Dynein regulatory complex subunit 3

Overview
NameDynein regulatory complex subunit 3
Smed IDSMED30024663
Length (bp)1680
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dynein regulatory complex subunit 3 (SMED30024663) t-SNE clustered cells

Violin plots show distribution of expression levels for Dynein regulatory complex subunit 3 (SMED30024663) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dynein regulatory complex subunit 3 (SMED30024663) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dynein regulatory complex subunit 3 (SMED30024663) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024663

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30024663SMESG000047633.1 SMESG000047632.1 SmedASXL_009096SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30024663SMESG000047633.1 SMESG000047632.1 dd_Smed_v4_12541_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30024663SMESG000047633.1 SMESG000047632.1 dd_Smed_v4_12541_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30024663SMESG000047633.1 SMESG000047632.1 dd_Smed_v4_12541_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30024663SMESG000047633.1 SMESG000047632.1 dd_Smed_v6_12541_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30024663SMESG000047633.1 SMESG000047632.1 dd_Smed_v4_12541_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Human
Match: DRC3 (dynein regulatory complex subunit 3 [Source:HGNC Symbol;Acc:HGNC:25384])

HSP 1 Score: 382.489 bits (981), Expect = 1.626e-126
Identity = 224/518 (43.24%), Postives = 343/518 (66.22%), Query Frame = 1
Query:  118 MSRLYDTIEPSVITEEMLRTTVYEQGPKGTAGQIAKAEGLSFEKVQSLRLSYKNILEVDNLWWFKNLTKLQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLVNIEDLTLFNNRIKKMENLEHLKQLQVXXXXXXXXXXXXXXKYLRTFKSLKAINLSGNPCCEKDEFRVVVLAYLPQLIYLDYKLINEEERKICCEKEQIRIESLQSDXXXXXXXXXXXXXXMNQEELYNLAFVDGLDKDQLFESLFSDDMEGQRLKELPKNAEHAEEFRKKFSESCYGLFECGLQEHERRQEEVSAFYECLNDAKYSNKKSGMELINEFILYKRDVMNALGNDTN-PNXXXXXXXXXXXXALQYN-LMALELHLVDQIEELVGEFDRNLLDIVLKFKENVESYFGKCRELDVIYQSKVSEEALAIQEKINKGDPTDDISEDLRMILIDKDSMTNALSASKDAHMLKIDSKSDSISNRVQDWFKNLFDTIKTKEEIERNRSRVLEINLLIDNFNLELENLD 1665
            M++  +++EP V+ ++ML+  V +QGP+  AGQ+AK EG+ F+ V SL+L ++NIL +DNLW F+NL KLQLDNNIIEKI GL +L  L WLDLSFNNIE IEG+D+LVN+EDL+LFNNRI K+++L+ L +LQVLS+GNN ID++ N+ YLR FK L+ ++LS NP  E +++++ + AYLP L+YLDY+ I++  +K+   K Q  I+ L+  E   + Q+E+E+ +  + E +  AFV+ L+   LF+S++++D EG  L  LP   E  E ++ KF   C  +FE GL++ E+R+ E+  F EC+ +A   N++ G   I +F       ++A+  +   PN +          +  ++ LM LE+ LV+Q+EE +  F+RN++D+V  F ENV+S   +CR+L+  +  K+ E +++  EKI +GD  +D+  DLR + +DKD++ NA+ AS D H+LKID++ D +  R+  W   L D I  K+EI RNR RV EIN  ID+   EL+NL+
Sbjct:    1 MNQPCNSMEPRVMDDDMLKLAVGDQGPQEEAGQLAKQEGILFKDVLSLQLDFRNILRIDNLWQFENLRKLQLDNNIIEKIEGLENLAHLVWLDLSFNNIETIEGLDTLVNLEDLSLFNNRISKIDSLDALVKLQVLSLGNNRIDNMMNIIYLRRFKCLRTLSLSRNPISEAEDYKMFICAYLPDLMYLDYRRIDDHTKKLAEAKHQYSIDELKHQENLMQAQLEDEQAQREELEKHKTAFVEHLNGSFLFDSMYAEDSEGNNLSYLPGVGELLETYKDKFVIICVNIFEYGLKQQEKRKTELDTFSECVREAIQENQEQGKRKIAKFEEKHLSSLSAIREELELPNIEKMILECSADISELFDALMTLEMQLVEQLEETINMFERNIVDMVGLFIENVQSLMAQCRDLENHHHEKLLEISISTLEKIVEGDLDEDLPNDLRALFVDKDTIVNAVGASHDIHLLKIDNREDELVTRINSWCTRLIDRIH-KDEIMRNRKRVKEINQYIDHMQSELDNLE 517          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Human
Match: DRC3 (dynein regulatory complex subunit 3 [Source:HGNC Symbol;Acc:HGNC:25384])

HSP 1 Score: 382.489 bits (981), Expect = 1.626e-126
Identity = 224/518 (43.24%), Postives = 343/518 (66.22%), Query Frame = 1
Query:  118 MSRLYDTIEPSVITEEMLRTTVYEQGPKGTAGQIAKAEGLSFEKVQSLRLSYKNILEVDNLWWFKNLTKLQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLVNIEDLTLFNNRIKKMENLEHLKQLQVXXXXXXXXXXXXXXKYLRTFKSLKAINLSGNPCCEKDEFRVVVLAYLPQLIYLDYKLINEEERKICCEKEQIRIESLQSDXXXXXXXXXXXXXXMNQEELYNLAFVDGLDKDQLFESLFSDDMEGQRLKELPKNAEHAEEFRKKFSESCYGLFECGLQEHERRQEEVSAFYECLNDAKYSNKKSGMELINEFILYKRDVMNALGNDTN-PNXXXXXXXXXXXXALQYN-LMALELHLVDQIEELVGEFDRNLLDIVLKFKENVESYFGKCRELDVIYQSKVSEEALAIQEKINKGDPTDDISEDLRMILIDKDSMTNALSASKDAHMLKIDSKSDSISNRVQDWFKNLFDTIKTKEEIERNRSRVLEINLLIDNFNLELENLD 1665
            M++  +++EP V+ ++ML+  V +QGP+  AGQ+AK EG+ F+ V SL+L ++NIL +DNLW F+NL KLQLDNNIIEKI GL +L  L WLDLSFNNIE IEG+D+LVN+EDL+LFNNRI K+++L+ L +LQVLS+GNN ID++ N+ YLR FK L+ ++LS NP  E +++++ + AYLP L+YLDY+ I++  +K+   K Q  I+ L+  E   + Q+E+E+ +  + E +  AFV+ L+   LF+S++++D EG  L  LP   E  E ++ KF   C  +FE GL++ E+R+ E+  F EC+ +A   N++ G   I +F       ++A+  +   PN +          +  ++ LM LE+ LV+Q+EE +  F+RN++D+V  F ENV+S   +CR+L+  +  K+ E +++  EKI +GD  +D+  DLR + +DKD++ NA+ AS D H+LKID++ D +  R+  W   L D I  K+EI RNR RV EIN  ID+   EL+NL+
Sbjct:    1 MNQPCNSMEPRVMDDDMLKLAVGDQGPQEEAGQLAKQEGILFKDVLSLQLDFRNILRIDNLWQFENLRKLQLDNNIIEKIEGLENLAHLVWLDLSFNNIETIEGLDTLVNLEDLSLFNNRISKIDSLDALVKLQVLSLGNNRIDNMMNIIYLRRFKCLRTLSLSRNPISEAEDYKMFICAYLPDLMYLDYRRIDDHTKKLAEAKHQYSIDELKHQENLMQAQLEDEQAQREELEKHKTAFVEHLNGSFLFDSMYAEDSEGNNLSYLPGVGELLETYKDKFVIICVNIFEYGLKQQEKRKTELDTFSECVREAIQENQEQGKRKIAKFEEKHLSSLSAIREELELPNIEKMILECSADISELFDALMTLEMQLVEQLEETINMFERNIVDMVGLFIENVQSLMAQCRDLENHHHEKLLEISISTLEKIVEGDLDEDLPNDLRALFVDKDTIVNAVGASHDIHLLKIDNREDELVTRINSWCTRLIDRIH-KDEIMRNRKRVKEINQYIDHMQSELDNLE 517          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Human
Match: DRC3 (dynein regulatory complex subunit 3 [Source:HGNC Symbol;Acc:HGNC:25384])

HSP 1 Score: 316.235 bits (809), Expect = 1.174e-101
Identity = 188/441 (42.63%), Postives = 293/441 (66.44%), Query Frame = 1
Query:  118 MSRLYDTIEPSVITEEMLRTTVYEQGPKGTAGQIAKAEGLSFEKVQSLRLSYKNILEVDNLWWFKNLTKLQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLVNIEDLTLFNNRIKKMENLEHLKQLQVXXXXXXXXXXXXXXKYLRTFKSLKAINLSGNPCCEKDEFRVVVLAYLPQLIYLDYKLINEEERKICCEKEQIRIESLQSDXXXXXXXXXXXXXXMNQEELYNLAFVDGLDKDQLFESLFSDDMEGQRLKELPKNAEHAEEFRKKFSESCYGLFECGLQEHERRQEEVSAFYECLNDAKYSNKKSGMELINEFILYKRDVMNALGNDTN-PNXXXXXXXXXXXXALQYN-LMALELHLVDQIEELVGEFDRNLLDIVLKFKENVESYFGKCRELDVIYQSKVSEEALAIQEKINKGDPTDDISEDLR 1434
            M++  +++EP V+ ++ML+  V +QGP+  AGQ+AK EG+ F+ V SL+L ++NIL +DNLW F+NL KLQLDNNIIEKI GL +L  L WLDLSFNNIE IEG+D+LVN+EDL+LFNNRI K+++L+ L +LQVLS+GNN ID++ N+ YLR FK L+ ++LS NP  E +++++ + AYLP L+YLDY+ I++  +K+   K Q  I+ L+  E   + Q+E+E+ +  + E +  AFV+ L+   LF+S++++D EG  L  LP   E  E ++ KF   C  +FE GL++ E+R+ E+  F EC+ +A   N++ G   I +F       ++A+  +   PN +          +  ++ LM LE+ LV+Q+EE +  F+RN++D+V  F ENV+S   +CR+L+  +  K+ E +++  EKI +GD  +D+  DLR
Sbjct:    1 MNQPCNSMEPRVMDDDMLKLAVGDQGPQEEAGQLAKQEGILFKDVLSLQLDFRNILRIDNLWQFENLRKLQLDNNIIEKIEGLENLAHLVWLDLSFNNIETIEGLDTLVNLEDLSLFNNRISKIDSLDALVKLQVLSLGNNRIDNMMNIIYLRRFKCLRTLSLSRNPISEAEDYKMFICAYLPDLMYLDYRRIDDHTKKLAEAKHQYSIDELKHQENLMQAQLEDEQAQREELEKHKTAFVEHLNGSFLFDSMYAEDSEGNNLSYLPGVGELLETYKDKFVIICVNIFEYGLKQQEKRKTELDTFSECVREAIQENQEQGKRKIAKFEEKHLSSLSAIREELELPNIEKMILECSADISELFDALMTLEMQLVEQLEETINMFERNIVDMVGLFIENVQSLMAQCRDLENHHHEKLLEISISTLEKIVEGDLDEDLPNDLR 441          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Human
Match: DRC3 (dynein regulatory complex subunit 3 [Source:HGNC Symbol;Acc:HGNC:25384])

HSP 1 Score: 316.235 bits (809), Expect = 1.174e-101
Identity = 188/441 (42.63%), Postives = 293/441 (66.44%), Query Frame = 1
Query:  118 MSRLYDTIEPSVITEEMLRTTVYEQGPKGTAGQIAKAEGLSFEKVQSLRLSYKNILEVDNLWWFKNLTKLQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLVNIEDLTLFNNRIKKMENLEHLKQLQVXXXXXXXXXXXXXXKYLRTFKSLKAINLSGNPCCEKDEFRVVVLAYLPQLIYLDYKLINEEERKICCEKEQIRIESLQSDXXXXXXXXXXXXXXMNQEELYNLAFVDGLDKDQLFESLFSDDMEGQRLKELPKNAEHAEEFRKKFSESCYGLFECGLQEHERRQEEVSAFYECLNDAKYSNKKSGMELINEFILYKRDVMNALGNDTN-PNXXXXXXXXXXXXALQYN-LMALELHLVDQIEELVGEFDRNLLDIVLKFKENVESYFGKCRELDVIYQSKVSEEALAIQEKINKGDPTDDISEDLR 1434
            M++  +++EP V+ ++ML+  V +QGP+  AGQ+AK EG+ F+ V SL+L ++NIL +DNLW F+NL KLQLDNNIIEKI GL +L  L WLDLSFNNIE IEG+D+LVN+EDL+LFNNRI K+++L+ L +LQVLS+GNN ID++ N+ YLR FK L+ ++LS NP  E +++++ + AYLP L+YLDY+ I++  +K+   K Q  I+ L+  E   + Q+E+E+ +  + E +  AFV+ L+   LF+S++++D EG  L  LP   E  E ++ KF   C  +FE GL++ E+R+ E+  F EC+ +A   N++ G   I +F       ++A+  +   PN +          +  ++ LM LE+ LV+Q+EE +  F+RN++D+V  F ENV+S   +CR+L+  +  K+ E +++  EKI +GD  +D+  DLR
Sbjct:    1 MNQPCNSMEPRVMDDDMLKLAVGDQGPQEEAGQLAKQEGILFKDVLSLQLDFRNILRIDNLWQFENLRKLQLDNNIIEKIEGLENLAHLVWLDLSFNNIETIEGLDTLVNLEDLSLFNNRISKIDSLDALVKLQVLSLGNNRIDNMMNIIYLRRFKCLRTLSLSRNPISEAEDYKMFICAYLPDLMYLDYRRIDDHTKKLAEAKHQYSIDELKHQENLMQAQLEDEQAQREELEKHKTAFVEHLNGSFLFDSMYAEDSEGNNLSYLPGVGELLETYKDKFVIICVNIFEYGLKQQEKRKTELDTFSECVREAIQENQEQGKRKIAKFEEKHLSSLSAIREELELPNIEKMILECSADISELFDALMTLEMQLVEQLEETINMFERNIVDMVGLFIENVQSLMAQCRDLENHHHEKLLEISISTLEKIVEGDLDEDLPNDLR 441          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Human
Match: DRC3 (dynein regulatory complex subunit 3 [Source:HGNC Symbol;Acc:HGNC:25384])

HSP 1 Score: 164.081 bits (414), Expect = 1.219e-47
Identity = 80/135 (59.26%), Postives = 109/135 (80.74%), Query Frame = 1
Query:  118 MSRLYDTIEPSVITEEMLRTTVYEQGPKGTAGQIAKAEGLSFEKVQSLRLSYKNILEVDNLWWFKNLTKLQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLVNIEDLTLFNNRIKKMENLEHLKQLQV 522
            M++  +++EP V+ ++ML+  V +QGP+  AGQ+AK EG+ F+ V SL+L ++NIL +DNLW F+NL KLQLDNNIIEKI GL +L  L WLDLSFNNIE IEG+D+LVN+EDL+LFNNRI K+++L+ L +LQV
Sbjct:    1 MNQPCNSMEPRVMDDDMLKLAVGDQGPQEEAGQLAKQEGILFKDVLSLQLDFRNILRIDNLWQFENLRKLQLDNNIIEKIEGLENLAHLVWLDLSFNNIETIEGLDTLVNLEDLSLFNNRISKIDSLDALVKLQV 135          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Celegans
Match: sds-22 (Protein phosphatase 1 regulatory subunit SDS22 homolog [Source:UniProtKB/Swiss-Prot;Acc:P45969])

HSP 1 Score: 58.5362 bits (140), Expect = 4.205e-9
Identity = 40/106 (37.74%), Postives = 60/106 (56.60%), Query Frame = 1
Query:  208 AGQIAKAEGLSFEKVQSLRLSYKNILEVD-NLWWFKNLTKLQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLVNIEDLTLFNNRIKKMENLEHLKQLQV 522
            A  I    G  F K++ LR+    ++ +   +     LT L L  N + +IS L  L++L  LDLS+N I  I G+D L  +E L L +N+I+K+ENLE L QL++
Sbjct:   48 ADHIPDLTG--FPKIEELRMRNNLLVSISPTISSLVTLTSLDLYENQLTEISHLESLVNLVSLDLSYNRIRQINGLDKLTKLETLYLVSNKIEKIENLEALTQLKL 151          

HSP 2 Score: 55.4546 bits (132), Expect = 4.688e-8
Identity = 38/95 (40.00%), Postives = 56/95 (58.95%), Query Frame = 1
Query:  238 SFEKVQSLRLSYKNILEVDNLWWFKNLTKLQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLVNIEDLTLFNNRIKKMENLEHLKQLQV 522
            S   + SL LSY  I +++ L     L  L L +N IEKI  L  L  LK L+L  N I+ IE I  LVN+++L +  N+I+++E +E L++L V
Sbjct:  101 SLVNLVSLDLSYNRIRQINGLDKLTKLETLYLVSNKIEKIENLEALTQLKLLELGDNRIKKIENIGHLVNLDELFIGKNKIRQLEGVETLQKLSV 195          

HSP 3 Score: 52.7582 bits (125), Expect = 3.197e-7
Identity = 37/93 (39.78%), Postives = 53/93 (56.99%), Query Frame = 1
Query:  238 SFEKVQSLRLSYKNILEVDNLWWFKNLTKLQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLVNIEDLTLFNNRIKKMENLEHLKQL 516
            S   + SL L    + E+ +L    NL  L L  N I +I+GL+ L  L+ L L  N IE IE +++L  ++ L L +NRIKK+EN+ HL  L
Sbjct:   79 SLVTLTSLDLYENQLTEISHLESLVNLVSLDLSYNRIRQINGLDKLTKLETLYLVSNKIEKIENLEALTQLKLLELGDNRIKKIENIGHLVNL 171          

HSP 4 Score: 52.373 bits (124), Expect = 3.959e-7
Identity = 36/103 (34.95%), Postives = 60/103 (58.25%), Query Frame = 1
Query:  214 QIAKAEGLS-FEKVQSLRLSYKNILEVDNLWWFKNLTKLQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLVNIEDLTLFNNRIKKMENLEHLKQLQ 519
            +I +  GL    K+++L L    I +++NL     L  L+L +N I+KI  + HL++L  L +  N I  +EG+++L  +  L+L  NRI K+EN+E L  L+
Sbjct:  114 RIRQINGLDKLTKLETLYLVSNKIEKIENLEALTQLKLLELGDNRIKKIENIGHLVNLDELFIGKNKIRQLEGVETLQKLSVLSLPGNRIVKIENVEQLNNLK 216          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Celegans
Match: C06A8.6 (pep chromosome:WBcel235:II:7772499:7773914:1 gene:WBGene00015516.1 transcript:C06A8.6.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C06A8.6)

HSP 1 Score: 58.5362 bits (140), Expect = 5.476e-9
Identity = 41/105 (39.05%), Postives = 63/105 (60.00%), Query Frame = 1
Query:  211 GQIAKAEGL-SFEKVQSLRLSYKNILEVDNLWWFKNLTKLQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLVNIEDLTLFNNRIKKMENLEHLKQLQV 522
             QI K E L S   ++SL LS+  I +++NL     L  L   +N I KI GL+ L  L++L+L  N I  IE +D+ + ++ L L  N+I+ +EN++HLK+L V
Sbjct:   86 NQITKVENLDSLVNLESLDLSFNRITKIENLEKLTKLKTLFFVHNKITKIEGLDTLTELEYLELGDNRIAKIENLDNNLKLDRLFLGANQIRLIENVDHLKKLTV 190          

HSP 2 Score: 53.5286 bits (127), Expect = 2.063e-7
Identity = 37/122 (30.33%), Postives = 64/122 (52.46%), Query Frame = 1
Query:  169 LRTTVYEQGPKGTAGQIAKAEGLSFEKV----QSLRLSYKNILEVDNLWWFKNLTKLQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLVNIEDLTLFNNRIKKMENLEHLKQLQV 522
            + +   E G K     + + E + + ++    +++ L+   I E+ +  W  ++       N+I+KI  L+ L +L  L+   N I  +E +DSLVN+E L L  NRI K+ENLE L +L+ 
Sbjct:    3 VTSVTSEDGVKEFEKIVVEPEDIEYVEIPADAKNVDLTRHRIKEIGDYSWLTHVEHFSFRWNLIKKIENLDCLTTLTHLEFYDNQITKVENLDSLVNLESLDLSFNRITKIENLEKLTKLKT 124          

HSP 3 Score: 51.2174 bits (121), Expect = 1.071e-6
Identity = 50/159 (31.45%), Postives = 78/159 (49.06%), Query Frame = 1
Query:  211 GQIAKAEGLSFE-KVQSLRLSYKNILEVDNLWWFKNLTKLQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLVNIEDLTLFNNRIKKMENLEHLKQLQVXXXXXXXXXXXXXXKYLRTFKSLKAINLSGNPCCEKDEFRVVVLAYLPQLIYLD 684
             +IAK E L    K+  L L    I  ++N+   K LT L L  N I  +  ++ L +LK + L+ N I+ + GID  + +E L    NR++K+EN+  LK L       N +D+ + +  L     L ++ L  NP    D +R  V+  L Q+  LD
Sbjct:  152 NRIAKIENLDNNLKLDRLFLGANQIRLIENVDHLKKLTVLSLPANAITVVDNISGLHNLKEIYLAQNGIKYVCGIDEHLPLEILDFNQNRLEKVENIHQLKTLTDFWARGNKLDNWSIMDELVELPQLNSVYLDFNPIASVDTYRGKVIHLLQQITRLD 310          

HSP 4 Score: 50.447 bits (119), Expect = 1.837e-6
Identity = 31/90 (34.44%), Postives = 53/90 (58.89%), Query Frame = 1
Query:  250 VQSLRLSYKNILEVDNLWWFKNLTKLQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLVNIEDLTLFNNRIKKMENLEHLKQLQ 519
            V+     +  I +++NL     LT L+  +N I K+  L+ L++L+ LDLSFN I  IE ++ L  ++ L   +N+I K+E L+ L +L+
Sbjct:   56 VEHFSFRWNLIKKIENLDCLTTLTHLEFYDNQITKVENLDSLVNLESLDLSFNRITKIENLEKLTKLKTLFFVHNKITKIEGLDTLTELE 145          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Celegans
Match: K10D2.8 (pep chromosome:WBcel235:III:5188726:5190175:1 gene:WBGene00189952.1 transcript:K10D2.8.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:K10D2.8)

HSP 1 Score: 57.3806 bits (137), Expect = 1.122e-8
Identity = 32/84 (38.10%), Postives = 56/84 (66.67%), Query Frame = 1
Query:  250 VQSLRLSYKNILEVDNLWWFKNLTKLQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLVNIEDLTLFNNRIKKMENLE 501
            ++ L L +  + ++D+     +LT+L L++N IEK+  L  L++L +LD+S+N I  IEG+  L+N+E+L L +N+I  +E LE
Sbjct:   51 IRDLSLRWNLLKKIDHFQCLTSLTRLNLNDNQIEKLENLETLVNLVFLDVSYNRITKIEGLSELINLEELHLVHNKIITIEGLE 134          

HSP 2 Score: 49.6766 bits (117), Expect = 3.253e-6
Identity = 36/103 (34.95%), Postives = 58/103 (56.31%), Query Frame = 1
Query:  214 QIAKAEGL-SFEKVQSLRLSYKNILEVDNLWWFKNLTKLQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLVNIEDLTLFNNRIKKMENLEHLKQLQ 519
            +I   EGL +   ++ L      I +++NL    NL +L L  N I KI GL+ +  LK L L  N ++IIEG+D+L  ++ ++L  N I+K++ L  L  L+
Sbjct:  126 KIITIEGLETNTAMKYLEFGDNRIQKMENLSHLVNLERLFLGANQIRKIEGLDGMAQLKELSLPGNALQIIEGLDTLSGLKSISLAQNGIRKIDGLSGLTNLK 228          

HSP 3 Score: 48.521 bits (114), Expect = 7.280e-6
Identity = 33/103 (32.04%), Postives = 60/103 (58.25%), Query Frame = 1
Query:  214 QIAKAEGLS-FEKVQSLRLSYKNILEVDNLWWFKNLTKLQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLVNIEDLTLFNNRIKKMENLEHLKQLQ 519
            +I K EGLS    ++ L L +  I+ ++ L     +  L+  +N I+K+  L+HL++L+ L L  N I  IEG+D +  +++L+L  N ++ +E L+ L  L+
Sbjct:  104 RITKIEGLSELINLEELHLVHNKIITIEGLETNTAMKYLEFGDNRIQKMENLSHLVNLERLFLGANQIRKIEGLDGMAQLKELSLPGNALQIIEGLDTLSGLK 206          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Fly
Match: Ppr-Y (gene:FBgn0046697 transcript:FBtr0346721)

HSP 1 Score: 211.46 bits (537), Expect = 7.218e-61
Identity = 162/529 (30.62%), Postives = 289/529 (54.63%), Query Frame = 1
Query:  127 LYDTIEPSVITEEMLRTTVYEQGPKGTAGQIAKAEGLSFEKVQSLRLSYKNILEVDNLWWFKNLTKLQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLVNIEDLTLFNNRIKKMENLEHLKQLQVXXXXXXXXXXXXXXKYLRTFKSLKAINLSGNPCCEKDEFRVV--VLAYLPQLIYLDYKLINEEERKICCEKEQIRIESLQSDXXXXXXXXXXXXXXMNQEELYNLAFVDGLDKDQLFESLFSDDMEGQRLKELPKNA-EHAEEFRKKFSESCYGLFECGLQEHERRQEEVSAFYECLNDAKYSNKKSGMELINEFILYKRDVM------------NAL-GNDTNPNXXXXXXXXXXXXALQYN---------LMALELHLVDQIEELVGEFDRNLLDIVLKFKENVESYFGKCRELDVIYQSKVSE-EALAIQEKINKGDPTDDISEDLRMILIDKDSMTNALSASKDAHMLKIDSKSDSISNRVQDWFKNLFDTIKTKEEIERNRSRVLEINLLID 1635
            +Y  IEP +I   ++ ++  +   +G   ++ + E +  E++ ++RL + NIL +D+LW   NLTKL L+ N IE I  +  L +LK L+LSFN IE IE +D+LVN+E L+LF+N+I+ +EN++ L  L ++S+GNNLID +  ++  R   +LK INL GNP  ++  F ++  + A LP+L Y +Y  I  E R   C      I  ++  ++++    +  + + ++ +    +FV+ LD  QLF+SL+  D +G+ L  +   A E A+E+ K   E    +++ GL+    R EE+  F+  L D +   +  G   I  F+ ++  +             N++ G D +  E LK         +Q+          LMA EL+L + I+E    F R + +++ KF E  +++F + RE+ + +   ++E     I  K    D  DD+  +LR+ + D+D++ N ++  KD H L++D + D+I+ R +++  N+ D + +  E+ER+RS++LEIN  ++
Sbjct:   20 IYPDIEPGIINRSLIESSYLKHVHRGEGRRLHQLEPVVLEQILTMRLEFNNILRIDHLWILPNLTKLCLNCNKIETIENIEMLTNLKDLNLSFNFIEKIENLDTLVNLEVLSLFSNKIEAIENIDMLTMLVIISLGNNLIDTVEGIERFRFMNNLKIINLEGNPIAKRTNFCLLKYISAILPKLNYYEYTFIKSELRAEACNLYYREIREIEDKQEKEIQARKFLEREQSEAKRLASSFVEHLDGHQLFDSLWRGDEDGRVLMLVGTQAQELADEYDKDIFELTQEIYKLGLERFTERDEEIRDFFNNLFDGQEELQILGQNEIEWFLQFREIIFEEARIRLLKLEQNSMHGEDEDTPENLKLSDALDKLNIQFEDAINDLWQALMAQELYLHESIQESTINFHRKIAELMSKFVEQSQAFFVQLREITLHFSENMTEILTRFISTKFALQD-FDDVPIELRVCVDDRDAILNLIAGMKDYHTLRLDEREDTIATRTKEFVDNMIDQLNSN-EVERHRSKILEINFFVE 546          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Fly
Match: TbCMF46 (gene:FBgn0032163 transcript:FBtr0079898)

HSP 1 Score: 204.527 bits (519), Expect = 2.371e-58
Identity = 160/529 (30.25%), Postives = 286/529 (54.06%), Query Frame = 1
Query:  142 EPSVITEEMLRTTVYEQGPKGTAGQIAKAEGLSFEKVQSLRLSYKNILEVDNLWWFKNLTKLQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLVNIEDLTLFNNRIKKMENLEHLKQLQVXXXXXXXXXXXXXXKYLRTFKSLKAINLSGNPCCEKDEF--RVVVLAYLPQLIYLDYKLINEEERKICCEKEQIRIESLQSDXXXXXXXXXXXXXXMNQEELYNLAFVDGLDKDQLFESLFSDDMEGQRLKELPKNA-EHAEEFRKKFSESCYGLFECGLQEHERRQEEVSAFYECLNDAKYSNKKSGMELINEFILYKR---DVMNALGNDTNPNXXXXXXXXXXXXALQYN-----------LMALELHLVDQIEELVGEFDRNLLDIVLKFKENVESYFGKCRELDVIYQSKVSEEALAIQEKINKGDPTDDISEDLRMILIDKDSMTNALSASKDAHMLKIDSKSDSISNRVQDWFKNLFDTIKTKEEIERNRSRVLEINLLIDNFNLELENLDYQIN 1677
            EP +I  +M+ T   E+G KG A ++ + E + ++++ ++RL +KNIL +D+LW   NLTKL L+ N IE I  L  L +LK L+LSFN I  IE ++ LV +E L+LF+NRI+K+EN+  L+ L +LSIGNNLID +  ++ LR   SLK +NL GNP  ++ +F   + V+A LPQL Y +Y  I  E R+   ++    +  ++  ++ +   +E E  +M + +    +FV+ LD  QL++SL+ DD +G+ L  +   A E  EE+ K   E    ++  GL+    R EE+  F   L++ +   +  G   I +F+ YK    D M     + +  +   E+ + ++  L  N           LMA ELHL + +E+   +F+R + D++  F E  +  F + R+L   +   +++            +  + I E+L+  + D++++   +   +  H  ++D + D ++ R + +  ++   +  K E++R+R+++LEIN  ++     L NL  +++
Sbjct:   33 EPGIIDRQMIETAYLEEGKKGEARRLHQLEPVVYDRITTMRLEFKNILRIDHLWMMPNLTKLCLNCNKIEVIEHLEMLTALKDLNLSFNYITRIENLEKLVKLEKLSLFSNRIRKIENIHTLQNLVILSIGNNLIDTVEGIERLRFVSSLKVLNLEGNPIAKQPDFPLSLYVIAILPQLNYYEYVFIKTETREEAQKRFYRELREIEDKQEREIQGLETEAREMAEADRLASSFVEHLDGMQLYDSLWRDDEDGRILMLVGAPAQELCEEYSKDVYELTQQIYRLGLERFGERDEEIRDFNANLHEGQEELQAQGQRQIEDFLEYKERIFDEMRLKWRELDQRDDDLEQLQAQLDTLTANFEDSLNELWESLMAQELHLHEAVEDSTLKFNRKISDLMSNFVEQAQVIFLQLRDLCSYFADNMTDIVNQFLSTKLARNELNTIPEELKQCVDDREAVLQLVEGMRTTHTSRVDKREDRLAQRSRQFIDDMITNLNNK-EVDRHRAKILEINSFMEMMTEALANLPGELH 560          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Fly
Match: sds22 (gene:FBgn0028992 transcript:FBtr0083436)

HSP 1 Score: 58.151 bits (139), Expect = 6.619e-9
Identity = 40/104 (38.46%), Postives = 62/104 (59.62%), Query Frame = 1
Query:  211 GQIAKAEGLS-FEKVQSLRLSYKNILEVDNLWWFKNLTKLQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLVNIEDLTLFNNRIKKMENLEHLKQLQ 519
             ++ K E L    K++ +      I +++NL    NLT L+L +N ++KI  +  L++L+ L L  N I  IE +D+LVN+E L+L  NRI K+ENLE L  L+
Sbjct:  115 NRLTKIENLDKLVKLEKVYFVSNRITQIENLDMLTNLTMLELGDNKLKKIENIEMLVNLRQLFLGKNKIAKIENLDTLVNLEILSLQANRIVKIENLEKLANLR 218          

HSP 2 Score: 56.225 bits (134), Expect = 3.123e-8
Identity = 35/95 (36.84%), Postives = 57/95 (60.00%), Query Frame = 1
Query:  238 SFEKVQSLRLSYKNILEVDNLWWFKNLTKLQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLVNIEDLTLFNNRIKKMENLEHLKQLQV 522
               +++ L L +  I +++NL   K L +L+L +N I KI  L+ L  L+ LD+SFN +  IE +D LV +E +   +NRI ++ENL+ L  L +
Sbjct:   59 PLTRIERLFLRWNLIKKIENLSSLKTLIELELYDNQITKIENLDDLPHLEVLDISFNRLTKIENLDKLVKLEKVYFVSNRITQIENLDMLTNLTM 153          

HSP 3 Score: 48.9062 bits (115), Expect = 6.276e-6
Identity = 36/105 (34.29%), Postives = 59/105 (56.19%), Query Frame = 1
Query:  211 GQIAKAEGLS-FEKVQSLRLSYKNILEVDNLWWFKNLTKLQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLVNIEDLTLFNNRIKKMENLEHLKQLQV 522
             QI K E L     ++ L +S+  + +++NL     L K+   +N I +I  L+ L +L  L+L  N ++ IE I+ LVN+  L L  N+I K+ENL+ L  L++
Sbjct:   93 NQITKIENLDDLPHLEVLDISFNRLTKIENLDKLVKLEKVYFVSNRITQIENLDMLTNLTMLELGDNKLKKIENIEMLVNLRQLFLGKNKIAKIENLDTLVNLEI 197          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Fly
Match: CG10839 (gene:FBgn0028858 transcript:FBtr0343725)

HSP 1 Score: 55.4546 bits (132), Expect = 1.455e-8
Identity = 56/188 (29.79%), Postives = 95/188 (50.53%), Query Frame = 1
Query:  142 EPSVITEEMLRTTVYEQGPKGTAGQIAKAEGLSFEKVQSLRLSYKNILEVDNLWWFKNLT---KLQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLVN-IEDLTLFNNRIKKMENLEHLKQLQVXXXXXXXXXXXXXXKYLRTFKSLKAINLSGNPCCE---KDEFRVVVLAYLPQLIYLD 684
            +P+ + + + +     + P  TA +I    GL F+        Y  I ++D +    +LT   KL L +N+IEKI+G++ + +LK L L+ NN++ + GI+ L + +E+L +  N I+K + LE +K L+V  I  N+I D      +    +L  I   GNP  E   +  F    +  LP +  LD
Sbjct:    3 KPTTLKDALAKWEDRNKQPAATATEI----GLQFQ--------YPPIEKMDPI--LNSLTECQKLSLSSNMIEKITGISGMKNLKVLSLARNNLKTLNGIEPLADTLEELWVSYNNIEKTKPLESMKALRVFYISFNMIKDWTEFMRMGVPPNLSEITFVGNPLNENMDQSAFTAEAVRRLPNMKKLD 176          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Fly
Match: CG10839 (gene:FBgn0028858 transcript:FBtr0305563)

HSP 1 Score: 55.4546 bits (132), Expect = 1.455e-8
Identity = 56/188 (29.79%), Postives = 95/188 (50.53%), Query Frame = 1
Query:  142 EPSVITEEMLRTTVYEQGPKGTAGQIAKAEGLSFEKVQSLRLSYKNILEVDNLWWFKNLT---KLQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLVN-IEDLTLFNNRIKKMENLEHLKQLQVXXXXXXXXXXXXXXKYLRTFKSLKAINLSGNPCCE---KDEFRVVVLAYLPQLIYLD 684
            +P+ + + + +     + P  TA +I    GL F+        Y  I ++D +    +LT   KL L +N+IEKI+G++ + +LK L L+ NN++ + GI+ L + +E+L +  N I+K + LE +K L+V  I  N+I D      +    +L  I   GNP  E   +  F    +  LP +  LD
Sbjct:    3 KPTTLKDALAKWEDRNKQPAATATEI----GLQFQ--------YPPIEKMDPI--LNSLTECQKLSLSSNMIEKITGISGMKNLKVLSLARNNLKTLNGIEPLADTLEELWVSYNNIEKTKPLESMKALRVFYISFNMIKDWTEFMRMGVPPNLSEITFVGNPLNENMDQSAFTAEAVRRLPNMKKLD 176          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Zebrafish
Match: drc3 (dynein regulatory complex subunit 3 [Source:ZFIN;Acc:ZDB-GENE-061103-349])

HSP 1 Score: 355.14 bits (910), Expect = 3.569e-116
Identity = 210/514 (40.86%), Postives = 326/514 (63.42%), Query Frame = 1
Query:  142 EPSVITEEMLRTTVYEQGPKGTAGQIAKAEGLSFEKVQSLRLSYKNILEVDNLWWFKNLTKLQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLVNIEDLTLFNNRIKKMENLEHLKQLQVXXXXXXXXXXXXXXKYLRTFKSLKAINLSGNPCCEKDEFRVVVLAYLPQLIYLDYKLINEEERKICCEKEQIRIESLQSDXXXXXXXXXXXXXXMNQEELYNLAFVDGLDKDQLFESLFSDDMEGQRLKELPKNAEHAEEFRKKFSESCYGLFECGLQEHERRQEEVSAFYECLNDAKYSNKKSGMELINEFILYKR-------DVMNALGNDTNPNXXXXXXXXXXXXALQYNLMALELHLVDQIEELVGEFDRNLLDIVLKFKENVESYFGKCRELDVIYQSKVSEEALAIQEKINKGDPTDDISEDLRMILIDKDSMTNALSASKDAHMLKIDSKSDSISNRVQDWFKNLFDTIKTKEEIERNRSRVLEINLLIDNFNLELENL 1662
            EP VI E+ML+  V EQ  + T       EG+  E+V  LRL Y+NIL++ +LW F +LTKLQLDNN IE+I GL +L +L WLDLSFN IE+IEG+ +LV ++DL+LFNNRI  +ENL+ L++LQVLS+GNN I  L N+ YLR F+SL+ +NL+GNP CE+D ++  V AYLP+L+YLDY+L++E+ R+    K Q  IE ++ +E +++  ME +K+   + +L+  AFV+ L+  QLF S+F+DD + ++L  LP      EEFR +    C  +FE GL ++ RR  EV +F+ C  +A   NK+   ++  +F  ++R        + +A+  +T+ +   ++            LM+LEL LVDQ+E++  EF+RN+ +++  F E V+  F +CR+L+  +  +  E  L   EK+ K +  ++I +DL M+L+DKD++ NA +AS D H++KID++ D +      W K+L   I+ +EE++RNR R+ EI   I     ELE++
Sbjct:    7 EPGVIDEQMLQRAVEEQQTRYT-------EGIQLEEVLELRLDYRNILKIYHLWSFSSLTKLQLDNNAIERIEGLENLTNLTWLDLSFNKIEVIEGLQTLVKLQDLSLFNNRISVIENLDTLQRLQVLSLGNNSIAQLENVIYLRRFQSLRTLNLAGNPICEEDRYKTFVSAYLPELVYLDYRLLDEQTRETANAKYQYAIEEMRQNEMQEQQAMEAQKISNEELQLHKDAFVENLNGAQLFHSMFADDPDAEKLALLPGVDALLEEFRSRMEAVCMQMFEAGLSQYSRRSAEVESFFSCSREAVAENKQKAAQIAADFESFRRLKTAEMHQIQDAVQLETHLSVCRQQLTHTSE-----QLMSLELQLVDQLEDVYKEFERNISEMLGGFVEFVQGMFAQCRDLENQHHEQQLEIGLETLEKVLKNELEEEIPDDLAMLLVDKDTLINAANASHDTHLMKIDNREDVLRTHTDSWIKHLKTEIQ-EEEMKRNRKRISEIQNYIRFVKEELEDM 507          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Zebrafish
Match: ppp1r7 (protein phosphatase 1, regulatory (inhibitor) subunit 7 [Source:NCBI gene;Acc:560323])

HSP 1 Score: 68.5514 bits (166), Expect = 4.851e-12
Identity = 47/139 (33.81%), Postives = 81/139 (58.27%), Query Frame = 1
Query:  280 ILEVDNLWWFKNLTKLQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLVNIEDLTLFNNRIKKMENLEHLKQLQVXXXXXXXXXXXXXXKYLRTFKSLKAINLSGNPCCEKDEFRVVVLAYLPQLIYLDYKLI 696
            I ++ NL    NLT L + +N I K+ GL +L++L+ L LS N IE++EG+++   +  L +  NRIKK+EN+ HL  L+   + +N I++  +L  L+  K L+ + L  NP  +  ++R  ++  LP +  +D   I
Sbjct:  205 ITQLQNLDGLHNLTVLSIQSNRITKLEGLQNLVNLRELYLSHNGIEVMEGLENNKKLSTLDIAANRIKKIENISHLTDLKEFWMNDNQIENWADLDELKNAKGLETVYLERNPLQKDPQYRRKIMLALPSVRQIDATFI 343          

HSP 2 Score: 60.8474 bits (146), Expect = 1.541e-9
Identity = 40/104 (38.46%), Postives = 61/104 (58.65%), Query Frame = 1
Query:  214 QIAKAEGLS-FEKVQSLRLSYKNILEVDNLWWFKNLTKLQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLVNIEDLTLFNNRIKKMENLEHLKQLQV 522
            +I K EGL    K +++ L    I  ++NL    +L +L L +N I K+  L  L  L+ LD+SFN +  IEG+DSL  ++ L L +N+I  + NL+HL  LQ+
Sbjct:   72 RIGKIEGLEVLLKAKTISLRQNLIKRIENLESLVSLRELDLYDNQIRKLENLQALTELEQLDVSFNLLRKIEGLDSLTKVKKLFLLHNKIASIANLDHLTSLQM 175          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Zebrafish
Match: lrrc6 (leucine rich repeat containing 6 [Source:NCBI gene;Acc:432388])

HSP 1 Score: 68.9366 bits (167), Expect = 5.068e-12
Identity = 52/173 (30.06%), Postives = 88/173 (50.87%), Query Frame = 1
Query:  250 VQSLRLSYKNILEVDNLW-WFKNLTKLQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLVNIEDLTLFNNRIKKMENLEHLKQLQVXXXXXXXXXXXXXXKYLRTFKSLKAINLSGNPCCEKDEFRVVVLAYLPQLIYLDYKLINEEER-KICCEKEQIRIESLQSD 762
            ++ L L  ++I  ++++  W ++L  L L NN+I KI  +  L  L++L+L+ NNIE+IE ++   +++ L L  N + ++ ++E LK                          LK + L GNPC E   +R  V+A +PQL  LD K I+  ER +   E + +R   LQ +
Sbjct:   23 LEELSLHQQDIQRIEHIHKWCRDLKILYLQNNLIPKIENVGRLKKLEYLNLALNNIEVIENLEGCESLQKLDLTVNFVGRLSSVETLKH----------------------NLHLKELYLVGNPCAEYHGYRQYVVATVPQLQSLDGKEISRAERIQALQELDAVRTRVLQQE 173          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Zebrafish
Match: lrrc6 (leucine rich repeat containing 6 [Source:NCBI gene;Acc:432388])

HSP 1 Score: 68.9366 bits (167), Expect = 5.068e-12
Identity = 52/173 (30.06%), Postives = 88/173 (50.87%), Query Frame = 1
Query:  250 VQSLRLSYKNILEVDNLW-WFKNLTKLQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLVNIEDLTLFNNRIKKMENLEHLKQLQVXXXXXXXXXXXXXXKYLRTFKSLKAINLSGNPCCEKDEFRVVVLAYLPQLIYLDYKLINEEER-KICCEKEQIRIESLQSD 762
            ++ L L  ++I  ++++  W ++L  L L NN+I KI  +  L  L++L+L+ NNIE+IE ++   +++ L L  N + ++ ++E LK                          LK + L GNPC E   +R  V+A +PQL  LD K I+  ER +   E + +R   LQ +
Sbjct:   23 LEELSLHQQDIQRIEHIHKWCRDLKILYLQNNLIPKIENVGRLKKLEYLNLALNNIEVIENLEGCESLQKLDLTVNFVGRLSSVETLKH----------------------NLHLKELYLVGNPCAEYHGYRQYVVATVPQLQSLDGKEISRAERIQALQELDAVRTRVLQQE 173          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Zebrafish
Match: lrrc6 (leucine rich repeat containing 6 [Source:NCBI gene;Acc:432388])

HSP 1 Score: 68.9366 bits (167), Expect = 5.068e-12
Identity = 52/173 (30.06%), Postives = 88/173 (50.87%), Query Frame = 1
Query:  250 VQSLRLSYKNILEVDNLW-WFKNLTKLQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLVNIEDLTLFNNRIKKMENLEHLKQLQVXXXXXXXXXXXXXXKYLRTFKSLKAINLSGNPCCEKDEFRVVVLAYLPQLIYLDYKLINEEER-KICCEKEQIRIESLQSD 762
            ++ L L  ++I  ++++  W ++L  L L NN+I KI  +  L  L++L+L+ NNIE+IE ++   +++ L L  N + ++ ++E LK                          LK + L GNPC E   +R  V+A +PQL  LD K I+  ER +   E + +R   LQ +
Sbjct:   23 LEELSLHQQDIQRIEHIHKWCRDLKILYLQNNLIPKIENVGRLKKLEYLNLALNNIEVIENLEGCESLQKLDLTVNFVGRLSSVETLKH----------------------NLHLKELYLVGNPCAEYHGYRQYVVATVPQLQSLDGKEISRAERIQALQELDAVRTRVLQQE 173          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Xenopus
Match: drc3 (dynein regulatory complex subunit 3 [Source:NCBI gene;Acc:100170587])

HSP 1 Score: 404.445 bits (1038), Expect = 4.146e-135
Identity = 233/521 (44.72%), Postives = 355/521 (68.14%), Query Frame = 1
Query:  118 MSRLYDTIEPSVITEEMLRTTVYEQGPKGTAGQIAKAEGLSFEKVQSLRLSYKNILEVDNLWWFKNLTKLQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLVNIEDLTLFNNRIKKMENLEHLKQLQVXXXXXXXXXXXXXXKYLRTFKSLKAINLSGNPCCEKDEFRVVVLAYLPQLIYLDYKLINEEERKICCEKEQIRIESLQSDXXXXXXXXXXXXXXMNQEELYNLAFVDGLDKDQLFESLFSDDMEGQRLKELPKNAEHAEEFR-KKFSESCYGLFECGLQEHERRQEEVSAFYECLNDAKYSNKKSGMELINEFILYKRDVMNALGNDTNPN--XXXXXXXXXXXXALQYNLMALELHLVDQIEELVGEFDRNLLDIVLKFKENVESYF--GKCRELDVIYQSKVSEEALAIQEKINKGDPTDDISEDLRMILIDKDSMTNALSASKDAHMLKIDSKSDSISNRVQDWFKNLFDTIKTKEEIERNRSRVLEINLLIDNFNLELENLD 1665
            MS LYDT+EP+VI ++MLR  V EQGPK  AG+IAK EG+ F+ V SLRL +KNIL++DNLW F +LTKLQLDNNIIEKISGL+ L+ L WLDLSFNNIE+IEG+ +L  +EDL+L+NNRI  +EN++ L  LQVLS+GNN +  L NL YLR FK L+ ++L+GNP  E D++++ + A+LP L YLD++L+NE  R++   K Q  I+ +  +E +++ + EEE+ K  + +L+  A+V+ L+   LFES+++DD +G +L  LP  AE  + +   +  E C  +FE G+++HE+R+ E   F EC+ +A   N++ G + I E      +++N L   +N +  +    +Y + +  L  +LM LEL LVDQ EE++ E++RN+ D+V  F E V+  +  G  R+L+  +  K+ E ++ + EK+ KG+  D+I++D+RMI +DKD++ NA+SAS D H+LKID++ D +  ++  W  NL   ++ K+EI+RNR+R+LEI   ID+   EL+NL+
Sbjct:    1 MSSLYDTMEPNVIDDDMLRNAVEEQGPKEEAGRIAKLEGIDFKHVSSLRLDFKNILKIDNLWQFHSLTKLQLDNNIIEKISGLDTLVHLVWLDLSFNNIEVIEGLKALTKLEDLSLYNNRISVVENMDTLSNLQVLSLGNNNLTSLENLIYLRKFKQLRTLSLAGNPLSEDDQYKLFIAAHLPNLAYLDFRLLNENIREMATMKYQYSIDDITHNENQEKRKQEEEEQKQRELDLHKAAYVENLNGPFLFESMYADDADGTKLSGLPGVAELMDSYPLLRCIEICQNIFEYGMKQHEKREAEAFEFNECMQEAIRENQEQGAKKIQELTEKNSEILNELSQSSNQDFLDLKISQYIDDINKLLDSLMTLELQLVDQTEEIIKEYERNVSDMVSAFLETVQGLYPWGSVRDLENHHHEKLLEISINLLEKVLKGEMDDEITDDIRMIFVDKDTVINAVSASHDIHLLKIDNREDELVTKMNTWANNLIQKVQ-KDEIQRNRNRILEITTYIDHLRDELDNLE 520          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Xenopus
Match: drc3 (dynein regulatory complex subunit 3 [Source:NCBI gene;Acc:100170587])

HSP 1 Score: 380.948 bits (977), Expect = 5.752e-126
Identity = 227/520 (43.65%), Postives = 345/520 (66.35%), Query Frame = 1
Query:  118 MSRLYDTIEPSVITEEMLRTTVYEQGPKGTAGQIAKAEGLSFEKVQSLRLSYKNILEVDNLWWFKNLTKLQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLVNIEDLTLFNNRIKKMENLEHLKQLQVXXXXXXXXXXXXXXKYLRTFKSLKAINLSGNPCCEKDEFRVVVLAYLPQLIYLDYKLINEEERKICCEKEQIRIESLQSDXXXXXXXXXXXXXXMNQEELYNLAFVDGLDKDQLFESLFSDDMEGQRLKELPKNAEHAEEFR-KKFSESCYGLFECGLQEHERRQEEVSAFYECLNDAKYSNKKSGMELINEFILYKRDVMNALGNDTNPN--XXXXXXXXXXXXALQYNLMALELHLVDQIEELVGEFDRNLLDIVLKFKENVESY-FGKCRELDVIYQSKVSEEALAIQEKINKGDPTDDISEDLRMILIDKDSMTNALSASKDAHMLKIDSKSDSISNRVQDWFKNLFDTIKTKEEIERNRSRVLEINLLIDNFNLELENLD 1665
            MS LYDT+EP+VI ++MLR  V EQGPK  AG+IAK EG+ F+ V SLRL +KNIL++DNLW F +LTKLQLDNNIIEKISGL+ L+ L WLDLSFNNIE+IEG+ +L  +EDL+L+NNRI  +EN++ L  LQVLS+GNN +  L NL YLR FK L+ ++L+GNP  E D++++ + A+LP L YLD++L+NE  R++   K Q  I+ +  +E +++ + EEE+ K  + +L+  A+V+ L+   LFES+++DD +G +L  LP  AE  + +   +  E C  +FE G+++HE+R+ E   F EC+ +A   N++ G + I E      +++N L   +N +  +    +Y + +  L  +LM LEL LVDQ E  V     + L  +L  +     Y   + R+L+  +  K+ E ++ + EK+ KG+  D+I++D+RMI +DKD++ NA+SAS D H+LKID++ D +  ++  W  NL   ++ K+EI+RNR+R+LEI   ID+   EL+NL+
Sbjct:    1 MSSLYDTMEPNVIDDDMLRNAVEEQGPKEEAGRIAKLEGIDFKHVSSLRLDFKNILKIDNLWQFHSLTKLQLDNNIIEKISGLDTLVHLVWLDLSFNNIEVIEGLKALTKLEDLSLYNNRISVVENMDTLSNLQVLSLGNNNLTSLENLIYLRKFKQLRTLSLAGNPLSEDDQYKLFIAAHLPNLAYLDFRLLNENIREMATMKYQYSIDDITHNENQEKRKQEEEEQKQRELDLHKAAYVENLNGPFLFESMYADDADGTKLSGLPGVAELMDSYPLLRCIEICQNIFEYGMKQHEKREAEAFEFNECMQEAIRENQEQGAKKIQELTEKNSEILNELSQSSNQDFLDLKISQYIDDINKLLDSLMTLELQLVDQTE--VHRHSSSPLTGLLSHESLTSMYTMAQVRDLENHHHEKLLEISINLLEKVLKGEMDDEITDDIRMIFVDKDTVINAVSASHDIHLLKIDNREDELVTKMNTWANNLIQKVQ-KDEIQRNRNRILEITTYIDHLRDELDNLE 517          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Xenopus
Match: rbpms2 (RNA binding protein with multiple splicing 2 [Source:Xenbase;Acc:XB-GENE-490341])

HSP 1 Score: 74.3294 bits (181), Expect = 3.101e-13
Identity = 58/169 (34.32%), Postives = 93/169 (55.03%), Query Frame = 1
Query:  217 IAKAEGLS-FEKVQSLRLSYKNILEVDNLWWFKNLTKLQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLVNIEDLTLFNNRIKKMENLEHLKQLQVXXXXXXXXXXXXXXKYLRTFKSLKAINLSGNPCCEKDEFRVVVLAYLPQLIYLDYKLINEEERKIC 720
            I +  GLS    ++ L L    I ++ NL   KNL  L L  N I KI  ++HL  L+ L+L+ N I  +E I+ L ++++L L +N+I  + +++ L  LQ+L +  N I  +N++  L    SL  + L GNP  ++  +R  +L ++ QL  LD K I EEER+  
Sbjct:  222 IEEISGLSSLRSLRVLMLGKNRIQKISNLENLKNLDVLDLHGNQIAKIENVSHLRELRVLNLARNQINQVENINGLDSLKELNLRDNKITFLRDVDTLPSLQLLYLSFNNISRINDILCLADSTSLSDVTLDGNPIAQESWYRQTILGHMLQLRQLDMKRITEEERRTA 390          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Xenopus
Match: rbpms2 (RNA binding protein with multiple splicing 2 [Source:Xenbase;Acc:XB-GENE-490341])

HSP 1 Score: 73.1738 bits (178), Expect = 5.088e-13
Identity = 58/169 (34.32%), Postives = 93/169 (55.03%), Query Frame = 1
Query:  217 IAKAEGLS-FEKVQSLRLSYKNILEVDNLWWFKNLTKLQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLVNIEDLTLFNNRIKKMENLEHLKQLQVXXXXXXXXXXXXXXKYLRTFKSLKAINLSGNPCCEKDEFRVVVLAYLPQLIYLDYKLINEEERKIC 720
            I +  GLS    ++ L L    I ++ NL   KNL  L L  N I KI  ++HL  L+ L+L+ N I  +E I+ L ++++L L +N+I  + +++ L  LQ+L +  N I  +N++  L    SL  + L GNP  ++  +R  +L ++ QL  LD K I EEER+  
Sbjct:   79 IEEISGLSSLRSLRVLMLGKNRIQKISNLENLKNLDVLDLHGNQIAKIENVSHLRELRVLNLARNQINQVENINGLDSLKELNLRDNKITFLRDVDTLPSLQLLYLSFNNISRINDILCLADSTSLSDVTLDGNPIAQESWYRQTILGHMLQLRQLDMKRITEEERRTA 247          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Xenopus
Match: rbpms2 (RNA binding protein with multiple splicing 2 [Source:Xenbase;Acc:XB-GENE-490341])

HSP 1 Score: 73.1738 bits (178), Expect = 6.613e-13
Identity = 58/169 (34.32%), Postives = 93/169 (55.03%), Query Frame = 1
Query:  217 IAKAEGLS-FEKVQSLRLSYKNILEVDNLWWFKNLTKLQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLVNIEDLTLFNNRIKKMENLEHLKQLQVXXXXXXXXXXXXXXKYLRTFKSLKAINLSGNPCCEKDEFRVVVLAYLPQLIYLDYKLINEEERKIC 720
            I +  GLS    ++ L L    I ++ NL   KNL  L L  N I KI  ++HL  L+ L+L+ N I  +E I+ L ++++L L +N+I  + +++ L  LQ+L +  N I  +N++  L    SL  + L GNP  ++  +R  +L ++ QL  LD K I EEER+  
Sbjct:  146 IEEISGLSSLRSLRVLMLGKNRIQKISNLENLKNLDVLDLHGNQIAKIENVSHLRELRVLNLARNQINQVENINGLDSLKELNLRDNKITFLRDVDTLPSLQLLYLSFNNISRINDILCLADSTSLSDVTLDGNPIAQESWYRQTILGHMLQLRQLDMKRITEEERRTA 314          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Mouse
Match: Drc3 (dynein regulatory complex subunit 3 [Source:MGI Symbol;Acc:MGI:1921915])

HSP 1 Score: 383.645 bits (984), Expect = 3.753e-127
Identity = 226/518 (43.63%), Postives = 347/518 (66.99%), Query Frame = 1
Query:  118 MSRLYDTIEPSVITEEMLRTTVYEQGPKGTAGQIAKAEGLSFEKVQSLRLSYKNILEVDNLWWFKNLTKLQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLVNIEDLTLFNNRIKKMENLEHLKQLQVXXXXXXXXXXXXXXKYLRTFKSLKAINLSGNPCCEKDEFRVVVLAYLPQLIYLDYKLINEEERKICCEKEQIRIESLQSDXXXXXXXXXXXXXXMNQEELYNLAFVDGLDKDQLFESLFSDDMEGQRLKELPKNAEHAEEFRKKFSESCYGLFECGLQEHERRQEEVSAFYECLNDAKYSNKKSGMELINEFILYKRDVMNALGNDTN-PNXXXXXXXXXXXXALQYN-LMALELHLVDQIEELVGEFDRNLLDIVLKFKENVESYFGKCRELDVIYQSKVSEEALAIQEKINKGDPTDDISEDLRMILIDKDSMTNALSASKDAHMLKIDSKSDSISNRVQDWFKNLFDTIKTKEEIERNRSRVLEINLLIDNFNLELENLD 1665
            MSR YD++EP V+ ++ML+  V EQGP+  AGQ+AK EG+ F+ V SL+L ++NIL +DNLW F+NL KLQL+NNIIE+I GL +LI L WLDLSFNNIE IEG+D+LVN+EDL+L NNRI K+++L+ L +LQVLS+GNN I ++ N+ YLR F  L+ ++L+GNP  E +E+++ + AYL  L+YLD++ ++E+ R++   K Q  I+ L+  E + ++++EEE+ K  + E + +AFV+ L+   LF+S++S+D+EG +L  LP   E  E ++ KF   C  +FE GL + E+R+ E+  F EC+ +A   N+  G   + +F       +NA+  +T+  N + K     +     +N LM LE+ LV+Q+EE +  F+RN+ D+V  F ENV+S   +CR+L+  +  K+ E A+   EKI KG+  +D+ +D+R + +DKD++ NA+ AS D H+LKID++ D +   +  W  +L D I  K+EI RNR RV EIN  +D+   EL+NL+
Sbjct:    1 MSRPYDSMEPKVMDDDMLKAAVGEQGPQEEAGQLAKQEGILFKDVLSLQLDFQNILRIDNLWQFENLKKLQLNNNIIERIEGLTNLIHLVWLDLSFNNIEAIEGLDTLVNLEDLSLSNNRISKVDSLDALVKLQVLSLGNNQISNMMNIIYLRRFPCLRTLSLAGNPVSEAEEYKMFIYAYLSDLVYLDFRRVDEQMREMAKMKHQYSIDELKHREAQLQMKLEEEQAKQEKLEEHKMAFVEHLNGPFLFDSMYSEDVEGNKLSYLPGVRELLEAYKDKFVIICLNIFEYGLNQQEKRKVELDTFNECIQEAILENQDQGKLKVAKFEEKHLLNLNAIREETDLSNIEKKLTECTESIGELFNTLMILEMQLVEQLEETINIFERNITDLVGLFIENVQSLIAQCRDLENHHHEKLLEIAINTLEKILKGEMDEDLPDDVRALFVDKDTIVNAVGASHDIHLLKIDNREDELVTGINSWCAHLVDKIH-KDEIMRNRKRVKEINQFVDHMQSELDNLE 517          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Mouse
Match: Drc3 (dynein regulatory complex subunit 3 [Source:MGI Symbol;Acc:MGI:1921915])

HSP 1 Score: 383.645 bits (984), Expect = 4.226e-127
Identity = 226/518 (43.63%), Postives = 347/518 (66.99%), Query Frame = 1
Query:  118 MSRLYDTIEPSVITEEMLRTTVYEQGPKGTAGQIAKAEGLSFEKVQSLRLSYKNILEVDNLWWFKNLTKLQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLVNIEDLTLFNNRIKKMENLEHLKQLQVXXXXXXXXXXXXXXKYLRTFKSLKAINLSGNPCCEKDEFRVVVLAYLPQLIYLDYKLINEEERKICCEKEQIRIESLQSDXXXXXXXXXXXXXXMNQEELYNLAFVDGLDKDQLFESLFSDDMEGQRLKELPKNAEHAEEFRKKFSESCYGLFECGLQEHERRQEEVSAFYECLNDAKYSNKKSGMELINEFILYKRDVMNALGNDTN-PNXXXXXXXXXXXXALQYN-LMALELHLVDQIEELVGEFDRNLLDIVLKFKENVESYFGKCRELDVIYQSKVSEEALAIQEKINKGDPTDDISEDLRMILIDKDSMTNALSASKDAHMLKIDSKSDSISNRVQDWFKNLFDTIKTKEEIERNRSRVLEINLLIDNFNLELENLD 1665
            MSR YD++EP V+ ++ML+  V EQGP+  AGQ+AK EG+ F+ V SL+L ++NIL +DNLW F+NL KLQL+NNIIE+I GL +LI L WLDLSFNNIE IEG+D+LVN+EDL+L NNRI K+++L+ L +LQVLS+GNN I ++ N+ YLR F  L+ ++L+GNP  E +E+++ + AYL  L+YLD++ ++E+ R++   K Q  I+ L+  E + ++++EEE+ K  + E + +AFV+ L+   LF+S++S+D+EG +L  LP   E  E ++ KF   C  +FE GL + E+R+ E+  F EC+ +A   N+  G   + +F       +NA+  +T+  N + K     +     +N LM LE+ LV+Q+EE +  F+RN+ D+V  F ENV+S   +CR+L+  +  K+ E A+   EKI KG+  +D+ +D+R + +DKD++ NA+ AS D H+LKID++ D +   +  W  +L D I  K+EI RNR RV EIN  +D+   EL+NL+
Sbjct:    1 MSRPYDSMEPKVMDDDMLKAAVGEQGPQEEAGQLAKQEGILFKDVLSLQLDFQNILRIDNLWQFENLKKLQLNNNIIERIEGLTNLIHLVWLDLSFNNIEAIEGLDTLVNLEDLSLSNNRISKVDSLDALVKLQVLSLGNNQISNMMNIIYLRRFPCLRTLSLAGNPVSEAEEYKMFIYAYLSDLVYLDFRRVDEQMREMAKMKHQYSIDELKHREAQLQMKLEEEQAKQEKLEEHKMAFVEHLNGPFLFDSMYSEDVEGNKLSYLPGVRELLETYKDKFVIICLNIFEYGLNQQEKRKVELDTFNECIQEAILENQDQGKLKVAKFEEKHLLNLNAIREETDLSNIEKKLTECTESIGELFNTLMILEMQLVEQLEETINIFERNITDLVGLFIENVQSLIAQCRDLENHHHEKLLEIAINTLEKILKGEMDEDLPDDVRALFVDKDTIVNAVGASHDIHLLKIDNREDELVTGINSWCAHLVDKIH-KDEIMRNRKRVKEINQFVDHMQSELDNLE 517          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Mouse
Match: Drc3 (dynein regulatory complex subunit 3 [Source:MGI Symbol;Acc:MGI:1921915])

HSP 1 Score: 241.891 bits (616), Expect = 1.598e-75
Identity = 136/276 (49.28%), Postives = 204/276 (73.91%), Query Frame = 1
Query:  118 MSRLYDTIEPSVITEEMLRTTVYEQGPKGTAGQIAKAEGLSFEKVQSLRLSYKNILEVDNLWWFKNLTKLQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLVNIEDLTLFNNRIKKMENLEHLKQLQVXXXXXXXXXXXXXXKYLRTFKSLKAINLSGNPCCEKDEFRVVVLAYLPQLIYLDYKLINEEERKICCEKEQIRIESLQSDXXXXXXXXXXXXXXMNQEELYNLAFVDGLDKDQLFESLFSDDMEGQRLKELPKNAEHAEEF 945
            MSR YD++EP V+ ++ML+  V EQGP+  AGQ+AK EG+ F+ V SL+L ++NIL +DNLW F+NL KLQL+NNIIE+I GL +LI L WLDLSFNNIE IEG+D+LVN+EDL+L NNRI K+++L+ L +LQVLS+GNN I ++ N+ YLR F  L+ ++L+GNP  E +E+++ + AYL  L+YLD++ ++E+ R++   K Q  I+ L+  E + ++++EEE+ K  + E + +AFV+ L+   LF+S++S+D+EG +L  LP   E  E +
Sbjct:    1 MSRPYDSMEPKVMDDDMLKAAVGEQGPQEEAGQLAKQEGILFKDVLSLQLDFQNILRIDNLWQFENLKKLQLNNNIIERIEGLTNLIHLVWLDLSFNNIEAIEGLDTLVNLEDLSLSNNRISKVDSLDALVKLQVLSLGNNQISNMMNIIYLRRFPCLRTLSLAGNPVSEAEEYKMFIYAYLSDLVYLDFRRVDEQMREMAKMKHQYSIDELKHREAQLQMKLEEEQAKQEKLEEHKMAFVEHLNGPFLFDSMYSEDVEGNKLSYLPGVRELLEAY 276          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Mouse
Match: Drc3 (dynein regulatory complex subunit 3 [Source:MGI Symbol;Acc:MGI:1921915])

HSP 1 Score: 213.772 bits (543), Expect = 9.495e-66
Identity = 110/208 (52.88%), Postives = 158/208 (75.96%), Query Frame = 1
Query:  118 MSRLYDTIEPSVITEEMLRTTVYEQGPKGTAGQIAKAEGLSFEKVQSLRLSYKNILEVDNLWWFKNLTKLQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLVNIEDLTLFNNRIKKMENLEHLKQLQVXXXXXXXXXXXXXXKYLRTFKSLKAINLSGNPCCEKDEFRVVVLAYLPQLIYLDYKLINEEERKICCEKEQIR 741
            MSR YD++EP V+ ++ML+  V EQGP+  AGQ+AK EG+ F+ V SL+L ++NIL +DNLW F+NL KLQL+NNIIE+I GL +LI L WLDLSFNNIE IEG+D+LVN+EDL+L NNRI K+++L+ L +LQVLS+GNN I ++ N+ YLR F  L+ ++L+GNP  E +E+++ + AYL  L+YLD++ ++E+       ++  R
Sbjct:    1 MSRPYDSMEPKVMDDDMLKAAVGEQGPQEEAGQLAKQEGILFKDVLSLQLDFQNILRIDNLWQFENLKKLQLNNNIIERIEGLTNLIHLVWLDLSFNNIEAIEGLDTLVNLEDLSLSNNRISKVDSLDALVKLQVLSLGNNQISNMMNIIYLRRFPCLRTLSLAGNPVSEAEEYKMFIYAYLSDLVYLDFRRVDEQMASAASTQQPTR 208          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Mouse
Match: Ppp1r7 (protein phosphatase 1, regulatory subunit 7 [Source:MGI Symbol;Acc:MGI:1913635])

HSP 1 Score: 72.4034 bits (176), Expect = 3.163e-13
Identity = 52/149 (34.90%), Postives = 89/149 (59.73%), Query Frame = 1
Query:  238 SFEKVQSLRLSYKNILEVDNLWWFKNLTKLQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLVNIEDLTLFNNRIKKMENLEHLKQLQVXXXXXXXXXXXXXXKYLRTFKSLKAINLSGNPCCEKDEFRVVVLAYLPQLIYLD 684
            +   ++SL L    I ++ NL    NLT L + +N + KI GL  L++L+ L LS N IE+IEG+++   +  L + +NRIKK+EN+ HL +LQ   + +NL++  ++L  L+  +SL+ + L  NP  +  ++R  V+  LP +  +D
Sbjct:  207 TLTNLESLFLGKNKITKLQNLDALTNLTVLSVQSNRLAKIEGLQSLVNLRELYLSNNGIEVIEGLENNNKLTMLDIASNRIKKIENISHLTELQEFWMNDNLLESWSDLDELKGARSLETVYLERNPLQKDPQYRRKVMLALPSVRQID 355          

HSP 2 Score: 67.0106 bits (162), Expect = 1.540e-11
Identity = 47/107 (43.93%), Postives = 67/107 (62.62%), Query Frame = 1
Query:  205 TAGQIAKAEGLS-FEKVQSLRLSYKNILEVDNLWWFKNLTKLQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLVNIEDLTLFNNRIKKMENLEHLKQLQV 522
            T  +I K EGL   +KV+SL L    I  ++NL   ++L +L L +N I+KI  L  L  L+ LD+SFN +  IEGID L  ++ L L NN+I K+EN+ +L QLQ+
Sbjct:   85 THYRIGKIEGLEVLKKVKSLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEVLDISFNMLRNIEGIDKLTQLKKLFLVNNKINKIENISNLHQLQM 191          

HSP 3 Score: 55.8398 bits (133), Expect = 6.968e-8
Identity = 39/104 (37.50%), Postives = 60/104 (57.69%), Query Frame = 1
Query:  214 QIAKAEGL-SFEKVQSLRLSYKNILEVDNLWWFKNLTKLQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLVNIEDLTLFNNRIKKMENLEHLKQLQV 522
            QI K E L +  +++ L +S+  +  ++ +     L KL L NN I KI  +++L  L+ L+L  N I  IE ID+L N+E L L  N+I K++NL+ L  L V
Sbjct:  132 QIKKIENLEALTELEVLDISFNMLRNIEGIDKLTQLKKLFLVNNKINKIENISNLHQLQMLELGSNRIRAIENIDTLTNLESLFLGKNKITKLQNLDALTNLTV 235          
BLAST of Dynein regulatory complex subunit 3 vs. UniProt/SwissProt
Match: sp|Q4R6X9|DRC3_MACFA (Dynein regulatory complex subunit 3 OS=Macaca fascicularis OX=9541 GN=DRC3 PE=2 SV=1)

HSP 1 Score: 387.497 bits (994), Expect = 7.521e-128
Identity = 227/519 (43.74%), Postives = 352/519 (67.82%), Query Frame = 1
Query:  118 MSRLYDTIEPSVITEEMLRTTVYEQGPKGTAGQIAKAEGLSFEKVQSLRLSYKNILEVDNLWWFKNLTKLQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLVNIEDLTLFNNRIKKMENLEHLKQLQVXXXXXXXXXXXXXXKYLRTFKSLKAINLSGNPCCEKDEFRVVVLAYLPQLIYLDYKLINEEERKICCEKEQIRIESLQSDXXXXXXXXXXXXXXMNQEELYNLAFVDGLDKDQLFESLFSDDMEGQRLKELPKNAEHAEEFRKKFSESCYGLFECGLQEHERRQEEVSAFYECLNDAKYSNKKSGMELINEFILYKRDVMNALGNDTN-PNXXXXXXXXXXXXALQYN-LMALELHLVDQIEELVGEFDRNLLDIVLKFKENVESYFGKCRELDVIYQSKVSEEALAIQEKINKGDPTDDISEDLRMILIDKDSMTNALSASKDAHMLKIDSKSDSISNRVQDWFKNLFDTIKTKEEIERNRSRVLEINLLIDNFNLELENLDY 1668
            M+RL D++EP V+ ++ML+  V EQGP+  AGQ+AK EG+ F+ V SL+L ++NIL +DNLW F+NL KLQLDNNIIEKI GL +L  L WLDLSFNNIE IEG+D+LVN+EDL+LFNNRI K+++L+ L +LQVLS+GNN ID++ N+ YLR F+ L+ ++LSGNP  E +++++ + AYLP L+YLD++ I++  +++   K Q  I+ L+  E   ++++++E+ +  + E +  AFV+ L+   LF+S++++D EG +L  LP  +E  E ++ KF   C  +FE GL++ E+R+ E+  F EC+++A   N++ G   I +F       ++A+  ++  PN +          +  +N LM LE+ LV+Q+EE +  F+RN++D+V  F ENV+S   +CR+L+  +  K+ E +++  EKI KGD  +D+ +DLR + +DKD++ NA+ AS D H+LKID++ D +  R+  W   L D I  K+EI RNR RV EIN  ID+   EL+NL+Y
Sbjct:    1 MNRLCDSMEPKVMDDDMLKLAVGEQGPQEEAGQLAKQEGILFKDVLSLQLDFRNILRIDNLWQFENLRKLQLDNNIIEKIGGLENLTHLVWLDLSFNNIETIEGLDTLVNLEDLSLFNNRISKIDSLDALVKLQVLSLGNNQIDNMMNIVYLRRFQCLRTLSLSGNPISEAEDYKMFICAYLPDLVYLDFRRIDDHTKELAEAKHQYSIDELKHRENLMQVRLQDERARQEELEKHKTAFVEHLNGSFLFDSMYAEDSEGNKLSYLPGVSELLEAYKDKFVIICMNIFEYGLKQQEKRKIELDTFSECVHEAIQENQEQGKRKIAQFEEKHLSSLSAIREESELPNIEKMILECSADVSELFNELMMLEMQLVEQLEETINMFERNIVDMVGLFIENVQSLMAQCRDLENHHHEKLLEISISTLEKIVKGDLDEDLPDDLRALFVDKDTIVNAVGASHDIHLLKIDNREDELVTRINSWCTRLVDKIH-KDEIMRNRKRVKEINQYIDHMQSELDNLEY 518          
BLAST of Dynein regulatory complex subunit 3 vs. UniProt/SwissProt
Match: sp|Q5XI54|DRC3_RAT (Dynein regulatory complex subunit 3 OS=Rattus norvegicus OX=10116 GN=Drc3 PE=2 SV=1)

HSP 1 Score: 384.8 bits (987), Expect = 9.617e-127
Identity = 229/518 (44.21%), Postives = 345/518 (66.60%), Query Frame = 1
Query:  118 MSRLYDTIEPSVITEEMLRTTVYEQGPKGTAGQIAKAEGLSFEKVQSLRLSYKNILEVDNLWWFKNLTKLQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLVNIEDLTLFNNRIKKMENLEHLKQLQVXXXXXXXXXXXXXXKYLRTFKSLKAINLSGNPCCEKDEFRVVVLAYLPQLIYLDYKLINEEERKICCEKEQIRIESLQSDXXXXXXXXXXXXXXMNQEELYNLAFVDGLDKDQLFESLFSDDMEGQRLKELPKNAEHAEEFRKKFSESCYGLFECGLQEHERRQEEVSAFYECLNDAKYSNKKSGMELINEFILYKRDVMNALGNDTN--PNXXXXXXXXXXXXALQYNLMALELHLVDQIEELVGEFDRNLLDIVLKFKENVESYFGKCRELDVIYQSKVSEEALAIQEKINKGDPTDDISEDLRMILIDKDSMTNALSASKDAHMLKIDSKSDSISNRVQDWFKNLFDTIKTKEEIERNRSRVLEINLLIDNFNLELENLD 1665
            MSR YD++EP V+ ++ML+  V EQGP+  AGQ+AK EG+ F+ V +L+L ++NIL +DNLW F+NL KLQL+NNIIE+I GL +L  L WLDLSFNNIE IEG+D+LVN+EDL+L +NRI K+++L+ L  LQVLS+GNN I+++ N+ YLR F  L+ ++LSGNP  E +E++V + AYLP L+YLD++ ++E+ R++   K Q  I+ L+  E   +I++EEE+ K  +   + +AFV+ L+   LF+S++SDD+EG +L  LP   E  E ++ KF   C  +FE GL + E+R+ E+  F EC+ +A   N+  G   I +F       +NA+  +++    E+   E  E +  L   LM LE+ LV+Q+EE +  F+RN+ D+V  F ENV+S   +CR+L+  +  K+ E A+   EKI KG+  +D+ +D+R + +DKD++ NA+ AS D H+LKID++ D +   V  W  +L D I  K+EI RNR RV EIN  +D+   EL+NL+
Sbjct:    1 MSRPYDSMEPKVMDDDMLKVAVGEQGPQEEAGQLAKQEGILFKDVLALQLDFQNILRIDNLWQFENLRKLQLNNNIIERIEGLENLTHLVWLDLSFNNIEAIEGLDTLVNLEDLSLSHNRISKIDSLDPLVNLQVLSLGNNQINNMMNIIYLRRFPCLRTLSLSGNPVSEAEEYKVFIYAYLPDLVYLDFRRVDEQAREVAKMKHQYSIDELKHREALMQIRLEEEQAKQQKLAEHKMAFVEHLNGPFLFDSMYSDDVEGNKLSYLPGVGELLEAYKDKFVIICLNIFEYGLSQQEKRKIELDTFNECIQEAIQENQDQGKLKIAKFEEKHLLNLNAIREESDLFTMEQKLTECNESITELFNTLMILEMQLVEQLEETINVFERNITDLVGLFIENVQSLIAQCRDLENHHHEKLLEIAINTLEKILKGEMDEDLPDDVRALFVDKDTIVNAVGASHDIHLLKIDNREDELVTGVNSWCAHLVDKIH-KDEIMRNRKRVKEINQFVDHMQSELDNLE 517          
BLAST of Dynein regulatory complex subunit 3 vs. UniProt/SwissProt
Match: sp|Q9D5E4|DRC3_MOUSE (Dynein regulatory complex subunit 3 OS=Mus musculus OX=10090 GN=Drc3 PE=1 SV=1)

HSP 1 Score: 383.645 bits (984), Expect = 2.625e-126
Identity = 226/518 (43.63%), Postives = 347/518 (66.99%), Query Frame = 1
Query:  118 MSRLYDTIEPSVITEEMLRTTVYEQGPKGTAGQIAKAEGLSFEKVQSLRLSYKNILEVDNLWWFKNLTKLQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLVNIEDLTLFNNRIKKMENLEHLKQLQVXXXXXXXXXXXXXXKYLRTFKSLKAINLSGNPCCEKDEFRVVVLAYLPQLIYLDYKLINEEERKICCEKEQIRIESLQSDXXXXXXXXXXXXXXMNQEELYNLAFVDGLDKDQLFESLFSDDMEGQRLKELPKNAEHAEEFRKKFSESCYGLFECGLQEHERRQEEVSAFYECLNDAKYSNKKSGMELINEFILYKRDVMNALGNDTN-PNXXXXXXXXXXXXALQYN-LMALELHLVDQIEELVGEFDRNLLDIVLKFKENVESYFGKCRELDVIYQSKVSEEALAIQEKINKGDPTDDISEDLRMILIDKDSMTNALSASKDAHMLKIDSKSDSISNRVQDWFKNLFDTIKTKEEIERNRSRVLEINLLIDNFNLELENLD 1665
            MSR YD++EP V+ ++ML+  V EQGP+  AGQ+AK EG+ F+ V SL+L ++NIL +DNLW F+NL KLQL+NNIIE+I GL +LI L WLDLSFNNIE IEG+D+LVN+EDL+L NNRI K+++L+ L +LQVLS+GNN I ++ N+ YLR F  L+ ++L+GNP  E +E+++ + AYL  L+YLD++ ++E+ R++   K Q  I+ L+  E + ++++EEE+ K  + E + +AFV+ L+   LF+S++S+D+EG +L  LP   E  E ++ KF   C  +FE GL + E+R+ E+  F EC+ +A   N+  G   + +F       +NA+  +T+  N + K     +     +N LM LE+ LV+Q+EE +  F+RN+ D+V  F ENV+S   +CR+L+  +  K+ E A+   EKI KG+  +D+ +D+R + +DKD++ NA+ AS D H+LKID++ D +   +  W  +L D I  K+EI RNR RV EIN  +D+   EL+NL+
Sbjct:    1 MSRPYDSMEPKVMDDDMLKAAVGEQGPQEEAGQLAKQEGILFKDVLSLQLDFQNILRIDNLWQFENLKKLQLNNNIIERIEGLTNLIHLVWLDLSFNNIEAIEGLDTLVNLEDLSLSNNRISKVDSLDALVKLQVLSLGNNQISNMMNIIYLRRFPCLRTLSLAGNPVSEAEEYKMFIYAYLSDLVYLDFRRVDEQMREMAKMKHQYSIDELKHREAQLQMKLEEEQAKQEKLEEHKMAFVEHLNGPFLFDSMYSEDVEGNKLSYLPGVRELLEAYKDKFVIICLNIFEYGLNQQEKRKVELDTFNECIQEAILENQDQGKLKVAKFEEKHLLNLNAIREETDLSNIEKKLTECTESIGELFNTLMILEMQLVEQLEETINIFERNITDLVGLFIENVQSLIAQCRDLENHHHEKLLEIAINTLEKILKGEMDEDLPDDVRALFVDKDTIVNAVGASHDIHLLKIDNREDELVTGINSWCAHLVDKIH-KDEIMRNRKRVKEINQFVDHMQSELDNLE 517          
BLAST of Dynein regulatory complex subunit 3 vs. UniProt/SwissProt
Match: sp|Q9H069|DRC3_HUMAN (Dynein regulatory complex subunit 3 OS=Homo sapiens OX=9606 GN=DRC3 PE=1 SV=2)

HSP 1 Score: 382.489 bits (981), Expect = 7.810e-126
Identity = 224/518 (43.24%), Postives = 343/518 (66.22%), Query Frame = 1
Query:  118 MSRLYDTIEPSVITEEMLRTTVYEQGPKGTAGQIAKAEGLSFEKVQSLRLSYKNILEVDNLWWFKNLTKLQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLVNIEDLTLFNNRIKKMENLEHLKQLQVXXXXXXXXXXXXXXKYLRTFKSLKAINLSGNPCCEKDEFRVVVLAYLPQLIYLDYKLINEEERKICCEKEQIRIESLQSDXXXXXXXXXXXXXXMNQEELYNLAFVDGLDKDQLFESLFSDDMEGQRLKELPKNAEHAEEFRKKFSESCYGLFECGLQEHERRQEEVSAFYECLNDAKYSNKKSGMELINEFILYKRDVMNALGNDTN-PNXXXXXXXXXXXXALQYN-LMALELHLVDQIEELVGEFDRNLLDIVLKFKENVESYFGKCRELDVIYQSKVSEEALAIQEKINKGDPTDDISEDLRMILIDKDSMTNALSASKDAHMLKIDSKSDSISNRVQDWFKNLFDTIKTKEEIERNRSRVLEINLLIDNFNLELENLD 1665
            M++  +++EP V+ ++ML+  V +QGP+  AGQ+AK EG+ F+ V SL+L ++NIL +DNLW F+NL KLQLDNNIIEKI GL +L  L WLDLSFNNIE IEG+D+LVN+EDL+LFNNRI K+++L+ L +LQVLS+GNN ID++ N+ YLR FK L+ ++LS NP  E +++++ + AYLP L+YLDY+ I++  +K+   K Q  I+ L+  E   + Q+E+E+ +  + E +  AFV+ L+   LF+S++++D EG  L  LP   E  E ++ KF   C  +FE GL++ E+R+ E+  F EC+ +A   N++ G   I +F       ++A+  +   PN +          +  ++ LM LE+ LV+Q+EE +  F+RN++D+V  F ENV+S   +CR+L+  +  K+ E +++  EKI +GD  +D+  DLR + +DKD++ NA+ AS D H+LKID++ D +  R+  W   L D I  K+EI RNR RV EIN  ID+   EL+NL+
Sbjct:    1 MNQPCNSMEPRVMDDDMLKLAVGDQGPQEEAGQLAKQEGILFKDVLSLQLDFRNILRIDNLWQFENLRKLQLDNNIIEKIEGLENLAHLVWLDLSFNNIETIEGLDTLVNLEDLSLFNNRISKIDSLDALVKLQVLSLGNNRIDNMMNIIYLRRFKCLRTLSLSRNPISEAEDYKMFICAYLPDLMYLDYRRIDDHTKKLAEAKHQYSIDELKHQENLMQAQLEDEQAQREELEKHKTAFVEHLNGSFLFDSMYAEDSEGNNLSYLPGVGELLETYKDKFVIICVNIFEYGLKQQEKRKTELDTFSECVREAIQENQEQGKRKIAKFEEKHLSSLSAIREELELPNIEKMILECSADISELFDALMTLEMQLVEQLEETINMFERNIVDMVGLFIENVQSLMAQCRDLENHHHEKLLEISISTLEKIVEGDLDEDLPNDLRALFVDKDTIVNAVGASHDIHLLKIDNREDELVTRINSWCTRLIDRIH-KDEIMRNRKRVKEINQYIDHMQSELDNLE 517          
BLAST of Dynein regulatory complex subunit 3 vs. UniProt/SwissProt
Match: sp|A8IVX2|DRC3_CHLRE (Dynein regulatory complex subunit 3 OS=Chlamydomonas reinhardtii OX=3055 GN=DRC3 PE=1 SV=1)

HSP 1 Score: 228.409 bits (581), Expect = 1.192e-66
Identity = 175/505 (34.65%), Postives = 276/505 (54.65%), Query Frame = 1
Query:  118 MSRLYDTIEPSVITEEMLRTTVYEQG--PKGTAGQIAKAEGLSFEKVQSLRLSYKNILEVDNLWWFKNLTKLQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLVNIEDLTLFNNRIKKMENLEHLKQLQVXXXXXXXXXXXXXXKYLRTFKSLKAINLSGNPCCEKDEFRVVVLAYLPQLIYLDYKLINEEERKICCEKEQIRIESLQSDXXXXXXXXXXXXXXMNQEELYNLAFVDGLDKDQLFESLFSDDMEGQRLKELPKNAEHAEEFRKKFSESCYGLFECGLQEHERRQEEVSAFYECLNDAKYSNKKSGMELINEFILYKRDVMNALGNDTNPNXXXXXXXXXXXXALQYNLMALELHLVDQIEELVGEFDRNLLDIVLKFKENVESYFGKCRELDVIYQSKVSEEALAIQEKINKGDP-TDDISEDLRMILIDKDSMTNALSASKDAHMLKIDSKSDS-ISNRVQDWFKNLFDTIKTKEEIERNRSRVLEI 1620
            + RL   +EP+VITE + R  +  QG  P   A    K   + F  V+ L  S+KN+  VDNL     LTKLQLDNN I KI  L HL +L WLDLSFN I  I G+++L  + DL+LFNN+I K+ENL+ L  L VLS+GNN +  L+N+ YLR FK L+ +NL+GNP C+  ++R  VL+++  LIYLDY+ +N  + +   E+ Q  +  LQ  E+++  + +    + + E+L   A ++G++   L + +  +D+E  RL ++P   +   E R KF+          L++H +++ E   +   +            +LI E+   K+     + +     E   +  K K+ AL+  LMA+E+  V+ ++ LV EFDR   ++    K     YF + R+L   + ++++  A+ + EK N+ +   + + E+ R +L DKDS+ NAL AS DAHM KIDS  D  +SN ++    N   +       +RNR R+ EI
Sbjct:    4 LERLIAEVEPNVITESLTRECIQIQGGEPDTAAN---KKRTMPFRDVECLAFSFKNLACVDNLRGLDTLTKLQLDNNQITKIENLAHLTNLTWLDLSFNKITAISGLETLTKLVDLSLFNNQIAKIENLDTLVNLNVLSLGNNQLSQLDNVMYLRQFKQLRLVNLAGNPICKSHDYRSYVLSHIKDLIYLDYRRVNPADVQAAREQHQDEMIELQEREEQQSQEEKLNAERESHEKLMKQANLEGVET--LIDDMVKEDLEWPRLSQVPSLLDPWNEIRDKFNTYTDEFKVAILEQHNKKKAEYEEWLGVVRSYLDEKDAEARKLIVEYEKAKKRTARVVVDQPLMAESQIDNLKVKLMALKDQLMAIEMEAVEVLDGLVQEFDRAYSELAEINKGQYNGYFTQVRDLQNSFFNQLTSVAMTVFEKYNQENSDIESLPEEARTLLQDKDSLMNALQASHDAHMGKIDSLEDRLVSNELRS--ANDLTSSNATWATKRNRDRISEI 501          
BLAST of Dynein regulatory complex subunit 3 vs. TrEMBL
Match: D1LX59 (LRRC48-like protein OS=Saccoglossus kowalevskii OX=10224 PE=2 SV=1)

HSP 1 Score: 443.351 bits (1139), Expect = 3.953e-147
Identity = 256/518 (49.42%), Postives = 353/518 (68.15%), Query Frame = 1
Query:  118 MSRLYDTIEPSVITEEMLRTTVYEQGPKGTAGQIAKAEGLSFEKVQSLRLSYKNILEVDNLWWFKNLTKLQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLVNIEDLTLFNNRIKKMENLEHLKQLQVXXXXXXXXXXXXXXKYLRTFKSLKAINLSGNPCCEKDEFRVVVLAYLPQLIYLDYKLINEEERKICCEKEQIRIESLQSDXXXXXXXXXXXXXXMNQEELYNLAFVDGLDKDQLFESLFSDDMEGQRLKELPKNAEHAEEFRKKFSESCYGLFECGLQEHERRQEEVSAFYECLNDAKYSNKKSGMELINEFILYKRDVMNALGN--DTNPNXXXXXXXXXXXXALQYNLMALELHLVDQIEELVGEFDRNLLDIVLKFKENVESYFGKCRELDVIYQSKVSEEALAIQEKINKGDPTDDISEDLRMILIDKDSMTNALSASKDAHMLKIDSKSDSISNRVQDWFKNLFDTIKTKEEIERNRSRVLEINLLIDNFNLELENLD 1665
            MSRLYDT+EP+VI EEML   V EQGPK  AG+IAK EG+ F  V  LRL +KNIL++DNLW F  LTKLQLDNNIIEKI GL+ L++L WLDLSFNNIEIIEG D L  +EDLTL+NNRI  +EN++ L +L VLS+GNN I+ L N+KYLR FK+L+ +NLSGN  C+   ++  ++A++P L+YLD++LI+E  R    E+ +  IE L++DE  +E +   EK K +  EL+  A+V+ L+   LF+S+F DD EG +L  LP   E    F++KF+E C  LFE GLQEH +R++EVS F+EC+ DAK  NK    E I+ F+ YK+ + + + +  D    +   EEY ++V  +   LM  EL LVDQ+EE + EFDRN+ D+V  F ENV++   +CREL+  +  K+ E A+   EK  K +  DD+ ++ +++L+DKD++ NA+SAS D H+LKID++ D I  R  +W   L + I   EEI+RNR R+ EIN LID+ N EL+NLD
Sbjct:    1 MSRLYDTVEPAVIDEEMLLKAVEEQGPKEEAGRIAKQEGIDFCDVVQLRLDFKNILKIDNLWQFTRLTKLQLDNNIIEKIEGLDQLVNLIWLDLSFNNIEIIEGFDKLTKLEDLTLYNNRISVIENMDALTKLHVLSVGNNNIEQLENVKYLRRFKNLQTLNLSGNEFCDDGNYKAYIVAHIPSLVYLDFRLIDESTRVAANEQYKYSIEELEADENAEERKRVSEKEKQDLFELHKSAYVENLNGPFLFDSMFFDDTEGPKLASLPGVEELLITFKEKFTEICQQLFEFGLQEHAKRKKEVSEFFECIEDAKKENKDIAAEKIDSFLAYKKKLFSEIQHMSDQKVLDSRIEEYHKEVNVIWDQLMGYELQLVDQLEETIKEFDRNMADMVSLFVENVQAQISQCRELENQHHEKLLEIAVITLEKFVKNELDDDVPDETKLLLVDKDTIQNAVSASHDLHLLKIDNREDEIITRANNWMAALMEQIHQDEEIKRNRDRICEINNLIDHLNDELDNLD 518          
BLAST of Dynein regulatory complex subunit 3 vs. TrEMBL
Match: A0A210QM46 (Leucine-rich repeat-containing protein 48 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT05716 PE=4 SV=1)

HSP 1 Score: 440.269 bits (1131), Expect = 6.416e-146
Identity = 240/518 (46.33%), Postives = 361/518 (69.69%), Query Frame = 1
Query:  118 MSRLYDTIEPSVITEEMLRTTVYEQGPKGTAGQIAKAEGLSFEKVQSLRLSYKNILEVDNLWWFKNLTKLQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLVNIEDLTLFNNRIKKMENLEHLKQLQVXXXXXXXXXXXXXXKYLRTFKSLKAINLSGNPCCEKDEFRVVVLAYLPQLIYLDYKLINEEERKICCEKEQIRIESLQSDXXXXXXXXXXXXXXMNQEELYNLAFVDGLDKDQLFESLFSDDMEGQRLKELPKNAEHAEEFRKKFSESCYGLFECGLQEHERRQEEVSAFYECLNDAKYSNKKSGMELINEFILYKRDVMNALG--NDTNPNXXXXXXXXXXXXALQYNLMALELHLVDQIEELVGEFDRNLLDIVLKFKENVESYFGKCRELDVIYQSKVSEEALAIQEKINKGDPTDDISEDLRMILIDKDSMTNALSASKDAHMLKIDSKSDSISNRVQDWFKNLFDTIKTKEEIERNRSRVLEINLLIDNFNLELENLD 1665
            MSRLYDT+EP+V+ E+ML+  V EQGPK  AG+IAK+EG+ F  V +LRL + N+L++DNLW F  LTKLQLDNNIIEKI GL+ L++L WLDLSFNNIE+IEG+++L  +EDLTL+NNRI  +EN++ L  L V SIGNN++ +L+NL YLR FK +K +NL+GNP C++  ++  V+A+L  + +LDY+L++++ R+   EK  I+ + +  +EK+ E++ EEE     Q EL+  A+V+ +D   LFE ++ +D EGQ+L E+P   +  + F+ KF   C+ +FE GL+EHE+R  EV  F+EC+ DA+  NK  GM+ IN F++ K+ +M  LG  +D    E +  +Y  +V  L   LM LEL +VDQ+E+++ +F+R++ D+V  F+EN++++  +CR+L+  +  K+ E A+   EK+ K +  D+I+EDLRM+ +DKD++ NA+S+S D H+LKID+K D +  R+  W K   D I   EE+ RNR RV EIN LID+   E++NL+
Sbjct:    1 MSRLYDTVEPAVVDEDMLKRAVEEQGPKDEAGKIAKSEGIDFGDVLALRLDFLNVLKIDNLWEFTALTKLQLDNNIIEKIEGLDCLVNLVWLDLSFNNIEVIEGLNALTKLEDLTLYNNRIATLENMDTLLNLHVFSIGNNMLTELSNLLYLRRFKEMKTLNLAGNPFCKQSGYKQYVIAFLSGIDFLDYRLVDKQSREDAMEKHMIQRDEMLHNEKQAELKQEEEIKNKKQLELHKAAYVELMDGPHLFEMMYIEDSEGQKLSEMPGIEDLLQTFKDKFVAICHQMFEYGLKEHEKRDSEVKQFWECVEDAEQENKNLGMKAINNFMVVKKRIMQELGQISDQKVLESVVADYNNQVSELWDKLMGLELQIVDQLEDVIKDFERSMQDLVASFQENIQAFLAQCRDLETFHHEKMMEIAIITLEKVLKNELDDEINEDLRMLFVDKDTIMNAVSSSHDVHLLKIDNKEDDMVTRINHWLKTTIDKIHEDEEVARNRMRVTEINNLIDHLRDEIDNLE 518          
BLAST of Dynein regulatory complex subunit 3 vs. TrEMBL
Match: A0A1S3I9V2 (dynein regulatory complex subunit 3-like OS=Lingula unguis OX=7574 GN=LOC106162325 PE=4 SV=1)

HSP 1 Score: 436.802 bits (1122), Expect = 2.287e-144
Identity = 250/539 (46.38%), Postives = 358/539 (66.42%), Query Frame = 1
Query:  118 MSRLYDTIEPSVITEEMLRTTVYEQGPKGTAGQIAKAEGLSFEKVQSLRLSYKNILEVDNLWWFKNLTKLQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLVNIEDLTLFNNRIKKMENLEHLKQLQVXXXXXXXXXXXXXXKYLRTFKSLKAINLSGNPCC------------------EKDEFRVVVLAYLPQLIYLDYKLINEEERKICCEKEQIRIESLQSDXXXXXXXXXXXXXXMNQEELYNLAFVDGLDKDQLFESLFSDDMEGQRLKELPKNAEHAEEFRKKFSESCYGLFECGLQEHERRQEEVSAFYECLNDAKYSNKKSGMELINEFILYKRDVMNALGNDTNPNX--XXXXXXXXXXXALQYNLMALELHLVDQIEELVGEFDRNLLDIVLKFKENVESYFGKCRELDVIYQSKVSEEALAIQEKINKGDPTDDISEDLRMILIDKDSMTNALSASKDAHMLKIDSKSDSISNRVQDWFKNLFDTIKTKEEIERNRSRVLEINLLIDNFNLELENLDYQI 1674
            MSRLYDT+EPSVI ++ML   V EQGPK  AG+IAKAEG+ F  V+SLRL +KNIL++DNLW F +LTKLQLDNNIIEKI GL+ L +L WLDLSFNNIE IEG++ L  ++DLTL+NNRI K+EN++ L  LQV SIGNN +D+L N+ YLR FK LK +NL+GNP C                  E  ++R  ++AYLP L YLDY+LI+E  R    EK  + IE L  +E+ +  + EE + K  +  L+  A+V+ +D   LF +++++D EGQ+L ++P   E    +++K+  +C+ +FE GLQEHERR EEV+ F++C+ +AK  NK+ GM+ IN+F+ YK+ +   L + T+         EY ++++ L   LM LEL LVDQ+EE   +F+RNL D+V  F EN + +    R+L+ I+  K+ E ++   EK+ K +  ++I EDLR++ +DKD++ NA+S+S D H+LKID++ D I  R+  W   L   I  +EE++RNR RV EIN LID+   E++ LD Q+
Sbjct:    1 MSRLYDTVEPSVIDDDMLHKAVEEQGPKEEAGRIAKAEGIDFADVKSLRLDFKNILKIDNLWCFDSLTKLQLDNNIIEKIEGLDTLTNLIWLDLSFNNIEAIEGLEKLTKLQDLTLYNNRISKIENMDCLPDLQVFSIGNNELDELENVIYLRRFKRLKTLNLNGNPFCKVCVQEENPEDGSEAVYTENQDYRPFIIAYLPSLDYLDYRLIDENTRAAANEKYHLAIEELTHNEEVENKKEEERQAKEKEHNLHKAAYVENMDGPALFHAMYTEDAEGQKLADMPGVDEMLVVYKEKYVATCHQIFEYGLQEHERRMEEVNQFWDCIEEAKRENKEMGMKQINQFMEYKKRLFQELTHLTDQQVLDNKITEYNKRLQELWDKLMGLELQLVDQLEEATKDFERNLSDLVSSFIENCQGHISALRDLENIHHEKLLEISIVTLEKVVKNELDEEIPEDLRLLFVDKDTIINAVSSSHDIHLLKIDNREDDIVTRINQWMSQLMTKIHEEEEVKRNRMRVSEINNLIDHLREEMDTLDLQL 539          
BLAST of Dynein regulatory complex subunit 3 vs. TrEMBL
Match: A0A2T7PVG3 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_00002 PE=4 SV=1)

HSP 1 Score: 436.032 bits (1120), Expect = 2.978e-144
Identity = 237/519 (45.66%), Postives = 352/519 (67.82%), Query Frame = 1
Query:  118 MSRLYDTIEPSVITEEMLRTTVYEQGPKGTAGQIAKAEGLSFEKVQSLRLSYKNILEVDNLWWFKNLTKLQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLVNIEDLTLFNNRIKKMENLEHLKQLQVXXXXXXXXXXXXXXKYLRTFKSLKAINLSGNPCCEKDEFRVVVLAYLPQLIYLDYKLINEEERKICCEKEQIRIESLQSDXXXXXXXXXXXXXXMNQEELYNLAFVDGLDKDQLFESLFSDDMEGQRLKELPKNAEHAEEFRKK-FSESCYGLFECGLQEHERRQEEVSAFYECLNDAKYSNKKSGMELINEFILYKRDVMNALGNDTNPNXXXXXXXXXXX--XALQYNLMALELHLVDQIEELVGEFDRNLLDIVLKFKENVESYFGKCRELDVIYQSKVSEEALAIQEKINKGDPTDDISEDLRMILIDKDSMTNALSASKDAHMLKIDSKSDSISNRVQDWFKNLFDTIKTKEEIERNRSRVLEINLLIDNFNLELENLD 1665
            MSRLYDT+EPSVI EEML   V EQGPK  AG+IAK EG+ F  V +LRL +KNIL++D LW F +LTKLQLDNNIIEKI G++ LI+L WLDLSFNNIE+IEG+D+LV ++DLTL+NNRI  +EN++ L  LQV SIGNN + +L N+ YLR FK LK +NL  NP C+ + +R  V A+LP + YLDY L++E+ +    E  QI+IE +  +EK+ + +  E+  +  + +L+  A+V+ L+   LF+S++++D EGQ+L+++P   E    +  K F+  C  +FE GLQEH++R+ EV  F+EC+ +AK  NK+ GM  + EF+  K+ +   + + ++P +      +       L   LM LEL LVDQ+EE++  FDRN+ D+V  F EN++ Y  + R+ +  +  K+ E A    EK+ K +  ++I +DL+M+ +D+D++TNA+S+S D H+LKID+K D I   + +W K++ +TI  ++EI+RNR RV EIN LID+   E++NL+
Sbjct:    1 MSRLYDTVEPSVIDEEMLTHAVEEQGPKEEAGKIAKTEGIDFRDVLALRLDFKNILKIDGLWEFSSLTKLQLDNNIIEKIEGISMLINLVWLDLSFNNIEVIEGLDTLVKLQDLTLYNNRISHVENMDTLTDLQVFSIGNNDLKELENIAYLRRFKKLKTLNLHHNPFCDLEGYRQYVAAFLPHIEYLDYHLLDEQTKAAAYEHHQIQIEEMLDNEKKAQSRQAEDDRQALELQLHRKAYVENLNGPSLFQSMYAEDAEGQKLEDMPGVDELLVVYPLKIFTAICQQMFEYGLQEHQKREAEVEQFWECVEEAKTENKEMGMRAVQEFMADKKQMFTEMSSISDPKQLADRVQEYNTCITELWDKLMGLELQLVDQLEEVIQNFDRNMQDLVSTFIENLQGYMVQARDAENAHHEKMMEIATVTLEKVLKNELDEEIPDDLKMLFVDRDTITNAVSSSHDVHLLKIDNKEDDIVTHINNWLKHMIETIHEEQEIQRNRQRVTEINHLIDHLREEIDNLE 519          
BLAST of Dynein regulatory complex subunit 3 vs. TrEMBL
Match: A0A267DEL0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig026166g1 PE=4 SV=1)

HSP 1 Score: 435.647 bits (1119), Expect = 3.582e-144
Identity = 252/518 (48.65%), Postives = 366/518 (70.66%), Query Frame = 1
Query:  118 MSRLYDTIEPSVITEEMLRTTVYEQGPKGTAGQIAKAEGLSFEKVQSLRLSYKNILEVDNLWWFKNLTKLQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLVNIEDLTLFNNRIKKMENLEHLKQLQVXXXXXXXXXXXXXXKYLRTFKSLKAINLSGNPCCEKDEFRVVVLAYLPQLIYLDYKLINEEERKICCEKEQIRIESLQSDXXXXXXXXXXXXXXMNQEELYNLAFVDGLDKDQLFESLFSDDMEGQRLKELPKNAEHAEEFRKKFSESCYGLFECGLQEHERRQEEVSAFYECLNDAKYSNKKSGMELINEFILYKRDVMNAL--GNDTNPNXXXXXXXXXXXXALQYNLMALELHLVDQIEELVGEFDRNLLDIVLKFKENVESYFGKCRELDVIYQSKVSEEALAIQEKINKGDPTDDISEDLRMILIDKDSMTNALSASKDAHMLKIDSKSDSISNRVQDWFKNLFDTIKTKEEIERNRSRVLEINLLIDNFNLELENLD 1665
            MSRLYDTIEPSV+ +EMLRT V+EQGPKG AG+IAK EG++F  V  LRL Y+NIL++DNLW F +L KLQLDNNIIE I GL+HL+ L+WLDLSFNNI  I+G+D L  +EDLTL++NRI+ +EN+  L +LQVLS+GNN ++DLNNL YLR F+ L+++N+ GNP C+  +FR  VLA++PQL +L+YKLI+   R    E+ +++I  ++ +E+ +E    E+ +K  +++L+ LAFV+ LD D LF+SL+ +DMEGQ+L  +P   E  ++F+ KF E C  LF+ GL +H++R EEV  F +C+++A+ +NK+   E I EF+ Y+RD ++ L    D+   E   ++Y E+V  L  +LM  EL LVDQ+EE + EFDRNL ++V  F ENV++    CREL+  +   + E A    EK+ K +  ++  EDLR + ++KD +  A+  S D H+LKID+K D I  R++DW K+L +++ T+ EI+RNRSRVLEIN L+D+   +++NLD
Sbjct:    1 MSRLYDTIEPSVVDDEMLRTAVHEQGPKGEAGRIAKKEGINFATVTELRLDYRNILKIDNLWAFGSLVKLQLDNNIIESIQGLDHLVHLRWLDLSFNNIGRIDGLDKLTQLEDLTLYSNRIETLENMNSLTKLQVLSVGNNKLNDLNNLLYLRRFRRLQSLNIKGNPVCDNRDFRDFVLAFVPQLDFLNYKLIDAALRSAAKERYELKINEMEDNERREERLASEKAVKEEEQKLHKLAFVENLDGDALFDSLYQEDMEGQKLNRMPGVDEKLQQFKDKFVEVCKQLFDFGLSDHQKRDEEVKQFLDCIDEAEMANKRMAEERIAEFMAYRRDTVDELMQMTDSKLAESRLKDYDEEVTKLWDDLMGYELQLVDQLEEAIKEFDRNLEEMVATFVENVQTLMSNCRELENNHNELMMETATVFLEKVMKNELEEEPPEDLRDLFVEKDVVVAAVQTSHDLHLLKIDNKEDDIVKRIKDWKKDLMESMNTEREIKRNRSRVLEINNLVDHLREDVQNLD 518          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Cavefish
Match: drc3 (dynein regulatory complex subunit 3 [Source:ZFIN;Acc:ZDB-GENE-061103-349])

HSP 1 Score: 335.88 bits (860), Expect = 7.049e-109
Identity = 200/514 (38.91%), Postives = 313/514 (60.89%), Query Frame = 1
Query:  151 VITEEMLRTTVYEQGPKGTAGQIAKAEGLSFEKVQSLRLSYKNILEVDNLWWFKNLTKLQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLVNIEDLTLFNNRIKKMENLEHLKQLQVXXXXXXXXXXXXXXKYLRTFKSLKAINLSGNPCCEKDEFRVVVLAYLPQLIYLDYKLINEE----ERKICCEKEQIRIESLQSDXXXXXXXXXXXXXXMNQEELYNLAFVDGLDKDQLFESLFSDDMEGQRLKELPKNAEHAE-------EFRKKFSESCYGLFECGLQEHERRQEEVSAFYECLNDAKYSNKKSGMELINEFILYKRDVMNALGNDTNPNXXXXXXXXXXXXALQYN--LMALELHLVDQIEELVGEFDRNLLDIVLKFKENVE-----------SYFGKCRELDVIYQSKVSEEALAIQEKINKGDPTDDISEDLRMILIDKDSMTNALSASKDAHMLKIDSKSDSISNRVQDWFKNLFDTIKTKEEIERNRSRVLEI 1620
            VI EEMLR  V EQGP+G AG+IAK  G+ +++V  LRL YK IL++D+LW F +LTKLQL+NN IEKI GL  L +L WL LSFN I++IEG+++LV ++ L+L NN+I  +E ++ L+ L++LS+G N+I  ++N+ YLR FK+L+++NL+ NP C++  +++ V+AYLP L+YLD++L++E+    + K   E ++I  + LQ                     L+  AFV+ L+  QLF+S+F+DD E  RL  LP   +  E        ++ +    C  +FE GL +H  R+ E  +F+ C  +A   N++   +++ +F   +R VM  +   T+P     +      K  Q +  LM LEL LVDQ+E++  EF+RN+ D+V  F ENV+           S+F +CREL+  Y  K+ E ALA  EK+ + +  +D+ ED+ ++L+DKD++  A+SAS D H LKID++ D +  R+  W   +  +++  EE+ RNR R+ EI
Sbjct:    1 VINEEMLRKAVEEQGPQGRAGRIAKEGGIQYDEVIQLRLEYK-ILQIDHLWEFTSLTKLQLNNNSIEKIQGLEKLTNLLWL-LSFNKIKMIEGLEALVKLQTLSLSNNQIPAIEKMDTLEHLEILSLGENVISQIDNVIYLRRFKNLRSLNLARNPICQETNYKIFVVAYLPDLVYLDFRLVDEQTNELKEKRAMEAQKITEQELQ---------------------LHKDAFVEYLNGPQLFDSMFADDAEESRLASLPGVPKLLETYPCLLIHYQTELVALCMQIFETGLIQHAERKNEGDSFFTCCREAVSDNQQRAAQIVTDFEESRRQVMAEMQKITDPELLEAQRDNYSEKISQLSDTLMTLELQLVDQLEDVFKEFERNISDMVGAFIENVQGIYPLTALPVQSHFAQCRELEKHYHEKLQEIALATLEKMARNELEEDMPEDMHLLLVDKDTVVKAVSASHDTHQLKIDNREDELMTRINSWMSAMMKSVQ-DEEVTRNRKRISEI 490          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Cavefish
Match: drc3 (dynein regulatory complex subunit 3 [Source:ZFIN;Acc:ZDB-GENE-061103-349])

HSP 1 Score: 315.079 bits (806), Expect = 2.892e-101
Identity = 188/501 (37.52%), Postives = 298/501 (59.48%), Query Frame = 1
Query:  118 MSRLYDTIEPSVITEEMLRTTVYEQGPKGTAGQIAKAEGLSFEKVQSLRLSYKNILEVDNLWWFKNLTKLQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLVNIEDLTLFNNRIKKMENLEHLKQLQVXXXXXXXXXXXXXXKYLRTFKSLKAINLSGNPCCEKDEFRVVVLAYLPQLIYLDYKLINEEERKICCEKEQIRIESLQSDXXXXXXXXXXXXXXMNQEELYNLAFVDGLDKDQLFESLFSDDMEGQRLKELPKNAEHAEEFRKKFSESCYGLFECGLQEHERRQEEVSAFYECLNDAKYSNKKSGMELINEFILYKRDVMNALGNDTNPNXXXXXXXXXXXXALQYNLMALELHLVDQIEELVGEFDRNLLDIVLKFKENVESYFGKCRELDVIYQSKVSEEALAIQEKINKGDPTDDISEDLRMILIDKDSMTNALSASKDAHMLKIDSKSDSISNRVQDWFKNLFDTIKTKEEIERNRSRVLEI 1620
            MS  YD +   VI EEMLR  V EQGP+G AG+IAK  G+ +++V  LRL YK IL++D+LW F +LTKLQL+NN IEKI GL  L +L WLDLSFN I++IEG+++LV ++ L+L NN+I  +E ++ L+ L++LS+G N+I  ++N+ YLR FK+L+++NL+ NP C++  +++ V+AYLP L+YLD++L++E+ R    E+    I  +  +E +++  ME +K+   + +L+  AFV+ L+  QLF+S+F+DD E  RL  LP       +  + +   C  +FE GL +H  R+ E  +F+ C  +A   N++   +++ +F   +R V  A                                L   I     EF+RN+ D+V  F ENV+  +         Y  K+ E ALA  EK+ + +  +D+ ED+ ++L+DKD++  A+SAS D H LKID++ D +  R+  W   +  +++  EE+ RNR R+ EI
Sbjct:    1 MSMWYDRMGHCVINEEMLRKAVEEQGPQGRAGRIAKEGGIQYDEVIQLRLEYKKILQIDHLWEFTSLTKLQLNNNSIEKIQGLEKLTNLLWLDLSFNKIKMIEGLEALVKLQTLSLSNNQIPAIEKMDTLEHLEILSLGENVISQIDNVIYLRRFKNLRSLNLARNPICQETNYKIFVVAYLPDLVYLDFRLVDEQTR----ERALTEINVMTDNELKEKRAMEAQKITEQELQLHKDAFVEYLNGPQLFDSMFADDAEESRLASLPG----VPKLLETYPSLCMQIFETGLIQHAERKNEGDSFFTCCREAVSDNQQRAAQIVTDFEESRRQVGFACS------------------------------LCVTI-----EFERNISDMVGAFIENVQGIYPLTH-----YHEKLQEIALATLEKMARNELEEDMPEDMHLLLVDKDTVVKAVSASHDTHQLKIDNREDELMTRINSWMSAMMKSVRHDEEVTRNRKRISEI 453          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Cavefish
Match: ENSAMXT00000057771.1 (pep primary_assembly:Astyanax_mexicanus-2.0:24:38132889:38135255:-1 gene:ENSAMXG00000029033.1 transcript:ENSAMXT00000057771.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 76.6406 bits (187), Expect = 1.533e-15
Identity = 66/213 (30.99%), Postives = 106/213 (49.77%), Query Frame = 1
Query:  346 IEKISGLNHLISLKWLDLSFNNIEIIEGIDSLVNIEDLTLFNNRIKKMENLEHLKQLQ-VXXXXXXXXXXXXXXKYLRTFKSLKAINLSGNPCCEKDEFRVVVLAYLPQLIYLDYKLINEEERKICCEKEQIRIESLQSDXXXXXXXXXXXXXXMNQEELYNLAFVDGLDKDQLFESLFSDDMEGQRLKELPKNAEHAEEFRKKFSESCYGLF 981
            I KI GL  L +L+ LDLS+N I++IEG+D+LV ++ L L  N I  +EN++ L+ LQ +      +    N ++YLR FK+L+++ L+GNP   K  + + ++  L ++         EE+ +I  + + I  + LQ                     L+  AFV+ L+    F S+  DD +     E+P   E  E +  K SE C  LF
Sbjct:   18 ISKIEGLEILTNLECLDLSYNKIKVIEGLDTLVKLKQLNLSMNNISVIENMDTLEHLQHLSLAHTRICQLDNTVEYLRRFKNLRSLRLAGNPISRKTNYTLYIVRALDEITVTGSLSELEEDTEI--KAQTIAKQELQ---------------------LHRDAFVEDLNGPHPFGSMTVDDGD-----EVP---ETMESYELKMSELCMQLF 199          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Cavefish
Match: ppp1r7 (protein phosphatase 1 regulatory subunit 7 [Source:NCBI gene;Acc:111191999])

HSP 1 Score: 72.7886 bits (177), Expect = 1.766e-13
Identity = 51/153 (33.33%), Postives = 87/153 (56.86%), Query Frame = 1
Query:  238 SFEKVQSLRLSYKNILEVDNLWWFKNLTKLQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLVNIEDLTLFNNRIKKMENLEHLKQLQVXXXXXXXXXXXXXXKYLRTFKSLKAINLSGNPCCEKDEFRVVVLAYLPQLIYLDYKLI 696
            +   + SL L    I ++ NL    NLT L + +N I K+ GL ++++L+ L LS N IE+IEG+++   +  L +  NRIKK+EN+ HL  LQ   + +N I++ ++L  L+  K L+ + L  NP  +  ++R  ++  LP +  +D   I
Sbjct:  192 ALTSLDSLFLGTNKITKLQNLDGLHNLTVLSIQSNRITKLEGLQNMVNLRELYLSHNGIEVIEGLENNKKLTTLDIAANRIKKIENISHLTDLQEFWMNDNQIENWSDLDELKNAKGLETVYLERNPLQKDPQYRRKIMLALPSVRQIDATFI 344          

HSP 2 Score: 60.4622 bits (145), Expect = 1.461e-9
Identity = 39/104 (37.50%), Postives = 61/104 (58.65%), Query Frame = 1
Query:  214 QIAKAEGLS-FEKVQSLRLSYKNILEVDNLWWFKNLTKLQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLVNIEDLTLFNNRIKKMENLEHLKQLQV 522
            +I K EGL   +K ++L L    I +++NL    +L +L L +N I K+  L  L  L+ LD+SFN +  IEG++ L  ++ L L +N+I  + NLEHL  L +
Sbjct:   73 RIGKIEGLEVLQKAKTLSLRQNLIKKIENLESLSSLRELDLYDNQIRKLENLQALTELEQLDVSFNLLRKIEGLERLTKVKKLFLLHNKISSIANLEHLTSLHM 176          

HSP 3 Score: 56.6102 bits (135), Expect = 2.547e-8
Identity = 38/104 (36.54%), Postives = 61/104 (58.65%), Query Frame = 1
Query:  214 QIAKAEGL-SFEKVQSLRLSYKNILEVDNLWWFKNLTKLQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLVNIEDLTLFNNRIKKMENLEHLKQLQV 522
            QI K E L +  +++ L +S+  + +++ L     + KL L +N I  I+ L HL SL  L+L  N I IIE +D+L +++ L L  N+I K++NL+ L  L V
Sbjct:  117 QIRKLENLQALTELEQLDVSFNLLRKIEGLERLTKVKKLFLLHNKISSIANLEHLTSLHMLELGSNRIRIIENLDALTSLDSLFLGTNKITKLQNLDGLHNLTV 220          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Cavefish
Match: lrrc6 (leucine rich repeat containing 6 [Source:NCBI gene;Acc:103025716])

HSP 1 Score: 65.855 bits (159), Expect = 4.835e-11
Identity = 44/136 (32.35%), Postives = 68/136 (50.00%), Query Frame = 1
Query:  304 WFKNLTKLQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLVNIEDLTLFNNRIKKMENLEHLKQLQVXXXXXXXXXXXXXXKYLRTFKSLKAINLSGNPCCEKDEFRVVVLAYLPQLIYLDYKLINEEER 711
            W ++L  L L NN+I KI  +  L +L++L+L+ NNIE+IE ++   +++ L L  N +  + ++E LK                          L+ + L GNPC E   +R  V+A LPQL +LD   I   ER
Sbjct:   57 WCRDLKILYLQNNLIPKIENVGRLKNLEYLNLALNNIEVIENLEGCESLQKLDLTVNFVGLLSSVESLKH----------------------NVHLRELYLVGNPCSEFQGYRQYVVACLPQLKWLDGTAIRRAER 170          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007158.1 (pep scaffold:Pmarinus_7.0:GL477065:91521:97732:-1 gene:ENSPMAG00000006473.1 transcript:ENSPMAT00000007158.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 162.155 bits (409), Expect = 2.141e-46
Identity = 93/245 (37.96%), Postives = 149/245 (60.82%), Query Frame = 1
Query:  943 FRKKFSESCYGLFECGLQEHERRQEEVSAFYECLNDAKYSNKKSGMELINEFILYKRDVMNALGNDTNPNXXXXXXXXXXXXA--LQYNLMALELHLVDQIEELVGEFDRNLLDIVLKFKENVESYFGKCRELDVIYQSKVSEEALAIQEKINKGDPTDDISEDLRMILIDKDSMTNALSASKDAHMLKIDSKSDSISNRVQDWFKNLFDTIKTKEEIERNRSRVLEINLLIDNFNLELENLDYQ 1671
            +R+KF + C  +FE GLQ++++R+EEV  F   +N+AK  N+++   +I++F      ++  +   T+      +  +   K   +   LM LE+ L+DQ+E++V +F+RNL D+V  F ENV+    +CREL+  Y  K+ E  ++  +KI K +  +++SEDLR+I  DKDS+ NA SAS D H+LKID+K D I +R   W       ++  EE++RNR+RV EIN  +D  + EL+N D Q
Sbjct:    5 YRQKFVDICRKIFEYGLQQYKKREEEVDDFTRSVNEAKSDNRQAASAIISDFEKENAQLLEEVQQITDAALLDAKILEHSQKINNMWDALMKLEIQLLDQLEDVVKDFERNLTDMVAAFIENVQGLLSQCRELENNYHEKLLEVLMSTFDKIVKNELKEELSEDLRLIFTDKDSLVNAASASHDIHLLKIDNKEDDIISRANTWMATFVQRVQ-DEEVKRNRARVTEINHYVDYLHEELQNQDIQ 248          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Sea Lamprey
Match: ppp1r7 (protein phosphatase 1, regulatory (inhibitor) subunit 7 [Source:NCBI gene;Acc:560323])

HSP 1 Score: 66.2402 bits (160), Expect = 4.953e-12
Identity = 47/149 (31.54%), Postives = 86/149 (57.72%), Query Frame = 1
Query:  238 SFEKVQSLRLSYKNILEVDNLWWFKNLTKLQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLVNIEDLTLFNNRIKKMENLEHLKQLQVXXXXXXXXXXXXXXKYLRTFKSLKAINLSGNPCCEKDEFRVVVLAYLPQLIYLD 684
            + + + SL +    I ++ NL    NLT L + +N I KI GL+ L++L+ L LS N IE+IEG+++   +  L +  NR++++EN+ HL +LQ   + +N I + N++  L+  + L+ + L  NP     ++R  ++  LP +  +D
Sbjct:  186 TLKNLDSLFIGKNKITKLQNLDSLTNLTVLSIQSNRITKIEGLSSLVNLQELYLSHNGIEVIEGLENNKKLTTLDIAANRVRRIENVGHLTELQEFWMNDNQISNWNDVDELKNARGLQTVYLERNPLQRDPQYRRKIMLALPWVRQID 334          

HSP 2 Score: 61.6178 bits (148), Expect = 1.412e-10
Identity = 40/104 (38.46%), Postives = 66/104 (63.46%), Query Frame = 1
Query:  211 GQIAKAEGLSFEKVQSLRLSYKNILEVDNLWWFKNLTKLQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLVNIEDLTLFNNRIKKMENLEHLKQLQV 522
            G+I + E L   KV  LR +   I +++NL     L +L L +N+++KI  L+ L++L+ LD+SFN +  IEG+D+L  +  L L +N+I K+ENL  L +L++
Sbjct:   69 GKIERLEILMKVKVLCLRQNM--IAQIENLESLTTLRELDLYDNVLKKIENLDTLVNLEMLDISFNVLRKIEGLDTLRKVRKLFLVSNKITKIENLNSLTELRM 170          

HSP 3 Score: 50.8322 bits (120), Expect = 4.400e-7
Identity = 34/103 (33.01%), Postives = 61/103 (59.22%), Query Frame = 1
Query:  217 IAKAEGL-SFEKVQSLRLSYKNILEVDNLWWFKNLTKLQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLVNIEDLTLFNNRIKKMENLEHLKQLQV 522
            + K E L +   ++ L +S+  + +++ L   + + KL L +N I KI  LN L  L+ L+++ N I +IE I++L N++ L +  N+I K++NL+ L  L V
Sbjct:  112 LKKIENLDTLVNLEMLDISFNVLRKIEGLDTLRKVRKLFLVSNKITKIENLNSLTELRMLEVASNRIRVIENIETLKNLDSLFIGKNKITKLQNLDSLTNLTV 214          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Sea Lamprey
Match: lrrc6 (leucine rich repeat containing 6 [Source:NCBI gene;Acc:432388])

HSP 1 Score: 65.4698 bits (158), Expect = 1.457e-11
Identity = 50/186 (26.88%), Postives = 89/186 (47.85%), Query Frame = 1
Query:  154 ITEEMLRTTVYEQGPKGTAGQIAKAEGLSFEKVQSLRLSYKNILEVDNLWWFKNLTKLQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLVNIEDLTLFNNRIKKMENLEHLKQLQVXXXXXXXXXXXXXXKYLRTFKSLKAINLSGNPCCEKDEFRVVVLAYLPQLIYLDYKLINEEER 711
            +TE ++R+           G++   E LS  + Q  RL + ++       W ++L  L L NN+I +I  L+ L  L++++L+ NN+E IE +    +++ L L  N + ++ ++E L+   +                      L+ + L GNPC + + +R  V+A LPQL  LD + I   ER
Sbjct:    1 VTEALVRSRAEHNN-----GELFSLEELSLHQQQIERLQHLDV-------WCRHLKTLYLHNNVIPRIENLSRLKELEYINLALNNVERIENLQGCESLQKLDLTVNFVGELSSVETLRHNPL----------------------LEELFLVGNPCADFEGYRPYVVATLPQLKRLDGQEIERSER 152          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Sea Lamprey
Match: LRRC49 (leucine rich repeat containing 49 [Source:HGNC Symbol;Acc:HGNC:25965])

HSP 1 Score: 57.3806 bits (137), Expect = 5.989e-9
Identity = 57/204 (27.94%), Postives = 93/204 (45.59%), Query Frame = 1
Query:  244 EKVQSLRLSYKNILEVDNLWWFKNLTKLQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLVNIEDLTLFNNRIKKMENLEHLKQLQVXXXXXXXXXXXXXXKYLRTF----------KSLKAIN----------------------------------LSGNPCCEKDEFRVVVLAYLPQLIYLDYKLINEEERKICC 723
            E ++ L L +  I    +L   + L  L L  N +E+ISGL +L SL+ L L  N I  I  ++SL  ++ L L  N+I ++ENL HL +L+VL++  N I  +++L+ L +            S+K ++                                  L GNP  ++  +R   L ++ QL  LD K + EEER++  
Sbjct:   52 EDLRLLSLQHNLIRRAQHLSHLRRLVFLDLYANELEEISGLYNLRSLRVLMLGKNRIRKITSLESLTKLDVLDLHGNQIVRIENLSHLSELRVLNLAGNQITHVDSLRGLHSLAELNLRRNNISSMKEVDCLPSLQRLFLSYNNIANFDGIVCLREAPSLCEVALDGNPLAQEACYRQTALRHMGQLRQLDMKRVTEEERRLAS 255          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Sea Lamprey
Match: lrguk (leucine-rich repeats and guanylate kinase domain containing [Source:ZFIN;Acc:ZDB-GENE-050419-232])

HSP 1 Score: 56.225 bits (134), Expect = 1.146e-8
Identity = 53/170 (31.18%), Postives = 84/170 (49.41%), Query Frame = 1
Query:  265 LSYKNILEVDNLWWFKNLTKLQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLV---------------------NIEDLTLFNNRIKKMENLEHLKQLQVXXXXXXXXXXXXXXKYLRTFKSLKAINLSGNPCCEKDEFRVVVLAYLPQLIYLDYKLINEEER 711
             SY  I E+ ++  +K+LTKL LDNN I +I GL    SL +L L+ N I  ++G+ SL                       +E + L  N+I+ ++ LE   +LQ L +  N I +L  +KY++    L+ +NL  NP  E    R+  +  L  L+ LD + +  EE+
Sbjct:   96 FSYNTISEMKDMSVYKSLTKLVLDNNNISEIIGLEECGSLAYLSLAHNRIRRLDGLGSLPLRYLCLRGNHLRKITGLEKLWKLEKVDLSGNKIRSLKGLEGHYRLQELDMEGNQITELAEVKYIKDLSLLRVLNLLRNPVQESPGHRIAAVFQLQTLVDLDLRRVTVEEK 265          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Yeast
Match: LEA1 (Component of U2 snRNP complex; disruption causes reduced U2 snRNP levels; physically interacts with Msl1p; putative homolog of human U2A' snRNP protein [Source:SGD;Acc:S000006134])

HSP 1 Score: 54.6842 bits (130), Expect = 8.225e-9
Identity = 44/140 (31.43%), Postives = 67/140 (47.86%), Query Frame = 1
Query:  307 FKNLTK----LQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLVNIEDLTLFNNRIKKMENLEHLKQLQVXXXXXXXXXXXXXXKYLRTFKSLKAINLSGNPCCEKDEFRVVVLAYLPQLIYLDYKLINEEERK 714
             K+LTK    L L NN +  I  L+    +  L L  NNI  ++G    +N+++LTL NN I++ E+L+ L+                     R  ++LK + L GN  C    +R  VL  +P L  LD++ +  EERK
Sbjct:   47 LKHLTKPTHILDLTNNDLIMIPDLSRRDDIHTLLLGRNNIVEVDGRLLPMNVQNLTLSNNSIRRFEDLQRLR---------------------RAPRTLKNLTLIGNQVCHLANYREHVLRLVPHLETLDFQNVTAEERK 165          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Yeast
Match: SDS22 (Regulatory subunit of the type 1 protein phosphatase (PP1) Glc7p; whether it functions as a positive or negative regulator of Glc7p is controversial; involved in the regulation of Glc7p nuclear localization and function [Source:SGD;Acc:S000001676])

HSP 1 Score: 47.3654 bits (111), Expect = 3.437e-6
Identity = 38/104 (36.54%), Postives = 52/104 (50.00%), Query Frame = 1
Query:  283 LEVDNLWWFKNLTKLQLDNNIIEKIS-------------------------GLNHLISLKWLDLSFNNIEIIEGIDSLVNIEDLTLFNNRIKKMENLEHLKQLQ 519
            LE  NL+ FKNL +L L  N+IE IS                          +N L  L  LDLSFN I+ I+ +++L ++E+L    N I K+ENL  LK L+
Sbjct:   57 LEDLNLYRFKNLKQLCLRQNLIESISEVEVLPHDKIVDLDFYDNKIKHISSNVNKLTKLTSLDLSFNKIKHIKNLENLTDLENLYFVQNSISKIENLSTLKSLK 160          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Nematostella
Match: EDO38071 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDZ3])

HSP 1 Score: 390.963 bits (1003), Expect = 2.937e-131
Identity = 227/516 (43.99%), Postives = 333/516 (64.53%), Query Frame = 1
Query:  118 MSRLYDTIEPSVITEEMLRTTVYEQGPKGTAGQIAKAEGLSFEKVQSLRLSYKNILEVDNLWWFKNLTKLQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLVNIEDLTLFNNRIKKMENLEHLKQLQVXXXXXXXXXXXXXXKYLRTFKSLKAINLSGNPCCEKDEFRVVVLAYLPQLIYLDYKLINEEERKICCEKEQIRIESLQSDXXXXXXXXXXXXXXMNQEELYNLAFVDGLDKDQLFESLFSDDMEGQRLKELPKNAEHAEE--FRKKFSESCYGLFECGLQEHERRQEEVSAFYECLNDAKYSNKKSGMELINEFILYKRDVMNALGNDTNPNXXXXXXXXXXXXALQYNLMALELHLVDQIEELVGEFDRNLLDIVLKFKENVESYFGKCRELDVIYQSKVSEEALAIQEKINKGDPTDDISEDLRMILIDKDSMTNALSASKDAHMLKIDSKSDSISNRVQDWFKNLFDTIKTKEEIERNRSRVLEINLLIDNFNLELEN 1659
            MSRLYDTIEPSVI E ML+  V EQGPKG AG+IAK EG+ FE V +LRL +KNIL++DNLW F NLT LQLDNNIIEKI GL+ L++L+WLDLSFNNIE+IEG+D L  ++DLTL+NNRI K+EN++ L  L V SIGNN +  L+N+ YLR FK+L+ +NLS NP CE  +++  V+A+LP L+YLD++LI+E  R+   E+ +  IE +  DE   + + +EE+ +  +  L+  A+VD L+   L+ES+FS+D E  ++  LP   +  ++  F+ KF+  C  +FE GL+E ++R+EEV +F++CLN+AK  NK  G++ I ++I +K+                                          ++ + +F+R++ D+V  F EN+       R+L+ I+  +VS+ A+   EK+ K +  +D+ +DLRM+ +DKD++ NA+SAS D H+LKID+K D I  R     + L + I + +EI+RNR RV EIN LID+F  E E+
Sbjct:    1 MSRLYDTIEPSVIDEHMLKQAVEEQGPKGEAGRIAKQEGIDFENVLALRLDFKNILKIDNLWSFVNLTTLQLDNNIIEKIEGLDMLVNLQWLDLSFNNIEVIEGLDKLTKLKDLTLYNNRITKIENMDSLTNLHVFSIGNNSLKQLDNVIYLRRFKNLRTLNLSFNPFCEDSKYKEYVIAHLPDLVYLDFRLIDETAREAATERYKYSIEEMVHDETVAQKKQDEEEARNKERLLHKAAYVDELNGRALYESMFSEDPEVNKMSILPGMEDILKKYPFQNKFTAVCLEIFEFGLKESKKRKEEVDSFFQCLNEAKTDNKSEGVKHIQKYIDFKK------------------------------------------KDTIKDFERSMADMVTSFVENL-------RDLENIHNERVSDIAVVTLEKLMKNELEEDLPDDLRMLFVDKDTIMNAVSASHDTHLLKIDNKEDDIVTRANTTMQTLIENIHS-DEIKRNRDRVAEINNLIDHFRDEAES 466          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Nematostella
Match: EDO44937 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RU20])

HSP 1 Score: 66.2402 bits (160), Expect = 6.391e-12
Identity = 48/135 (35.56%), Postives = 78/135 (57.78%), Query Frame = 1
Query:  142 EPSVITEEMLRTTVYEQGPKG-----TAGQIAKAEGLSFEK---VQSLRLSYKNILEVDNLWWFKNLTKLQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLVNIEDLTLFNNRIKKMENLEHLKQLQV 522
            + SV+ E+     +    P+      T G+I K +  +FE+   V+SL L    I +++NL    +L +L   +N I KI  L+ L++L+ LDLSFN I++IE ++SL  +E L L  N+I ++E LEHL +L +
Sbjct:    9 DSSVMEEDSAEVRIVNLDPETEDVDLTHGRIDKIQ--NFERLRCVKSLCLRRNEIKKLENLETLTSLEELDFYDNQISKIENLDRLVNLRILDLSFNVIKVIENLNSLTKLEKLYLVQNKIGRIEGLEHLTELTM 141          

HSP 2 Score: 63.5438 bits (153), Expect = 4.655e-11
Identity = 59/179 (32.96%), Postives = 89/179 (49.72%), Query Frame = 1
Query:  160 EEMLRTTVYEQGPKGTAGQIAKAEGL-SFEKVQSLRLSYKNILEVDNLWWFKNLTKLQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLVNIEDLTLFNNRIKKMENLEHLKQLQVXXXXXXXXXXXXXXKYLRTFKSLKAINLSGNPCCEKDEFRVVVLAYLPQLIYLDYKL 693
            E +   T+ E G    A +I   EGL    K++SL +    I E+ NL    +L  L + +N I ++ GL HL SL+ L +S N IE I+G++SL  +  L L +NRIK++ N+ HL  L+     +N ++   +L  L     L  + L  NP      +R  V   LP L  +D  L
Sbjct:  134 EHLTELTMVELG----ANKIRVLEGLEHLTKLESLFVGKNKITELQNLSGLCSLKVLSIQSNRIVELKGLEHLDSLEELYISHNGIEEIKGLESLTKLNTLDLASNRIKRISNVGHLLNLEEFWFNDNQLEHWEDLDELAKCPKLHTVYLERNPLSRDTAYRRKVKLALPALKQIDATL 308          

HSP 3 Score: 54.299 bits (129), Expect = 4.513e-8
Identity = 38/104 (36.54%), Postives = 58/104 (55.77%), Query Frame = 1
Query:  214 QIAKAEGLS-FEKVQSLRLSYKNILEVDNLWWFKNLTKLQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLVNIEDLTLFNNRIKKMENLEHLKQLQV 522
            QI+K E L     ++ L LS+  I  ++NL     L KL L  N I +I GL HL  L  ++L  N I ++EG++ L  +E L +  N+I +++NL  L  L+V
Sbjct:   82 QISKIENLDRLVNLRILDLSFNVIKVIENLNSLTKLEKLYLVQNKIGRIEGLEHLTELTMVELGANKIRVLEGLEHLTKLESLFVGKNKITELQNLSGLCSLKV 185          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Nematostella
Match: EDO49856 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7REV6])

HSP 1 Score: 65.0846 bits (157), Expect = 1.896e-11
Identity = 58/180 (32.22%), Postives = 95/180 (52.78%), Query Frame = 1
Query:  184 YEQGPKGTAGQIAKAEGLSFEKVQSLRLSYKNILEVDNL--WWFKNLTKLQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLVNIEDLTLFNNRIKKMENL-EHLKQLQVXXXXXXXXXXXXXXKYLRTFKSLKAINLSGNPCCEKDEFRVVVLAYLPQLIYLDYKLINEEERK 714
            Y Q    T  +I   EG++   ++ L LS   I+EV  L       L  L+L  N +   +G+N L +L+ L L+ N I  +EG+D L ++  L L +N+I  +E   E++K LQ L++  N I     ++ L+    L+A+ L  NP  ++D++R+ VL  L +L  LD     E+ER+
Sbjct:  121 YLQIASFTQNKIMDTEGINHPLLEHLNLSMNEIVEVSGLDPGKLSRLAILELRGNKLMTTTGMN-LENLRELYLAANTIRKVEGLDRLEHLTKLHLRDNQIDSLEGFSENMKNLQYLNLRGNSISSNKEVQKLKCLPLLRALVLMENPVSDEDDYRIEVLIALRRLERLDKDEYTEDERQ 299          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Nematostella
Match: EDO45771 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSA0])

HSP 1 Score: 62.7734 bits (151), Expect = 2.453e-10
Identity = 55/170 (32.35%), Postives = 85/170 (50.00%), Query Frame = 1
Query:  214 QIAKAEGLS-FEKVQSLRLSYKNILEVDNLWWFKNLTKLQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLVNIEDLTLFNNRIKKMENLEHLKQLQVXXXXXXXXXXXXXXKYLRTFKSLKAINLSGNPCCEKDEFRVVVLAYLPQLIYLDYKLINEEERKIC 720
            QI +  GLS  + ++ L L    I +++NL     L  L L  N I KI  L+HL  L+ L+L+ N I  +  I  + ++ +L L  N+I  +E ++ L  LQ L +  N I    ++  L    S+  ++L GNP      ++  VL  +  L  LD K I EEER+I 
Sbjct:   82 QIEEISGLSSLKSLRVLMLGKNRIRKINNLEALTKLDVLDLHGNRISKIENLSHLTELRVLNLAGNEILKVCNISGMRSLAELNLRRNKICTVEEVDRLSNLQRLFLSFNCISRFEDINCLTRSTSITELSLDGNPFASDVTYKQTVLKSVTCLRQLDMKRITEEERRIA 251          

HSP 2 Score: 53.5286 bits (127), Expect = 1.880e-7
Identity = 57/161 (35.40%), Postives = 85/161 (52.80%), Query Frame = 1
Query:  280 ILEVDNLWWFKNLTKLQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLVNIEDLTLFNNRIKKMENLEHLKQLQVXXXXXXXXXXXXXXKYLRTFKSLKAINLSGNPCCEKDEFRVVVLAYLPQLIYLDYKLINEEERKICCEKEQIRIESLQSD 762
            I  + +L   + L  L + +N IE+ISGL+ L SL+ L L  N I  I  +++L  ++ L L  NRI K+ENL HL +L+VL++  N I  + N+  +R   SL  +NL  N  C  +E  V  L+ L Q ++L +  I+  E  I C      I  L  D
Sbjct:   61 IRNIQHLANLRRLIFLDIYDNQIEEISGLSSLKSLRVLMLGKNRIRKINNLEALTKLDVLDLHGNRISKIENLSHLTELRVLNLAGNEILKVCNISGMR---SLAELNLRRNKICTVEE--VDRLSNL-QRLFLSFNCISRFE-DINCLTRSTSITELSLD 214          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Nematostella
Match: EDO47417 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLZ8])

HSP 1 Score: 56.225 bits (134), Expect = 6.885e-9
Identity = 52/177 (29.38%), Postives = 81/177 (45.76%), Query Frame = 1
Query:  277 NILEVDNLWWFKNLTKLQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLVNIEDLT------------LFN------------------NRIKKMENLEHLKQL-QVXXXXXXXXXXXXXXKYLRTFKSLKAINLSGNPCCEKDEFRVVVLAYLPQLIYLDYKLINEEERK 714
            NI ++ NL +  NLT L L NN I +I GL+H   L  L L  N+I +IEG+D L N+ +L             LF+                  N I  ++ L+ L  + Q  +  N L D     + +  +  L  + +SGNP C+K ++R  ++     L+ LD K IN   ++
Sbjct:   62 NISKIKNLGFAGNLTHLYLQNNKISRIEGLDHCRRLSKLYLGGNSITVIEGLDKLENLRELHMEKQHLPPGEKLLFDPRTLQALSKCLCVLNISENNIDSIDELQCLTNMTQFFTEHNLLADMKELSRVMAAWPYLWRLEVSGNPLCQKKKYRDRIIVMSNSLVMLDGKEINATAKR 238          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Medaka
Match: drc3 (dynein regulatory complex subunit 3 [Source:NCBI gene;Acc:101162841])

HSP 1 Score: 189.504 bits (480), Expect = 3.982e-53
Identity = 147/510 (28.82%), Postives = 268/510 (52.55%), Query Frame = 1
Query:  145 PSVITEEMLRTTVYEQGPKGTAGQIAKAEGLSFEKVQSLRLSYKNILEVDNLWWFKNLTKLQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLVNIEDLTLFNNRIKKMENLEHLKQLQVXXXXXXXXXXXXXXKYLRTFKSLKAINLSGNPCCEKDEFRVVVLAYLPQLIYLDYKLINEEERKICCEKEQIRIESLQSDXXXXXXXXXXXXXXMNQEELYNLAFVDGLDKDQLFESLFSDDMEGQRLKELPKNAEHAEEFRKKFSESCYGLFECGLQEHERRQEEVSAFYECLNDAKYSNKKSGMELINEFILYKRDVMNALGNDT--NPNXXXXXXXXXXXXALQYNLMALELHLVDQIEELVGEFDRNLLDIVLKFKENVESYFGKCRELDVIYQSKVSEEALAIQEKINKGDPTDDISEDLRMILIDKDSMTNALSASKDAHMLKIDSKSDSISNRVQDW----FKNLFDTIKTKEEIERNRSRVLEINLLIDNFNLELE 1656
            P+ +  EM++  + +   K     ++K + +   +   ++L Y+NI  +D+L  + +L +L L+NN+I+KI GL+ LI+L WL+LSFN IE I+G+ SL  ++ L L NN+I  +EN++ L  L    IG NL++ L N+ YL+ FK L  I + GN    +D+++  ++A+ P L  LD KLI +E ++    K Q  IE    +E +K++  E  + +  +  L+  AFV+ LD   LF+S+F +D      + +P   +  + F  +    C  LF+ GL E E+R+ E+ +F    ++ +   K   ++++ +F    ++ +  L   T  N   +      +++  L   LM LE  L+ ++EE +   +  + D V  F E  +  F +CR L+  +  KV E   A  E + KG   +++  D++M+  DK  + +AL+ +   H+L ++ +   +   V  W    FK++ D +      ++NR+R+ +I+   D    +LE
Sbjct:    5 PNRMNREMIQNAIEKNSIKSDL--MSKEDNICLPEADVIKLEYQNIQRIDSLQEYTSLVRLDLNNNLIKKIQGLDSLINLTWLNLSFNRIEKIQGLTSLQKLKVLNLSNNQITVIENMDTLDNLTHFFIGCNLLNQLENVLYLKRFKKLVHIYMKGNLFSNEDDYQFFIVAFFPNLTVLDNKLILQELKEKASSKYQDDIEKRNQEESQKQLAEEVLQKQEAELNLHKEAFVEYLDGPHLFKSMFDEDTFSSDRRSVPGIEDLLQSFENQMVGLCKQLFDRGLAEREQRERELKSFSSSQDEVETHYKNQAIQVLEDFNRQHKERIKKLEQLTLRNSVSEELSRGYDEINKLSERLMTLEFKLISKLEENIRNVETCISDKVTDFIEIAQETFTECRNLEDDFHHKVQEIIDATLENVAKGSQVENLPHDVKMLFTDKIKVMHALNTNHKLHLLTLNDREQKLLTSVSSWKIAFFKDVHDKV-----TQQNRTRISDIHRYADFLRKQLE 507          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Medaka
Match: drc3 (dynein regulatory complex subunit 3 [Source:NCBI gene;Acc:101162841])

HSP 1 Score: 107.071 bits (266), Expect = 2.070e-24
Identity = 91/278 (32.73%), Postives = 155/278 (55.76%), Query Frame = 1
Query:  265 LSYKNILEVDNLWWFKNLTKLQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLVNIEDLTLFNNRIKKMENLEHLKQLQVXXXXXXXXXXXXXXKYLRTFKSLKAINLSGNPCCEKDEFRVVVLAYLPQLIYLDYKLINEEERKICCEKEQIRIESLQSDXXXXXXXXXXXXXXMNQEELYNLAFVDGLDKDQLFESLFSDDMEGQRLKELPKNAEHAEEFRKKFSESCYGLFECGLQEHERRQEEVSAFYECLNDAKYSNKKSGMELINEF 1098
            + + +I  +D+L  + +L +L L+NN+I+KI GL+ LI+L WL+LSFN IE I+G+ SL  ++ L L NN+I  +EN++ L  L    IG NL++ L N+ YL+ FK L  I + GN    +D+++  ++A+ P L  LD KLI +E   +   K Q  IE    +E +K++  E  +    QEE    AFV+ LD   LF+S+F +D      + +P   +  + +   F  S   +    L + E+R+ E+ +F    ++ +   K   ++++ +F
Sbjct:   31 ICFADIQRIDSLQEYTSLVRLDLNNNLIKKIQGLDSLINLTWLNLSFNRIEKIQGLTSLQKLKVLNLSNNQITVIENMDTLDNLTHFFIGCNLLNQLENVLYLKRFKKLVHIYMKGNLFSNEDDYQFFIVAFFPNLTVLDNKLILQE---LASSKYQDDIEKRNQEESQKQLAEEVLQK---QEE----AFVEYLDGPHLFKSMFDEDTFSSDRRSVPGIEDLLQSY-PLFRFSNTQIDHSLLNKREQRERELKSFSSSQDEVETHYKNQAIQVLEDF 297          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Medaka
Match: ppp1r7 (protein phosphatase 1 regulatory subunit 7 [Source:NCBI gene;Acc:101158055])

HSP 1 Score: 74.7146 bits (182), Expect = 3.475e-14
Identity = 56/160 (35.00%), Postives = 93/160 (58.13%), Query Frame = 1
Query:  217 IAKAEGLSFEKVQSLRLSYKNILEVDNLWWFKNLTKLQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLVNIEDLTLFNNRIKKMENLEHLKQLQVXXXXXXXXXXXXXXKYLRTFKSLKAINLSGNPCCEKDEFRVVVLAYLPQLIYLDYKLI 696
            I   +GL+   + SL L    I ++ NL    NL+ L + +N I KI GL +L++LK L LS N IE+IEG+++   +  L +  NR+KK+EN+ HL +LQ   + +N I++ ++L  L+  KSL+ + L  NP  +  ++R  ++  LP +  +D   I
Sbjct:  187 IENLDGLT--SLTSLFLGTNKINKLQNLDALHNLSVLSIQSNRITKIEGLQNLVNLKELYLSHNGIEVIEGLENNKKLTTLDIAANRVKKIENISHLTELQEFWMNDNQIENWSDLDELKNAKSLETVYLERNPLQKDPQYRRKIMLALPSVRQIDATFI 344          

HSP 2 Score: 53.9138 bits (128), Expect = 1.840e-7
Identity = 37/104 (35.58%), Postives = 62/104 (59.62%), Query Frame = 1
Query:  214 QIAKAEGLS-FEKVQSLRLSYKNILEVDNLWWFKNLTKLQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLVNIEDLTLFNNRIKKMENLEHLKQLQV 522
            +I K EGL   +K ++L L    I +++NL    +L +L L +N I K+  L++L  L+ LD+SFN +  IE ++ L  ++ L L +N+I  + NLEH   L++
Sbjct:   73 RIGKIEGLEVLQKAKTLSLRQNLIKKIENLESLSSLRELDLYDNQIRKLENLDNLTELEQLDVSFNILRKIENLERLTQLKKLFLVHNKITGIANLEHFSFLEM 176          

HSP 3 Score: 51.9878 bits (123), Expect = 8.240e-7
Identity = 37/104 (35.58%), Postives = 59/104 (56.73%), Query Frame = 1
Query:  214 QIAKAEGL-SFEKVQSLRLSYKNILEVDNLWWFKNLTKLQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLVNIEDLTLFNNRIKKMENLEHLKQLQV 522
            QI K E L +  +++ L +S+  + +++NL     L KL L +N I  I+ L H   L+ L+L  N I +IE +D L ++  L L  N+I K++NL+ L  L V
Sbjct:  117 QIRKLENLDNLTELEQLDVSFNILRKIENLERLTQLKKLFLVHNKITGIANLEHFSFLEMLELGSNRIRVIENLDGLTSLTSLFLGTNKINKLQNLDALHNLSV 220          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Medaka
Match: ppp1r7 (protein phosphatase 1 regulatory subunit 7 [Source:NCBI gene;Acc:101158055])

HSP 1 Score: 72.7886 bits (177), Expect = 2.285e-13
Identity = 56/160 (35.00%), Postives = 93/160 (58.13%), Query Frame = 1
Query:  217 IAKAEGLSFEKVQSLRLSYKNILEVDNLWWFKNLTKLQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLVNIEDLTLFNNRIKKMENLEHLKQLQVXXXXXXXXXXXXXXKYLRTFKSLKAINLSGNPCCEKDEFRVVVLAYLPQLIYLDYKLI 696
            I   +GL+   + SL L    I ++ NL    NL+ L + +N I KI GL +L++LK L LS N IE+IEG+++   +  L +  NR+KK+EN+ HL +LQ   + +N I++ ++L  L+  KSL+ + L  NP  +  ++R  ++  LP +  +D   I
Sbjct:  226 IENLDGLT--SLTSLFLGTNKINKLQNLDALHNLSVLSIQSNRITKIEGLQNLVNLKELYLSHNGIEVIEGLENNKKLTTLDIAANRVKKIENISHLTELQEFWMNDNQIENWSDLDELKNAKSLETVYLERNPLQKDPQYRRKIMLALPSVRQIDATFI 383          

HSP 2 Score: 53.5286 bits (127), Expect = 3.413e-7
Identity = 37/104 (35.58%), Postives = 62/104 (59.62%), Query Frame = 1
Query:  214 QIAKAEGLS-FEKVQSLRLSYKNILEVDNLWWFKNLTKLQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLVNIEDLTLFNNRIKKMENLEHLKQLQV 522
            +I K EGL   +K ++L L    I +++NL    +L +L L +N I K+  L++L  L+ LD+SFN +  IE ++ L  ++ L L +N+I  + NLEH   L++
Sbjct:  112 RIGKIEGLEVLQKAKTLSLRQNLIKKIENLESLSSLRELDLYDNQIRKLENLDNLTELEQLDVSFNILRKIENLERLTQLKKLFLVHNKITGIANLEHFSFLEM 215          

HSP 3 Score: 51.9878 bits (123), Expect = 1.109e-6
Identity = 37/104 (35.58%), Postives = 59/104 (56.73%), Query Frame = 1
Query:  214 QIAKAEGL-SFEKVQSLRLSYKNILEVDNLWWFKNLTKLQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLVNIEDLTLFNNRIKKMENLEHLKQLQV 522
            QI K E L +  +++ L +S+  + +++NL     L KL L +N I  I+ L H   L+ L+L  N I +IE +D L ++  L L  N+I K++NL+ L  L V
Sbjct:  156 QIRKLENLDNLTELEQLDVSFNILRKIENLERLTQLKKLFLVHNKITGIANLEHFSFLEMLELGSNRIRVIENLDGLTSLTSLFLGTNKINKLQNLDALHNLSV 259          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Medaka
Match: lrrc6 (leucine rich repeat containing 6 [Source:NCBI gene;Acc:101163520])

HSP 1 Score: 68.5514 bits (166), Expect = 7.061e-12
Identity = 57/194 (29.38%), Postives = 86/194 (44.33%), Query Frame = 1
Query:  181 VYEQGPKGTAGQIAKAEGL-----------------SFEKVQSLRLSYKNILEVDNLWWFKNLTKLQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLVNIEDLTLFNNRIKKMENLEHLKQLQVXXXXXXXXXXXXXXKYLRTFKSLKAINLSGNPCCEKDEFRVVVLAYLPQLIYLDYKLINEEER 711
            V E GP   AG+ AK   L                 S E++   +L  + I  +D   W   L  L L NN+I +I  L HL  L++L+L+ NNIE+IE ++   +++ L L  N +  + +++                       LR    L+ + L GNPC   + +R  V+A LPQL  LD   I+  ER
Sbjct:   32 VEEPGP---AGEEAKGNSLTEDLIRRRAEHNDSELFSLEELSLHQLDIEKIEHIDR--WCSKLVILYLQNNLIPRIENLGHLKRLQYLNLALNNIEVIENLEGCESLQKLDLMVNFVGHLSSVD----------------------SLRHNIHLRDLCLMGNPCSRFEGYRQYVVAALPQLQCLDGTEISRSER 198          
BLAST of Dynein regulatory complex subunit 3 vs. Planmine SMEST
Match: SMESG000047633.1 (SMESG000047633.1)

HSP 1 Score: 490.73 bits (1262), Expect = 7.880e-173
Identity = 275/276 (99.64%), Postives = 276/276 (100.00%), Query Frame = 1
Query:  118 MSRLYDTIEPSVITEEMLRTTVYEQGPKGTAGQIAKAEGLSFEKVQSLRLSYKNILEVDNLWWFKNLTKLQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLVNIEDLTLFNNRIKKMENLEHLKQLQVXXXXXXXXXXXXXXKYLRTFKSLKAINLSGNPCCEKDEFRVVVLAYLPQLIYLDYKLINEEERKICCEKEQIRIESLQSDXXXXXXXXXXXXXXMNQEELYNLAFVDGLDKDQLFESLFSDDMEGQRLKELPKNAEHAEEF 945
            MSRLYDTIEPSVITEEMLRTTVYEQGPKGTAGQIAKAEGLSFEKVQSLRLSYKNILEVDNLWWFKNLTKLQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLVNIEDLTLFNNRIKKMENLEHLKQLQVLSIGNNLIDDLNNLKYLRTFKSLKAINLSGNPCCEKDEFRVVVLAYLPQLIYLDYKLINEEERKICCEKEQIRIESLQSDEKEKEIQMEEEKLKMNQEELYNLAFVDGLDKDQLFESLFSDDMEGQRLKELPKNAEHAEE+
Sbjct:    1 MSRLYDTIEPSVITEEMLRTTVYEQGPKGTAGQIAKAEGLSFEKVQSLRLSYKNILEVDNLWWFKNLTKLQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLVNIEDLTLFNNRIKKMENLEHLKQLQVLSIGNNLIDDLNNLKYLRTFKSLKAINLSGNPCCEKDEFRVVVLAYLPQLIYLDYKLINEEERKICCEKEQIRIESLQSDEKEKEIQMEEEKLKMNQEELYNLAFVDGLDKDQLFESLFSDDMEGQRLKELPKNAEHAEEY 276          
BLAST of Dynein regulatory complex subunit 3 vs. Planmine SMEST
Match: SMESG000047632.1 (SMESG000047632.1)

HSP 1 Score: 369.777 bits (948), Expect = 1.009e-126
Identity = 200/200 (100.00%), Postives = 200/200 (100.00%), Query Frame = 1
Query: 1078 MELINEFILYKRDVMNALGNDTNPNXXXXXXXXXXXXALQYNLMALELHLVDQIEELVGEFDRNLLDIVLKFKENVESYFGKCRELDVIYQSKVSEEALAIQEKINKGDPTDDISEDLRMILIDKDSMTNALSASKDAHMLKIDSKSDSISNRVQDWFKNLFDTIKTKEEIERNRSRVLEINLLIDNFNLELENLDYQIN 1677
            MELINEFILYKRDVMNALGNDTNPNEKLKEEYKEKVKALQYNLMALELHLVDQIEELVGEFDRNLLDIVLKFKENVESYFGKCRELDVIYQSKVSEEALAIQEKINKGDPTDDISEDLRMILIDKDSMTNALSASKDAHMLKIDSKSDSISNRVQDWFKNLFDTIKTKEEIERNRSRVLEINLLIDNFNLELENLDYQIN
Sbjct:    1 MELINEFILYKRDVMNALGNDTNPNEKLKEEYKEKVKALQYNLMALELHLVDQIEELVGEFDRNLLDIVLKFKENVESYFGKCRELDVIYQSKVSEEALAIQEKINKGDPTDDISEDLRMILIDKDSMTNALSASKDAHMLKIDSKSDSISNRVQDWFKNLFDTIKTKEEIERNRSRVLEINLLIDNFNLELENLDYQIN 200          
BLAST of Dynein regulatory complex subunit 3 vs. Planmine SMEST
Match: SMESG000061668.1 (SMESG000061668.1)

HSP 1 Score: 242.662 bits (618), Expect = 1.957e-75
Identity = 131/263 (49.81%), Postives = 190/263 (72.24%), Query Frame = 1
Query:  118 MSRLYDTIEPSVITEEMLRTTVYEQGPKGTAGQIAKAEGLSFEKVQSLRLSYKNILEVDNLWWFKNLTKLQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLVNIEDLTLFNNRIKKMENLEHLKQLQVXXXXXXXXXXXXXXKYLRTFKSLKAINLSGNPCCEKDEFRVVVLAYLPQLIYLDYKLINEEERKICCEKEQIRIESLQSDXXXXXXXXXXXXXXMNQEELYNLAFVDGLDKDQLFESLFSDDMEGQRL 906
            M RLY+T+EP++I+ ++L   VYEQGPK  AG+IAK EG++F  V SLRL +KNIL+++NLW FK+LTKLQL NNIIEKI  L+ L+ L+WLDLSFN IE+IEG+++LV + DL+L+ NRI  +EN+++LK+L V S G NL+  + N+ YLR FK L+++NLSGNP C  DE+   + A+ P L++LDYKL+ + E + C EK  IR+E  +  E+E E +  +EK  +   +++ LAFV+ LD D L+  +  DD E +++
Sbjct:   20 MKRLYNTLEPNIISNKLLTQVVYEQGPKDEAGKIAKTEGIAFSTVLSLRLDFKNILKINNLWAFKSLTKLQLVNNIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNLKELNVFSFGKNLLTSIENVLYLRKFKKLQSLNLSGNPICHSDEYFSFIFAFFPNLMFLDYKLVTKMEHQACYEKYLIRVEQYKEKEEEIEKKELDEKNLLESRKVHTLAFVELLDTDLLYNQMIHDDPEKEKI 282          
BLAST of Dynein regulatory complex subunit 3 vs. Planmine SMEST
Match: SMESG000061669.1 (SMESG000061669.1)

HSP 1 Score: 78.1814 bits (191), Expect = 4.416e-16
Identity = 45/122 (36.89%), Postives = 73/122 (59.84%), Query Frame = 1
Query:  976 LFECGLQEHERRQEEVSAFYECLNDAKYSNKKSGMELINEFILYKRDVMNALGNDTNPNXXXXXXXXXXXXALQYNLMALELHLVDQIEELVGEFDRNLLDIVLKFKENVESYFGKCRELDV 1341
            LF  GL E E+RQ + + FY C+N AK  N +  ++L+ EF ++K ++M  +      +E   ++ KE    L  NLM+LE+ L DQ+EE + ++ RNL +++  F E V +YF + REL+ 
Sbjct:    7 LFHKGLNELEKRQRDGTLFYTCINAAKSDNNQRAIDLLEEFNIFKVEIMQEINKSAVISENDMKKLKEMTYDLWSNLMSLEVQLFDQLEETIRDYLRNLTEMIDGFLEIVHAYFAQMRELET 128          
BLAST of Dynein regulatory complex subunit 3 vs. Planmine SMEST
Match: SMESG000061669.1 (SMESG000061669.1)

HSP 1 Score: 78.1814 bits (191), Expect = 6.085e-16
Identity = 47/133 (35.34%), Postives = 77/133 (57.89%), Query Frame = 1
Query:  943 FRKKFSESCYGLFECGLQEHERRQEEVSAFYECLNDAKYSNKKSGMELINEFILYKRDVMNALGNDTNPNXXXXXXXXXXXXALQYNLMALELHLVDQIEELVGEFDRNLLDIVLKFKENVESYFGKCRELDV 1341
            + +KF      LF  GL E E+RQ + + FY C+N AK  N +  ++L+ EF ++K ++M  +      +E   ++ KE    L  NLM+LE+ L DQ+EE + ++ RNL +++  F E V +YF + REL+ 
Sbjct:   17 YLEKFMFISTELFHKGLNELEKRQRDGTLFYTCINAAKSDNNQRAIDLLEEFNIFKVEIMQEINKSAVISENDMKKLKEMTYDLWSNLMSLEVQLFDQLEETIRDYLRNLTEMIDGFLEIVHAYFAQMRELET 149          
The following BLAST results are available for this feature:
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DRC31.626e-12643.24dynein regulatory complex subunit 3 [Source:HGNC S... [more]
DRC31.626e-12643.24dynein regulatory complex subunit 3 [Source:HGNC S... [more]
DRC31.174e-10142.63dynein regulatory complex subunit 3 [Source:HGNC S... [more]
DRC31.174e-10142.63dynein regulatory complex subunit 3 [Source:HGNC S... [more]
DRC31.219e-4759.26dynein regulatory complex subunit 3 [Source:HGNC S... [more]
back to top
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
sds-224.205e-937.74Protein phosphatase 1 regulatory subunit SDS22 hom... [more]
C06A8.65.476e-939.05pep chromosome:WBcel235:II:7772499:7773914:1 gene:... [more]
K10D2.81.122e-838.10pep chromosome:WBcel235:III:5188726:5190175:1 gene... [more]
back to top
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ppr-Y7.218e-6130.62gene:FBgn0046697 transcript:FBtr0346721[more]
TbCMF462.371e-5830.25gene:FBgn0032163 transcript:FBtr0079898[more]
sds226.619e-938.46gene:FBgn0028992 transcript:FBtr0083436[more]
CG108391.455e-829.79gene:FBgn0028858 transcript:FBtr0343725[more]
CG108391.455e-829.79gene:FBgn0028858 transcript:FBtr0305563[more]
back to top
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
drc33.569e-11640.86dynein regulatory complex subunit 3 [Source:ZFIN;A... [more]
ppp1r74.851e-1233.81protein phosphatase 1, regulatory (inhibitor) subu... [more]
lrrc65.068e-1230.06leucine rich repeat containing 6 [Source:NCBI gene... [more]
lrrc65.068e-1230.06leucine rich repeat containing 6 [Source:NCBI gene... [more]
lrrc65.068e-1230.06leucine rich repeat containing 6 [Source:NCBI gene... [more]
back to top
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
drc34.146e-13544.72dynein regulatory complex subunit 3 [Source:NCBI g... [more]
drc35.752e-12643.65dynein regulatory complex subunit 3 [Source:NCBI g... [more]
rbpms23.101e-1334.32RNA binding protein with multiple splicing 2 [Sour... [more]
rbpms25.088e-1334.32RNA binding protein with multiple splicing 2 [Sour... [more]
rbpms26.613e-1334.32RNA binding protein with multiple splicing 2 [Sour... [more]
back to top
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Drc33.753e-12743.63dynein regulatory complex subunit 3 [Source:MGI Sy... [more]
Drc34.226e-12743.63dynein regulatory complex subunit 3 [Source:MGI Sy... [more]
Drc31.598e-7549.28dynein regulatory complex subunit 3 [Source:MGI Sy... [more]
Drc39.495e-6652.88dynein regulatory complex subunit 3 [Source:MGI Sy... [more]
Ppp1r73.163e-1334.90protein phosphatase 1, regulatory subunit 7 [Sourc... [more]
back to top
BLAST of Dynein regulatory complex subunit 3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q4R6X9|DRC3_MACFA7.521e-12843.74Dynein regulatory complex subunit 3 OS=Macaca fasc... [more]
sp|Q5XI54|DRC3_RAT9.617e-12744.21Dynein regulatory complex subunit 3 OS=Rattus norv... [more]
sp|Q9D5E4|DRC3_MOUSE2.625e-12643.63Dynein regulatory complex subunit 3 OS=Mus musculu... [more]
sp|Q9H069|DRC3_HUMAN7.810e-12643.24Dynein regulatory complex subunit 3 OS=Homo sapien... [more]
sp|A8IVX2|DRC3_CHLRE1.192e-6634.65Dynein regulatory complex subunit 3 OS=Chlamydomon... [more]
back to top
BLAST of Dynein regulatory complex subunit 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
D1LX593.953e-14749.42LRRC48-like protein OS=Saccoglossus kowalevskii OX... [more]
A0A210QM466.416e-14646.33Leucine-rich repeat-containing protein 48 OS=Mizuh... [more]
A0A1S3I9V22.287e-14446.38dynein regulatory complex subunit 3-like OS=Lingul... [more]
A0A2T7PVG32.978e-14445.66Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A267DEL03.582e-14448.65Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
drc37.049e-10938.91dynein regulatory complex subunit 3 [Source:ZFIN;A... [more]
drc32.892e-10137.52dynein regulatory complex subunit 3 [Source:ZFIN;A... [more]
ENSAMXT00000057771.11.533e-1530.99pep primary_assembly:Astyanax_mexicanus-2.0:24:381... [more]
ppp1r71.766e-1333.33protein phosphatase 1 regulatory subunit 7 [Source... [more]
lrrc64.835e-1132.35leucine rich repeat containing 6 [Source:NCBI gene... [more]
back to top
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000007158.12.141e-4637.96pep scaffold:Pmarinus_7.0:GL477065:91521:97732:-1 ... [more]
ppp1r74.953e-1231.54protein phosphatase 1, regulatory (inhibitor) subu... [more]
lrrc61.457e-1126.88leucine rich repeat containing 6 [Source:NCBI gene... [more]
LRRC495.989e-927.94leucine rich repeat containing 49 [Source:HGNC Sym... [more]
lrguk1.146e-831.18leucine-rich repeats and guanylate kinase domain c... [more]
back to top
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
LEA18.225e-931.43Component of U2 snRNP complex; disruption causes r... [more]
SDS223.437e-636.54Regulatory subunit of the type 1 protein phosphata... [more]
back to top
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO380712.937e-13143.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO449376.391e-1235.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO498561.896e-1132.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO457712.453e-1032.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO474176.885e-929.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
drc33.982e-5328.82dynein regulatory complex subunit 3 [Source:NCBI g... [more]
drc32.070e-2432.73dynein regulatory complex subunit 3 [Source:NCBI g... [more]
ppp1r73.475e-1435.00protein phosphatase 1 regulatory subunit 7 [Source... [more]
ppp1r72.285e-1335.00protein phosphatase 1 regulatory subunit 7 [Source... [more]
lrrc67.061e-1229.38leucine rich repeat containing 6 [Source:NCBI gene... [more]
back to top
BLAST of Dynein regulatory complex subunit 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000047633.17.880e-17399.64SMESG000047633.1[more]
SMESG000047632.11.009e-126100.00SMESG000047632.1[more]
SMESG000061668.11.957e-7549.81SMESG000061668.1[more]
SMESG000061669.14.416e-1636.89SMESG000061669.1[more]
SMESG000061669.16.085e-1635.34SMESG000061669.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024663 ID=SMED30024663|Name=Dynein regulatory complex subunit 3|organism=Schmidtea mediterranea sexual|type=transcript|length=1680bp
GTTCTTCCTAAAATTTTTACTCTTTCATTTTCATATCCAAAATGAACTTT
GTTTAAATAATAAAGTTATCATAGCAACCTTGTGGCACACATTTAAAAAC
AATCATAAAATCGTTTAATGAGTCGTTTATATGATACAATCGAACCTTCA
GTTATTACTGAAGAGATGCTTAGGACGACTGTTTATGAACAAGGTCCAAA
AGGCACTGCTGGTCAAATAGCAAAAGCCGAAGGTTTGTCATTTGAAAAAG
TTCAAAGTTTAAGACTTAGTTATAAAAATATTTTGGAAGTCGATAATTTA
TGGTGGTTCAAAAATCTAACCAAATTACAATTGGATAATAATATTATAGA
AAAGATTTCCGGTTTAAATCATTTAATCAGCTTAAAATGGCTAGATCTCT
CATTCAACAACATAGAAATTATTGAAGGAATTGACTCCCTTGTAAACATT
GAGGATTTGACCTTGTTCAATAATCGAATTAAAAAAATGGAAAATTTAGA
ACATTTAAAACAATTACAAGTGCTGTCAATTGGTAACAATTTGATAGATG
ATTTAAACAATCTAAAATATCTACGAACTTTCAAAAGTCTCAAAGCAATA
AATCTATCGGGCAATCCTTGTTGTGAGAAGGACGAATTTCGGGTTGTCGT
ACTCGCTTATTTACCGCAGTTAATTTATCTGGATTATAAATTAATAAATG
AAGAAGAAAGAAAAATATGTTGTGAAAAAGAACAAATTCGAATAGAATCT
CTACAATCTGATGAAAAGGAAAAAGAAATACAGATGGAAGAGGAAAAACT
CAAAATGAACCAAGAAGAGTTATATAATTTAGCATTTGTCGATGGGCTGG
ATAAAGATCAACTTTTTGAGTCACTCTTTTCTGACGATATGGAAGGTCAG
CGATTGAAAGAATTGCCGAAAAACGCTGAACACGCTGAAGAGTTTCGGAA
AAAATTTTCTGAATCTTGTTATGGTTTATTTGAATGTGGTCTTCAAGAAC
ATGAACGAAGACAAGAAGAAGTTTCAGCATTTTATGAATGTTTAAATGAT
GCCAAATATAGCAACAAAAAGAGCGGGATGGAATTAATTAATGAATTTAT
TTTATATAAAAGAGATGTTATGAACGCGTTGGGAAATGACACAAATCCCA
ATGAGAAACTAAAGGAAGAGTATAAAGAAAAGGTCAAAGCATTGCAGTAT
AATTTAATGGCTCTGGAATTACATTTAGTAGATCAAATTGAAGAATTAGT
CGGAGAATTTGATAGAAATTTATTAGACATAGTTCTTAAATTTAAAGAAA
ATGTCGAATCTTATTTTGGAAAATGCCGAGAACTTGATGTCATTTACCAA
TCGAAAGTTTCAGAAGAAGCGTTAGCTATACAAGAGAAAATAAACAAAGG
AGATCCGACTGACGATATTTCTGAAGACTTAAGGATGATTTTGATTGATA
AAGATTCTATGACAAATGCGTTGTCGGCTTCTAAAGATGCTCATATGTTG
AAAATTGATTCGAAGAGCGATTCTATCAGCAATCGAGTACAGGATTGGTT
TAAAAACCTTTTTGATACCATTAAAACAAAAGAAGAAATTGAAAGAAATA
GATCTCGAGTTTTGGAAATAAATCTTCTTATAGATAACTTTAATTTGGAA
TTAGAAAATCTTGACTATCAAATAAATTAG
back to top

protein sequence of SMED30024663-orf-1

>SMED30024663-orf-1 ID=SMED30024663-orf-1|Name=SMED30024663-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=521bp
MSRLYDTIEPSVITEEMLRTTVYEQGPKGTAGQIAKAEGLSFEKVQSLRL
SYKNILEVDNLWWFKNLTKLQLDNNIIEKISGLNHLISLKWLDLSFNNIE
IIEGIDSLVNIEDLTLFNNRIKKMENLEHLKQLQVLSIGNNLIDDLNNLK
YLRTFKSLKAINLSGNPCCEKDEFRVVVLAYLPQLIYLDYKLINEEERKI
CCEKEQIRIESLQSDEKEKEIQMEEEKLKMNQEELYNLAFVDGLDKDQLF
ESLFSDDMEGQRLKELPKNAEHAEEFRKKFSESCYGLFECGLQEHERRQE
EVSAFYECLNDAKYSNKKSGMELINEFILYKRDVMNALGNDTNPNEKLKE
EYKEKVKALQYNLMALELHLVDQIEELVGEFDRNLLDIVLKFKENVESYF
GKCRELDVIYQSKVSEEALAIQEKINKGDPTDDISEDLRMILIDKDSMTN
ALSASKDAHMLKIDSKSDSISNRVQDWFKNLFDTIKTKEEIERNRSRVLE
INLLIDNFNLELENLDYQIN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005929cilium
GO:0031514motile cilium
GO:0005737cytoplasm
GO:0005856cytoskeleton
GO:0042995cell projection
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR032675LRR_dom_sf
IPR001611Leu-rich_rpt
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 202..234
NoneNo IPR availableCOILSCoilCoilcoord: 349..369
NoneNo IPR availableSMARTSM00365LRR_sd22_2coord: 64..85
e-value: 2.2
score: 17.3
coord: 86..107
e-value: 1.4
score: 17.9
coord: 130..148
e-value: 95.0
score: 7.6
coord: 108..129
e-value: 0.24
score: 20.5
NoneNo IPR availablePFAMPF14580LRR_9coord: 92..201
e-value: 1.8E-14
score: 53.6
NoneNo IPR availablePANTHERPTHR45973FAMILY NOT NAMEDcoord: 1..518
NoneNo IPR availablePANTHERPTHR45973:SF12DYNEIN REGULATORY COMPLEX SUBUNIT 3coord: 1..518
NoneNo IPR availableSUPERFAMILYSSF52075Outer arm dynein light chain 1coord: 42..200
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 33..202
e-value: 3.2E-34
score: 119.5
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 88..109
score: 8.89
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 110..131
score: 8.459
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 66..87
score: 8.775
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 132..153
score: 7.789
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 44..65
score: 4.693