTTTAAATTGTGTTTATTATTAATACTTCAATT
TAATTGTTGTTTTTATTATTATTACTAATGTAGTTTTTCACTTAGTAATT
TTTTTATCGCAGGTCATCCACTGGCGAATGATGAACTCTGAAGTCGACCG
GCATTGTAGTTAATTTTTGTTTGGTTTCATGGTTTGTCAATGAGAAATAA
ATCCTTTTTAATTTTGTGTGTTTAATCGTTTGTGCATTTTTTGACTTGTG
TGCTGATTGGGTCGCATTGTAGTTGTTATCGGAATTTTTATCCTGACTGA
TGTTTTGCTGTAATAAAGGATTTTTATTATTTTCTCCAAAAAAAA
back to top

protein sequence of SMED30024706-orf-1

>SMED30024706-orf-1 ID=SMED30024706-orf-1|Name=SMED30024706-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=423bp
MKFAIVLLCLTIKSIIGQTYEICENLVQEFQIGLQKSEKSNFGGGNTAWE
EKRLGNYATSETRLVHILEKLCPSSINNREKCQYLREEVEEKIEEWWFNI
FKKDLNGLSLYHYLCVDYLKACCPPNYFGKSCELCHFHNETTGLTCSGHG
KCDGNGTRIGNGTCVCYSGYTGTMCNECEFNYFQTTNDNGYTCTICHNSC
VGCHGPGYDECEKCAEGWNQEDSKCVDIDECSNATICDVNQYCLNTEGSF
KCASCDLSCANCTGFGNDKCVSCNNGYQKINNNCEDINECSADSELCREP
GQKCTNLPGSFSCDCIDSYVKQSDGSCKFKEPSKKISSTDKPTNRKTTGG
KNKNRKQPKKIWTKKFEREFFKLICCIFLLGITSYFFGYYSLIVIVAALI
CGYYIYFKSIKLDQIFSKSFVV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR021852DUF3456
IPR000742EGF-like_dom
IPR006212Furin_repeat
IPR001881EGF-like_Ca-bd_dom
IPR002049Laminin_EGF
IPR018097EGF_Ca-bd_CS
IPR000152EGF-type_Asp/Asn_hydroxyl_site
IPR013032EGF-like_CS
IPR009030Growth_fac_rcpt_cys_sf
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005509calcium ion binding
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
GO:0005783endoplasmic reticulum
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006212Furin-like repeatSMARTSM00261furin_3coord: 190..237
e-value: 2.8E-6
score: 36.9
coord: 249..297
e-value: 0.0053
score: 26.0
IPR006212Furin-like repeatCDDcd00064FUcoord: 255..284
e-value: 0.00881056
score: 32.1056
IPR006212Furin-like repeatCDDcd00064FUcoord: 196..227
e-value: 4.13056E-4
score: 35.9576
IPR000742EGF-like domainSMARTSM00181egf_5coord: 254..285
e-value: 71.0
score: 6.3
coord: 289..328
e-value: 0.79
score: 18.8
coord: 134..176
e-value: 26.0
score: 11.3
IPR000742EGF-like domainPROSITEPS50026EGF_3coord: 286..322
score: 7.484
IPR000742EGF-like domainPROSITEPS50026EGF_3coord: 137..176
score: 10.711
IPR001881EGF-like calcium-binding domainSMARTSM00179egfca_6coord: 227..271
e-value: 0.009
score: 18.3
coord: 286..328
e-value: 1.5E-7
score: 41.1
IPR001881EGF-like calcium-binding domainPFAMPF07645EGF_CAcoord: 286..327
e-value: 5.5E-7
score: 29.7
coord: 227..256
e-value: 6.8E-5
score: 23.0
IPR002049Laminin EGF domainPFAMPF00053Laminin_EGFcoord: 146..193
e-value: 2.1E-4
score: 21.4
IPR002049Laminin EGF domainPROSITEPS01248EGF_LAM_1coord: 164..196
NoneNo IPR availableGENE3DG3DSA:2.10.25.10coord: 283..328
e-value: 2.7E-8
score: 35.8
NoneNo IPR availableGENE3DG3DSA:2.10.220.10coord: 144..281
e-value: 4.1E-6
score: 28.6
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 333..358
NoneNo IPR availablePANTHERPTHR24034:SF110CYSTEINE-RICH WITH EGF-LIKE DOMAIN PROTEIN 2coord: 5..344
NoneNo IPR availablePANTHERPTHR24034FAMILY NOT NAMEDcoord: 5..344
NoneNo IPR availableCDDcd00054EGF_CAcoord: 286..315
e-value: 0.00928441
score: 31.8382
NoneNo IPR availableCDDcd00054EGF_CAcoord: 227..252
e-value: 9.41479E-4
score: 34.5346
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..17
score: 0.788
NoneNo IPR availableTMHMMTMhelixcoord: 385..407
IPR021852Domain of unknown function DUF3456PFAMPF11938DUF3456coord: 20..78
e-value: 4.7E-5
score: 23.9
IPR018097EGF-like calcium-binding, conserved sitePROSITEPS01187EGF_CAcoord: 286..313
IPR018097EGF-like calcium-binding, conserved sitePROSITEPS01187EGF_CAcoord: 227..252
IPR013032EGF-like, conserved sitePROSITEPS00022EGF_1coord: 164..175
IPR000152EGF-type aspartate/asparagine hydroxylation sitePROSITEPS00010ASX_HYDROXYLcoord: 304..315
IPR009030Growth factor receptor cysteine-rich domain superfamilySUPERFAMILYSSF57184Growth factor receptor domaincoord: 178..328