inositol phosphoceramide mannosyltransferase 2-like

Overview
Nameinositol phosphoceramide mannosyltransferase 2-like
Smed IDSMED30024675
Length (bp)1045
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of inositol phosphoceramide mannosyltransferase 2-like (SMED30024675) t-SNE clustered cells

Violin plots show distribution of expression levels for inositol phosphoceramide mannosyltransferase 2-like (SMED30024675) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of inositol phosphoceramide mannosyltransferase 2-like (SMED30024675) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for inositol phosphoceramide mannosyltransferase 2-like (SMED30024675) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024675

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30024675SMESG000059803.1 SmedASXL_071928SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30024675SMESG000059803.1 SMESG000059799.1 SmedASXL_013040SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30024675SMESG000059803.1 SMESG000059799.1 dd_Smed_v4_9415_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30024675SMESG000059803.1 SMESG000059799.1 dd_Smed_v4_9415_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30024675SMESG000059803.1 SMESG000059799.1 dd_Smed_v4_9415_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30024675SMESG000059803.1 SMESG000059799.1 dd_Smed_v4_9415_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30024675SMESG000059803.1 SMESG000059799.1 Contig50488newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30024675SMESG000059803.1 SMESG000059799.1 Contig50488uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30024675SMESG000059803.1 SMESG000059799.1 dd_Smed_v6_9415_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30024675SMESG000059803.1 SMESG000059799.1 dd_Smed_v4_9415_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. UniProt/SwissProt
Match: sp|P33300|SUR1_YEAST (Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 1.608e-19
Identity = 65/202 (32.18%), Postives = 99/202 (49.01%), Query Frame = 1
Query:  277 QNLSKIIHFSWKNKKIPNFFINFMKTWQEDCFK---DWKFMFWTDDDNYNFIRVHYPWFLKRYNEFHRNIYRADVSRYFYLFHYGGIYTDLDTECLRPFQHLLQNYSLVFGAMKGHWKGTKLKEGYVQNSFMYSKPRQTFWLELIFDILNLKK---VDRPEIM--TGPVLLTNKIEEYQKRMIGKHLDMIVYPPQYFNPFSW 858
            Q + KIIH ++K + IP  +    K  ++ C     D+K++ WTD+  Y FI+  YPWFL  +  +   I RAD  RYF L HYGG+Y DLD  C R    LL   + +           K     V N  M S PR  F+L+ +  + +  K   +    IM  TGP+ L+   ++Y++  I K+  + +  P Y+   S+
Sbjct:   53 QLIPKIIHQTYKTEDIPEHW----KEGRQKCLDLHPDYKYILWTDEMAYEFIKEEYPWFLDTFENYKYPIERADAIRYFILSHYGGVYIDLDDGCERKLDPLLAFPAFL----------RKTSPLGVSNDVMGSVPRHPFFLKALKSLKHYDKYWFIPYMTIMGSTGPLFLSVIWKQYKRWRIPKNGTVRILQPAYYKMHSY 240          
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. UniProt/SwissProt
Match: sp|Q10323|IMT3_SCHPO (Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 3.014e-18
Identity = 44/99 (44.44%), Postives = 59/99 (59.60%), Query Frame = 1
Query:  283 LSKIIHFSWKNKKIPNFFINFMKTWQEDCFKDWKFMFWTDDDNYNFIRVHYPWFLKRYNEFHRNIYRADVSRYFYLFHYGGIYTDLDTECLRPFQHLLQ 579
            + KIIH +WK  +IP  ++   K+   D   D++++ WTD+    FI   YPWFL +Y+ +  NI RADV RYF L+ YGGIY DLD  C R    LL 
Sbjct:   57 IPKIIHQTWKTNEIPEKWVGAQKS-CIDLHPDYEYVLWTDESMREFIATDYPWFLTQYDSYPYNIERADVVRYFILYKYGGIYLDLDVGCNRTLDPLLH 154          
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. UniProt/SwissProt
Match: sp|P38287|CSH1_YEAST (Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 4.636e-18
Identity = 61/179 (34.08%), Postives = 91/179 (50.84%), Query Frame = 1
Query:  277 QNLSKIIHFSWKNKKIPNFFINFMKTWQE--DCFKDWKFMFWTDDDNYNFIRVHYPWFLKRYNEFHRNIYRADVSRYFYLFHYGGIYTDLDTECLRPFQHLLQNYSLVFGAMKGHWKGTKLKEGYVQNSFMYSKPRQTFWLELIFDILNLKK---VDRPEIM--TGPVLLTNKIEEYQK 792
            Q + KIIH ++K   IP     ++K  Q+  D   D+ ++ WTD+ +  FI+  YPWFL  +  +   I RAD  RYF L HYGGIY DLD  C R    LL+  + +           K     V N  M S PR  F+L++I  + + KK   +    IM  TGP+ ++   ++Y++
Sbjct:   60 QLIPKIIHQTYKTNDIPE---QWVKGRQKCIDLHPDYTYILWTDEMSDTFIKQEYPWFLDTFRSYEYPIERADAIRYFILSHYGGIYIDLDDGCERRLDPLLKVPAFL----------RKTSPTGVSNDVMGSVPRHPFFLKVIKSLKHYKKNWYIPYMTIMGSTGPLFISVVWKQYKR 225          
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. UniProt/SwissProt
Match: sp|Q9UT67|IMT2_SCHPO (Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 4.677e-17
Identity = 64/186 (34.41%), Postives = 96/186 (51.61%), Query Frame = 1
Query:  274 EQNLSKIIHFSWKNKKIPNFFINFMKTWQEDCF---KDWKFMFWTDDDNYNFIRVHYPWFLKRYNEFHRNIYRADVSRYFYLFHYGGIYTDLDTECLRPFQHLLQNYSLVFGAMKGHWKGTKLKEGYVQNSFMYSKPRQTFWLELIFDILNLKKVDRP--------EIMTGPVLLTNKIEEYQKRM 798
            E  + KIIH +WK  ++P  +    K  Q+ C     D++++ WTD+ + NFI  +YPWFL  ++ +  N+ RADV RYF L+HYGG Y DLD  C +    LL  Y  V       W       G V N  M S P   ++ ELI  I NL+K  +          + TGP+ ++   E+Y++++
Sbjct:   79 EPVIPKIIHQTWKTTEVPEGW----KGAQQSCIDLHPDYEYILWTDEMSRNFIADNYPWFLPYFDAYPFNVQRADVIRYFVLYHYGGNYIDLDDGCRQRLDSLL--YYPV-------WVRRTDPVG-VSNDVMGSVPHHPYF-ELI--IQNLEKNAKSYWLPYLTIMLSTGPLSISFLWEKYKRQL 247          
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. UniProt/SwissProt
Match: sp|O14084|IMT1_SCHPO (Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2)

HSP 1 Score: 79.7221 bits (195), Expect = 1.739e-15
Identity = 50/192 (26.04%), Postives = 92/192 (47.92%), Query Frame = 1
Query:  277 QNLSKIIHFSWKNKKIPNFFINFMKTW--QEDCFKDWKFMFWTDDDNYNFIRVHYPWFLKRYNEFHRNIYRADVSRYFYLFHYGGIYTDLDTECLRPFQHLLQNYSLVFGAMKGHWKGTKLKEGYVQNSFMYSKPRQTFWLELIFDILN-----LKKVDRPEIMTGPVLLTNKIEEYQKRMIGKHLDMIVYP 831
            + + ++IH  WK++ IP  + N + +   Q      W+F+ WTD+   +F+  +Y WF+  ++ +  NI + D +RYF L+HYGG+Y DLD  C +P   LL   + +  + +          GY  N +  + P+  F  + I ++         K     +  GP+ L+    ++ K ++  H  + V P
Sbjct:   62 EKIPRVIHQLWKDENIPERWSNTVNSCRRQHPDENGWQFILWTDEKIMSFMNENYSWFMPVFHSYPYNIQKFDAARYFILYHYGGVYMDLDIGCKKPMDPLLSKATFILPSTE--------PIGY-SNDWFAATPKHPFLYQAIHNLSKFNHRYFTKYPTVFLSAGPLFLS---YQFCKYLLTPHEPVRVLP 241          
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. TrEMBL
Match: A0A1I8HSW6 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 200.29 bits (508), Expect = 2.216e-57
Identity = 102/246 (41.46%), Postives = 139/246 (56.50%), Query Frame = 1
Query:  289 KIIHFSWKNKKIPNFFINFMKTWQEDCFKDWKFMFWTDDDNYNFIRVHYPWFLKRYNEFHRNIYRADVSRYFYLFHYGGIYTDLDTECLRPFQHLLQNYSLVFGAMKGHWKGTK-----LKEGYVQNSFMYSKPRQTFWLELIFDILNLKKVDRPEIMTGPVLLTNKIEEYQKRMIGKHL-----DMIVYPPQYFNPFSWIDPSD--VDRNCMTSNQMTAENLEKCRYS-LKAKGSYVAQYHFHTW 987
             I+H SWK   +P  F N   T+  DC   ++ + WTD DN + +  HYPWFL RY+     + RADV+R FY+  YGG+Y DLD +CLR FQHLL N SL  GAM+G     +     + EG V+NSFMYS+PR  F+ ELI   LN  + D P + +G  LL   I   ++  + + L      + VYPP  FNPFSWI+P +     +C    Q T ++ + CR + LK+  SY+ QYH   W
Sbjct:  126 AILHQSWKTAHLPPLFANLSATF-ADCLPSFRRILWTDSDNRDLVARHYPWFLARYDSLAPGVQRADVARLFYMHRYGGVYCDLDCDCLRGFQHLLANTSLALGAMEGSLIPERENPAFVDEGQVENSFMYSQPRHPFFWELILR-LNATQGDLPIMASGTYLLMTGIRSARRIGLDRTLFSGLPYLTVYPPSLFNPFSWINPQEGRASPDCQLFGQFTPQSRQLCRQAYLKSNASYIVQYHTQVW 369          
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. TrEMBL
Match: A0A1I8HLW6 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 200.29 bits (508), Expect = 3.045e-57
Identity = 102/246 (41.46%), Postives = 139/246 (56.50%), Query Frame = 1
Query:  289 KIIHFSWKNKKIPNFFINFMKTWQEDCFKDWKFMFWTDDDNYNFIRVHYPWFLKRYNEFHRNIYRADVSRYFYLFHYGGIYTDLDTECLRPFQHLLQNYSLVFGAMKGHWKGTK-----LKEGYVQNSFMYSKPRQTFWLELIFDILNLKKVDRPEIMTGPVLLTNKIEEYQKRMIGKHL-----DMIVYPPQYFNPFSWIDPSD--VDRNCMTSNQMTAENLEKCRYS-LKAKGSYVAQYHFHTW 987
             I+H SWK   +P  F N   T+  DC   ++ + WTD DN + +  HYPWFL RY+     + RADV+R FY+  YGG+Y DLD +CLR FQHLL N SL  GAM+G     +     + EG V+NSFMYS+PR  F+ ELI   LN  + D P + +G  LL   I   ++  + + L      + VYPP  FNPFSWI+P +     +C    Q T ++ + CR + LK+  SY+ QYH   W
Sbjct:  133 AILHQSWKTAHLPPLFANLSATF-ADCLPSFRRILWTDSDNRDLVARHYPWFLARYDSLAPGVQRADVARLFYMHRYGGVYCDLDCDCLRGFQHLLANTSLALGAMEGSLIHERENPAFVDEGQVENSFMYSQPRHPFFWELILR-LNATQGDVPIMASGTYLLMTGIRSARRIGLDRTLFIGLPYLTVYPPSLFNPFSWINPQEGRASPDCQLFGQFTPQSRQLCRQAYLKSNASYIVQYHTQVW 376          
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. TrEMBL
Match: A0A1I8H5Y8 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 192.2 bits (487), Expect = 5.046e-55
Identity = 105/252 (41.67%), Postives = 148/252 (58.73%), Query Frame = 1
Query:  271 YEQNLSKIIHFSWKNKKIPNFFINFMKTWQEDCFKDWKFMFWTDDDNYNFIRVHYPWFLKRYNEFHRNIYRADVSRYFYLFHYGGIYTDLDTECLRPFQHLLQNYSLVFGAMKGHWKGTK-----LKEGYVQNSFMYSKPRQTFWLELIFDILNLKKVDRPEIMTGPVLLTNKIEEYQKRMI---GKHLD----MIVYPPQYFNPFSWIDPSDVDRNCMTSNQM-TAENLEKCRYSLKAKGSYVAQYHFHTW 987
            +   L +I+H SW ++K+P  F  + +++   CF D++   WTD DN   I  HYPWFL+RY+   R + RADVSR FY++HYGG+Y DLD ECLR F+HLL N SLVFGAM+G    +      + EG ++NSFMYS+PR  F+ +LI   LN    + P + +GP L+ + I   ++  I   G  +D    + VYPP YFNP+SW+  +   R+C    +      L +CR S   + SYV QYH   W
Sbjct:   58 FSGPLVRIVHQSWASRKLPEQFAEWSRSFSA-CFPDFRRRLWTDKDNRQLIARHYPWFLRRYDSLARGVQRADVSRLFYMYHYGGLYCDLDCECLRDFRHLLANASLVFGAMQGLMIRSPRDPAYVAEGQIENSFMYSRPRHPFFWDLIV-YLNATTGEMPIMSSGPYLIMSGIHAARQLGIAPSGIRVDGRDFLTVYPPAYFNPYSWMLLN--SRHCRLYGRFENRAQLRQCRDSF--QDSYVMQYHTQVW 303          
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. TrEMBL
Match: A0A1I8FU40 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 203.756 bits (517), Expect = 6.099e-55
Identity = 102/245 (41.63%), Postives = 139/245 (56.73%), Query Frame = 1
Query:  292 IIHFSWKNKKIPNFFINFMKTWQEDCFKDWKFMFWTDDDNYNFIRVHYPWFLKRYNEFHRNIYRADVSRYFYLFHYGGIYTDLDTECLRPFQHLLQNYSLVFGAMKGHWKGTK-----LKEGYVQNSFMYSKPRQTFWLELIFDILNLKKVDRPEIMTGPVLLTNKIEEYQKRMIGKHL-----DMIVYPPQYFNPFSWIDPSD--VDRNCMTSNQMTAENLEKCRYS-LKAKGSYVAQYHFHTW 987
            I+H SWK   +P  F N   T+  DC   ++ + WTD DN + +  HYPWFL RY+     + RADV+R FY+  YGG+Y DLD +CLR FQHLL N SL  GAM+G     +     + EG V+NSFMYS+PR  F+ ELI   LN  + D P + +G  LL   I   ++  + + L      + VYPP  FNPFSWI+P +     +C    Q T ++ + CR + LK+  SY+ QYH   W
Sbjct:  556 ILHQSWKTAHLPPLFANLSATF-ADCLPSFRRILWTDSDNRDLVARHYPWFLARYDSLAPGVQRADVARLFYMHRYGGVYCDLDCDCLRGFQHLLANTSLALGAMEGSLIPERENPAFVDEGQVENSFMYSQPRHPFFWELILR-LNATQGDLPIMASGTYLLMTGIRSARRIGLDRTLFSGLPYLTVYPPSLFNPFSWINPQEGRASPDCQLFGQFTPQSRQLCRQAYLKSNASYIVQYHTQVW 798          
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. TrEMBL
Match: A0A267F5S5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig014144g2 PE=4 SV=1)

HSP 1 Score: 189.504 bits (480), Expect = 5.562e-54
Identity = 104/252 (41.27%), Postives = 148/252 (58.73%), Query Frame = 1
Query:  271 YEQNLSKIIHFSWKNKKIPNFFINFMKTWQEDCFKDWKFMFWTDDDNYNFIRVHYPWFLKRYNEFHRNIYRADVSRYFYLFHYGGIYTDLDTECLRPFQHLLQNYSLVFGAMKGHWKGTK-----LKEGYVQNSFMYSKPRQTFWLELIFDILNLKKVDRPEIMTGPVLLTNKIEEYQKRMI---GKHLD----MIVYPPQYFNPFSWIDPSDVDRNCMTSNQM-TAENLEKCRYSLKAKGSYVAQYHFHTW 987
            +   L +I+H SW ++K+P  F  + +++   CF D++   WTD+DN   I  HYPWFL+RY+     + RADVSR FY++HYGG+Y DLD ECLR F+HLL N SLVFGAM+G    +      + EG ++NSFMYS+PR  F+ +LI   LN    + P + +GP L+ + I   ++  I   G  +D    + VYPP YFNP+SW+  +   R+C    +      L +CR S   + SYV QYH   W
Sbjct:   58 FSGPLVRIVHQSWASRKLPEQFAEWSRSFSA-CFPDFRRRLWTDEDNRELIARHYPWFLRRYDSLAPGVQRADVSRLFYMYHYGGLYCDLDCECLRDFRHLLDNASLVFGAMQGLMIRSPRDPAYVAEGQIENSFMYSRPRHPFFWDLIV-YLNATTGEMPIMSSGPYLIMSGIHAARQLGIAPSGIRVDGRDFLTVYPPAYFNPYSWMLLN--SRHCRLYGRFENRTQLRQCRDSF--QDSYVMQYHTQVW 303          
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. Ensembl Yeast
Match: SUR1 (Mannosylinositol phosphorylceramide (MIPC) synthase catalytic subunit; forms a complex with regulatory subunit Csg2p; function in sphingolipid biosynthesis is overlapping with that of Csh1p; SUR1 has a paralog, CSH1, that arose from the whole genome duplication [Source:SGD;Acc:S000005978])

HSP 1 Score: 92.0485 bits (227), Expect = 2.316e-21
Identity = 65/202 (32.18%), Postives = 99/202 (49.01%), Query Frame = 1
Query:  277 QNLSKIIHFSWKNKKIPNFFINFMKTWQEDCFK---DWKFMFWTDDDNYNFIRVHYPWFLKRYNEFHRNIYRADVSRYFYLFHYGGIYTDLDTECLRPFQHLLQNYSLVFGAMKGHWKGTKLKEGYVQNSFMYSKPRQTFWLELIFDILNLKK---VDRPEIM--TGPVLLTNKIEEYQKRMIGKHLDMIVYPPQYFNPFSW 858
            Q + KIIH ++K + IP  +    K  ++ C     D+K++ WTD+  Y FI+  YPWFL  +  +   I RAD  RYF L HYGG+Y DLD  C R    LL   + +           K     V N  M S PR  F+L+ +  + +  K   +    IM  TGP+ L+   ++Y++  I K+  + +  P Y+   S+
Sbjct:   53 QLIPKIIHQTYKTEDIPEHW----KEGRQKCLDLHPDYKYILWTDEMAYEFIKEEYPWFLDTFENYKYPIERADAIRYFILSHYGGVYIDLDDGCERKLDPLLAFPAFL----------RKTSPLGVSNDVMGSVPRHPFFLKALKSLKHYDKYWFIPYMTIMGSTGPLFLSVIWKQYKRWRIPKNGTVRILQPAYYKMHSY 240          
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. Ensembl Yeast
Match: CSH1 (Mannosylinositol phosphorylceramide (MIPC) synthase catalytic subunit; forms a complex with regulatory subunit Csg2p; function in sphingolipid biosynthesis is overlapping with that of Sur1p; CSH1 has a paralog, SUR1, that arose from the whole genome duplication [Source:SGD;Acc:S000000365])

HSP 1 Score: 87.8113 bits (216), Expect = 6.677e-20
Identity = 61/179 (34.08%), Postives = 91/179 (50.84%), Query Frame = 1
Query:  277 QNLSKIIHFSWKNKKIPNFFINFMKTWQE--DCFKDWKFMFWTDDDNYNFIRVHYPWFLKRYNEFHRNIYRADVSRYFYLFHYGGIYTDLDTECLRPFQHLLQNYSLVFGAMKGHWKGTKLKEGYVQNSFMYSKPRQTFWLELIFDILNLKK---VDRPEIM--TGPVLLTNKIEEYQK 792
            Q + KIIH ++K   IP     ++K  Q+  D   D+ ++ WTD+ +  FI+  YPWFL  +  +   I RAD  RYF L HYGGIY DLD  C R    LL+  + +           K     V N  M S PR  F+L++I  + + KK   +    IM  TGP+ ++   ++Y++
Sbjct:   60 QLIPKIIHQTYKTNDIPE---QWVKGRQKCIDLHPDYTYILWTDEMSDTFIKQEYPWFLDTFRSYEYPIERADAIRYFILSHYGGIYIDLDDGCERRLDPLLKVPAFL----------RKTSPTGVSNDVMGSVPRHPFFLKVIKSLKHYKKNWYIPYMTIMGSTGPLFISVVWKQYKR 225          
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. Ensembl Yeast
Match: OCH1 (Mannosyltransferase of the cis-Golgi apparatus; initiates the polymannose outer chain elongation of N-linked oligosaccharides of glycoproteins [Source:SGD;Acc:S000003006])

HSP 1 Score: 55.8398 bits (133), Expect = 4.333e-9
Identity = 35/119 (29.41%), Postives = 58/119 (48.74%), Query Frame = 1
Query:  229 NVRKAIIFQKPEFIYEQNLSKIIHFSWK----NKKIPNFFINFMKTWQEDCFKDWKFMFWTDDDNYNFIRVHY---PWFLKRYNEFHRNIYRADVSRYFYLFHYGGIYTDLDTECLRPF 564
            N+R  + F  P +  +  + + +  +WK    +K  P+ F  + KTW      D+++   +DD    F+   Y   P  ++ +     NI +AD  RY  LF  GGIY+D+DT  L+P 
Sbjct:   79 NLRDQLSFAFP-YDSQAPIPQRVWQTWKVGADDKNFPSSFRTYQKTWSGSYSPDYQYSLISDDSIIPFLENLYAPVPIVIQAFKLMPGNILKADFLRYLLLFARGGIYSDMDTMLLKPI 196          
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. Planmine SMEST
Match: SMESG000059799.1 (SMESG000059799.1)

HSP 1 Score: 454.521 bits (1168), Expect = 4.853e-163
Identity = 211/222 (95.05%), Postives = 217/222 (97.75%), Query Frame = 1
Query:  322 IPNFFINFMKTWQEDCFKDWKFMFWTDDDNYNFIRVHYPWFLKRYNEFHRNIYRADVSRYFYLFHYGGIYTDLDTECLRPFQHLLQNYSLVFGAMKGHWKGTKLKEGYVQNSFMYSKPRQTFWLELIFDILNLKKVDRPEIMTGPVLLTNKIEEYQKRMIGKHLDMIVYPPQYFNPFSWIDPSDVDRNCMTSNQMTAENLEKCRYSLKAKGSYVAQYHFHTW 987
            +P+ F++FMKTWQEDCFKDWKFMFWTDDDNYNFIRVHYPWFLKRYNEFHRNIYRADVSRYFYLFHYGGIYTDLDTECLRPFQHLLQNYSLVFGAMKGHWKGTKLKEGYVQNSFMYSKPRQTFWLELIFDILN K+VDRPEI+ G VLLT KIEEYQKRMIGKHLDMIVYPPQYFNPFSWIDPSDVDRNCMTSNQMTAENLEKCRYSLKAKGSYVAQYHFHTW
Sbjct:    1 MPDLFLDFMKTWQEDCFKDWKFMFWTDDDNYNFIRVHYPWFLKRYNEFHRNIYRADVSRYFYLFHYGGIYTDLDTECLRPFQHLLQNYSLVFGAMKGHWKGTKLKEGYVQNSFMYSKPRQTFWLELIFDILNSKEVDRPEILAGSVLLTKKIEEYQKRMIGKHLDMIVYPPQYFNPFSWIDPSDVDRNCMTSNQMTAENLEKCRYSLKAKGSYVAQYHFHTW 222          
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. Planmine SMEST
Match: SMESG000059803.1 (SMESG000059803.1)

HSP 1 Score: 468.003 bits (1203), Expect = 9.683e-157
Identity = 213/213 (100.00%), Postives = 213/213 (100.00%), Query Frame = 1
Query:  346 MKTWQEDCFKDWKFMFWTDDDNYNFIRVHYPWFLKRYNEFHRNIYRADVSRYFYLFHYGGIYTDLDTECLRPFQHLLQNYSLVFGAMKGHWKGTKLKEGYVQNSFMYSKPRQTFWLELIFDILNLKKVDRPEIMTGPVLLTNKIEEYQKRMIGKHLDMIVYPPQYFNPFSWIDPSDVDRNCMTSNQMTAENLEKCRYSLKAKGSYVAQYHFHT 984
            MKTWQEDCFKDWKFMFWTDDDNYNFIRVHYPWFLKRYNEFHRNIYRADVSRYFYLFHYGGIYTDLDTECLRPFQHLLQNYSLVFGAMKGHWKGTKLKEGYVQNSFMYSKPRQTFWLELIFDILNLKKVDRPEIMTGPVLLTNKIEEYQKRMIGKHLDMIVYPPQYFNPFSWIDPSDVDRNCMTSNQMTAENLEKCRYSLKAKGSYVAQYHFHT
Sbjct:    1 MKTWQEDCFKDWKFMFWTDDDNYNFIRVHYPWFLKRYNEFHRNIYRADVSRYFYLFHYGGIYTDLDTECLRPFQHLLQNYSLVFGAMKGHWKGTKLKEGYVQNSFMYSKPRQTFWLELIFDILNLKKVDRPEIMTGPVLLTNKIEEYQKRMIGKHLDMIVYPPQYFNPFSWIDPSDVDRNCMTSNQMTAENLEKCRYSLKAKGSYVAQYHFHT 213          
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. Planmine SMEST
Match: SMESG000059803.1 (SMESG000059803.1)

HSP 1 Score: 468.003 bits (1203), Expect = 1.184e-156
Identity = 213/213 (100.00%), Postives = 213/213 (100.00%), Query Frame = 1
Query:  346 MKTWQEDCFKDWKFMFWTDDDNYNFIRVHYPWFLKRYNEFHRNIYRADVSRYFYLFHYGGIYTDLDTECLRPFQHLLQNYSLVFGAMKGHWKGTKLKEGYVQNSFMYSKPRQTFWLELIFDILNLKKVDRPEIMTGPVLLTNKIEEYQKRMIGKHLDMIVYPPQYFNPFSWIDPSDVDRNCMTSNQMTAENLEKCRYSLKAKGSYVAQYHFHT 984
            MKTWQEDCFKDWKFMFWTDDDNYNFIRVHYPWFLKRYNEFHRNIYRADVSRYFYLFHYGGIYTDLDTECLRPFQHLLQNYSLVFGAMKGHWKGTKLKEGYVQNSFMYSKPRQTFWLELIFDILNLKKVDRPEIMTGPVLLTNKIEEYQKRMIGKHLDMIVYPPQYFNPFSWIDPSDVDRNCMTSNQMTAENLEKCRYSLKAKGSYVAQYHFHT
Sbjct:    1 MKTWQEDCFKDWKFMFWTDDDNYNFIRVHYPWFLKRYNEFHRNIYRADVSRYFYLFHYGGIYTDLDTECLRPFQHLLQNYSLVFGAMKGHWKGTKLKEGYVQNSFMYSKPRQTFWLELIFDILNLKKVDRPEIMTGPVLLTNKIEEYQKRMIGKHLDMIVYPPQYFNPFSWIDPSDVDRNCMTSNQMTAENLEKCRYSLKAKGSYVAQYHFHT 213          
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. Planmine SMEST
Match: SMESG000045480.1 (SMESG000045480.1)

HSP 1 Score: 345.895 bits (886), Expect = 3.462e-119
Identity = 160/238 (67.23%), Postives = 188/238 (78.99%), Query Frame = 1
Query:  274 EQNLSKIIHFSWKNKKIPNFFINFMKTWQEDCFKDWKFMFWTDDDNYNFIRVHYPWFLKRYNEFHRNIYRADVSRYFYLFHYGGIYTDLDTECLRPFQHLLQNYSLVFGAMKGHWKGTKLKEGYVQNSFMYSKPRQTFWLELIFDILNLKKVDRPEIMTGPVLLTNKIEEYQKRMIGKHLDMIVYPPQYFNPFSWIDPSDVDRNCMTSNQMTAENLEKCRYSLKAKGSYVAQYHFHTW 987
            ++ ++KIIH SWK   IP  F  ++K+W + C+KDWKFMFWTD DNYN I+  YPWFLK YNEF RNIYRADVSRYFYLFHYGGIYTDLD ECLRPF+HLLQNYS+VFGAMKG + GT LKEGYVQNSFMYS+PRQTFW+EL+ DIL  K  D  E+ TGPVLL+ +I  Y++R+     DM++Y P YFNPFSWID S VD NC + NQMT ENL KCR S+ +KGSYV QYH H+W
Sbjct:   47 KEKVTKIIHVSWKTNDIPVVFQKYLKSWTDFCYKDWKFMFWTDKDNYNLIKTFYPWFLKTYNEFPRNIYRADVSRYFYLFHYGGIYTDLDNECLRPFEHLLQNYSIVFGAMKGQYLGTNLKEGYVQNSFMYSRPRQTFWMELLNDILMFKGTDSVEVQTGPVLLSKRIALYRERLNSSD-DMMIYSPNYFNPFSWIDNSKVDPNCKSPNQMTRENLNKCRSSMLSKGSYVVQYHAHSW 283          
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. Planmine SMEST
Match: SMESG000045267.1 (SMESG000045267.1)

HSP 1 Score: 342.043 bits (876), Expect = 1.043e-117
Identity = 158/238 (66.39%), Postives = 187/238 (78.57%), Query Frame = 1
Query:  274 EQNLSKIIHFSWKNKKIPNFFINFMKTWQEDCFKDWKFMFWTDDDNYNFIRVHYPWFLKRYNEFHRNIYRADVSRYFYLFHYGGIYTDLDTECLRPFQHLLQNYSLVFGAMKGHWKGTKLKEGYVQNSFMYSKPRQTFWLELIFDILNLKKVDRPEIMTGPVLLTNKIEEYQKRMIGKHLDMIVYPPQYFNPFSWIDPSDVDRNCMTSNQMTAENLEKCRYSLKAKGSYVAQYHFHTW 987
            ++ ++KIIH SWK   IP  F  ++K+W + C+KDW FMFWTD DNYN I+  YPWFLK YN+F RNIYRADVSRYFYLFHYGGIYTDLD ECLRPF+HLLQNYS+VFGAMKG + GT LKEGYVQNSFMYS+PRQTFW+EL+ DIL  K  D  E+ TGPVLL+ +I  Y++R+     DM++Y P YFNPFSWID S VD NC + NQMT ENL KCR S+ +KGSYV QYH H+W
Sbjct:   47 KEKVTKIIHVSWKTNDIPVVFQKYLKSWTDFCYKDWNFMFWTDKDNYNLIKTFYPWFLKTYNKFPRNIYRADVSRYFYLFHYGGIYTDLDNECLRPFEHLLQNYSIVFGAMKGQYLGTNLKEGYVQNSFMYSRPRQTFWMELLNDILMFKGTDSVEVQTGPVLLSKRIALYRERLNSSD-DMMIYSPNYFNPFSWIDNSKVDLNCKSHNQMTRENLNKCRSSMISKGSYVVQYHAHSW 283          
The following BLAST results are available for this feature:
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P33300|SUR1_YEAST1.608e-1932.18Mannosyl phosphorylinositol ceramide synthase SUR1... [more]
sp|Q10323|IMT3_SCHPO3.014e-1844.44Inositol phosphoceramide mannosyltransferase 3 OS=... [more]
sp|P38287|CSH1_YEAST4.636e-1834.08Mannosyl phosphorylinositol ceramide synthase CSH1... [more]
sp|Q9UT67|IMT2_SCHPO4.677e-1734.41Inositol phosphoceramide mannosyltransferase 2 OS=... [more]
sp|O14084|IMT1_SCHPO1.739e-1526.04Inositol phosphoceramide mannosyltransferase 1 OS=... [more]
back to top
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8HSW62.216e-5741.46Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8HLW63.045e-5741.46Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8H5Y85.046e-5541.67Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8FU406.099e-5541.63Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267F5S55.562e-5441.27Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
SUR12.316e-2132.18Mannosylinositol phosphorylceramide (MIPC) synthas... [more]
CSH16.677e-2034.08Mannosylinositol phosphorylceramide (MIPC) synthas... [more]
OCH14.333e-929.41Mannosyltransferase of the cis-Golgi apparatus; in... [more]
back to top
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000059799.14.853e-16395.05SMESG000059799.1[more]
SMESG000059803.19.683e-157100.00SMESG000059803.1[more]
SMESG000059803.11.184e-156100.00SMESG000059803.1[more]
SMESG000045480.13.462e-11967.23SMESG000045480.1[more]
SMESG000045267.11.043e-11766.39SMESG000045267.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024675 ID=SMED30024675|Name=inositol phosphoceramide mannosyltransferase 2-like|organism=Schmidtea mediterranea sexual|type=transcript|length=1045bp
CACTCAACCGTGACACGGACCAAATTTTGGTAGAATTATTTATATAAATT
GTTATAATGATTGCTGTTGAGATTCTGTATTATAATTCTGTGTATTATGC
TGTGAAATAATAATTCACATAAAATATATATTGGAATACTCACAAATGCC
ATTGCAATGATGAATTTAAACAAATTATTTACTATATGTTTGATTATAGC
AATAATATTTTTATTGTTGAACTCATTTAATGTCAGAAAAGCGATTATAT
TCCAGAAACCAGAATTCATTTATGAGCAAAATTTATCAAAAATAATACAT
TTCTCTTGGAAGAATAAAAAAATACCAAATTTTTTCATAAACTTCATGAA
AACTTGGCAAGAAGACTGCTTTAAAGATTGGAAATTCATGTTCTGGACTG
ATGACGATAACTATAACTTTATCCGAGTCCATTATCCGTGGTTTCTCAAA
AGATACAATGAATTTCACAGGAATATTTACCGGGCAGATGTTAGTCGCTA
CTTCTATTTGTTTCATTATGGCGGCATTTACACTGATCTTGACACGGAAT
GTTTGCGTCCCTTTCAGCATCTGTTGCAGAATTATTCCCTTGTTTTTGGA
GCTATGAAAGGCCATTGGAAGGGTACGAAATTAAAAGAAGGATACGTGCA
AAACTCATTTATGTATTCAAAGCCTCGACAAACGTTTTGGTTGGAGTTGA
TATTTGATATTTTAAACTTAAAAAAAGTTGACAGACCTGAAATTATGACT
GGGCCAGTTCTTTTGACTAATAAAATTGAAGAATATCAGAAGCGAATGAT
TGGCAAACATCTTGATATGATTGTTTACCCCCCTCAATATTTCAATCCTT
TCAGCTGGATTGATCCATCCGATGTTGACCGAAATTGTATGACTAGTAAT
CAAATGACAGCTGAAAATTTGGAAAAATGTAGGTATTCTTTAAAAGCTAA
AGGATCCTATGTTGCTCAGTACCATTTTCATACATGGTAAAGGTTTCATT
TTATGTAGAATTTGTTTCAATAAATTCAAGTTTTGTGTTTTGTGA
back to top

protein sequence of SMED30024675-orf-1

>SMED30024675-orf-1 ID=SMED30024675-orf-1|Name=SMED30024675-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=278bp
MMNLNKLFTICLIIAIIFLLLNSFNVRKAIIFQKPEFIYEQNLSKIIHFS
WKNKKIPNFFINFMKTWQEDCFKDWKFMFWTDDDNYNFIRVHYPWFLKRY
NEFHRNIYRADVSRYFYLFHYGGIYTDLDTECLRPFQHLLQNYSLVFGAM
KGHWKGTKLKEGYVQNSFMYSKPRQTFWLELIFDILNLKKVDRPEIMTGP
VLLTNKIEEYQKRMIGKHLDMIVYPPQYFNPFSWIDPSDVDRNCMTSNQM
TAENLEKCRYSLKAKGSYVAQYHFHTW*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR007577GlycoTrfase_DXD_sugar-bd_CS
IPR029044Nucleotide-diphossugar_trans
Vocabulary: molecular function
TermDefinition
GO:0016740transferase activity
GO:0016757transferase activity, transferring glycosyl groups
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR007577Glycosyltransferase, DXD sugar-binding motifPFAMPF04488Gly_transf_sugcoord: 64..143
e-value: 7.8E-16
score: 58.5
NoneNo IPR availableGENE3DG3DSA:3.90.550.20coord: 44..267
e-value: 1.8E-16
score: 63.1
NoneNo IPR availablePANTHERPTHR32385FAMILY NOT NAMEDcoord: 45..277
NoneNo IPR availableTMHMMTMhelixcoord: 7..26
IPR029044Nucleotide-diphospho-sugar transferasesSUPERFAMILYSSF53448Nucleotide-diphospho-sugar transferasescoord: 44..248