Ligand of Numb protein X 2

Overview
NameLigand of Numb protein X 2
Smed IDSMED30024655
Length (bp)2153
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ligand of Numb protein X 2 (SMED30024655) t-SNE clustered cells

Violin plots show distribution of expression levels for Ligand of Numb protein X 2 (SMED30024655) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ligand of Numb protein X 2 (SMED30024655) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ligand of Numb protein X 2 (SMED30024655) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024655

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X2 cellSMED30024655h1SMcG0019354 SmedASXL_001571SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30024655h1SMcG0019354 Contig47944newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30024655h1SMcG0019354 Contig47944uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
gutSMED30024655h1SMcG0019354 dd_Smed_v4_4763_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30024655h1SMcG0019354 dd_Smed_v4_4763_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30024655h1SMcG0019354 dd_Smed_v4_4763_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30024655h1SMcG0019354 dd_Smed_v4_4763_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ligand of Numb protein X 2 vs. Ensembl Human
Match: LNX2 (ligand of numb-protein X 2 [Source:HGNC Symbol;Acc:HGNC:20421])

HSP 1 Score: 266.159 bits (679), Expect = 2.353e-78
Identity = 181/508 (35.63%), Postives = 266/508 (52.36%), Query Frame = 3
Query:  585 ITIINPER----LEFGVSFVGGFDTPLQCIVIQEIFRDGRIAMDGRLRPGDQITKINEYYLSQASHIECRDVLSRISQSGDTIYLTIHRDIVDKRWLPVA---------KEEILTFVLEK-PTDRKMGLKLAGKTNKSGLYIQEVLPDSQASLDGRLKKDDRILKINEHDLVFGTQNEALEIIKSVKDSVKFVISRIVRPQTPDIIRAAGTEPDS--NMTPIATSSSYPGLKNASTRGYEVGNSPFTFDSPISFKS-----TYREEVVEVDKKPGESLGMSVAGGVNSQRGDTPVYITNIAPNSLLKNTNGIDKGDILLAVNETELLGLSHERAVEALKLARDNCNKVTVRVLKV-------------PNLLLMANTD-NFIPSWMYWLKLPGYCQIPRMITLSRDAATGSLGFSIVGGNDPIYPFNTNSSLTDLSHNKEAPYRPIMIKSIVSGSPAHKNGRLKCGDILISINDFSLSNVSHSDAVNLFKSTQGPVHLKVVSWPGTII 2003
            IT I   R    ++ G+S VGG +TPL  IVIQE++RDG IA DGRL  GDQI ++N Y +S  SH   R VLS   Q  +T++LT+ R+   +R+   A         +EEI    L K  +  ++G+KL  +T++ G++I ++L    A+ DGRL  +DR+L IN HDL +GT   A +II++  + V   I+R  +PQ  + IR AG    S  + TP                       P  +  P S K      T +E+ + V K+P ESLGM+VAGG  S+ G+ P+++T++ P+  L     I +GD+LL +N  +L  LSH  AV  LK A      V ++ L+V             P+       D ++ PSW+ WL LP        I L R +  GS GFSIVGG +  +   TN              +P  IK+IV G+PA+ +GRLKCGD+++++N  S   +SHS  V + K  +  V L V+ WPG+++
Sbjct:  231 ITTIEIHRSNPYIQLGISIVGGNETPLINIVIQEVYRDGVIARDGRLLAGDQILQVNNYNISNVSHNYARAVLS---QPCNTLHLTVLRE---RRFGNRAHNHSDSNSPREEIFQVALHKRDSGEQLGIKLVRRTDEPGVFILDLLEGGLAAQDGRLSSNDRVLAINGHDLKYGTPELAAQIIQASGERVNLTIARPGKPQPGNTIREAGNHSSSSQHHTP-----------------------PPYYSRPSSHKDLTQCVTCQEKHITVKKEPHESLGMTVAGGRGSKSGELPIFVTSVPPHGCLARDGRIKRGDVLLNINGIDLTNLSHSEAVAMLK-ASAASPAVALKALEVQIVEEATQNAEEQPSTFSENEYDASWSPSWVMWLGLPSTLHSCHDIVLRR-SYLGSWGFSIVGGYEENH---TN--------------QPFFIKTIVLGTPAYYDGRLKCGDMIVAVNGLSTVGMSHSALVPMLKEQRNKVTLTVICWPGSLV 690          
BLAST of Ligand of Numb protein X 2 vs. Ensembl Human
Match: LNX2 (ligand of numb-protein X 2 [Source:HGNC Symbol;Acc:HGNC:20421])

HSP 1 Score: 266.159 bits (679), Expect = 2.353e-78
Identity = 181/508 (35.63%), Postives = 266/508 (52.36%), Query Frame = 3
Query:  585 ITIINPER----LEFGVSFVGGFDTPLQCIVIQEIFRDGRIAMDGRLRPGDQITKINEYYLSQASHIECRDVLSRISQSGDTIYLTIHRDIVDKRWLPVA---------KEEILTFVLEK-PTDRKMGLKLAGKTNKSGLYIQEVLPDSQASLDGRLKKDDRILKINEHDLVFGTQNEALEIIKSVKDSVKFVISRIVRPQTPDIIRAAGTEPDS--NMTPIATSSSYPGLKNASTRGYEVGNSPFTFDSPISFKS-----TYREEVVEVDKKPGESLGMSVAGGVNSQRGDTPVYITNIAPNSLLKNTNGIDKGDILLAVNETELLGLSHERAVEALKLARDNCNKVTVRVLKV-------------PNLLLMANTD-NFIPSWMYWLKLPGYCQIPRMITLSRDAATGSLGFSIVGGNDPIYPFNTNSSLTDLSHNKEAPYRPIMIKSIVSGSPAHKNGRLKCGDILISINDFSLSNVSHSDAVNLFKSTQGPVHLKVVSWPGTII 2003
            IT I   R    ++ G+S VGG +TPL  IVIQE++RDG IA DGRL  GDQI ++N Y +S  SH   R VLS   Q  +T++LT+ R+   +R+   A         +EEI    L K  +  ++G+KL  +T++ G++I ++L    A+ DGRL  +DR+L IN HDL +GT   A +II++  + V   I+R  +PQ  + IR AG    S  + TP                       P  +  P S K      T +E+ + V K+P ESLGM+VAGG  S+ G+ P+++T++ P+  L     I +GD+LL +N  +L  LSH  AV  LK A      V ++ L+V             P+       D ++ PSW+ WL LP        I L R +  GS GFSIVGG +  +   TN              +P  IK+IV G+PA+ +GRLKCGD+++++N  S   +SHS  V + K  +  V L V+ WPG+++
Sbjct:  231 ITTIEIHRSNPYIQLGISIVGGNETPLINIVIQEVYRDGVIARDGRLLAGDQILQVNNYNISNVSHNYARAVLS---QPCNTLHLTVLRE---RRFGNRAHNHSDSNSPREEIFQVALHKRDSGEQLGIKLVRRTDEPGVFILDLLEGGLAAQDGRLSSNDRVLAINGHDLKYGTPELAAQIIQASGERVNLTIARPGKPQPGNTIREAGNHSSSSQHHTP-----------------------PPYYSRPSSHKDLTQCVTCQEKHITVKKEPHESLGMTVAGGRGSKSGELPIFVTSVPPHGCLARDGRIKRGDVLLNINGIDLTNLSHSEAVAMLK-ASAASPAVALKALEVQIVEEATQNAEEQPSTFSENEYDASWSPSWVMWLGLPSTLHSCHDIVLRR-SYLGSWGFSIVGGYEENH---TN--------------QPFFIKTIVLGTPAYYDGRLKCGDMIVAVNGLSTVGMSHSALVPMLKEQRNKVTLTVICWPGSLV 690          
BLAST of Ligand of Numb protein X 2 vs. Ensembl Human
Match: LNX1 (ligand of numb-protein X 1 [Source:HGNC Symbol;Acc:HGNC:6657])

HSP 1 Score: 253.062 bits (645), Expect = 6.572e-74
Identity = 180/541 (33.27%), Postives = 274/541 (50.65%), Query Frame = 3
Query:  462 ISNTNSGNNFPKPQDCFYQNNSFYTPLNHLDNLEFNVEDFTITIINPERLE----FGVSFVGGFDTPLQCIVIQEIFRDGRIAMDGRLRPGDQITKINEYYLSQASHIECRDVLSRISQSGDTIYLTIHRD----IVDKRWLPVA---KEEILTFVLEKPT-DRKMGLKLAGKTNKSGLYIQEVLPDSQASLDGRLKKDDRILKINEHDLVFGTQNEALEIIKSVKDSVKFVISRIVRPQTPDIIRAAGTEPDSNMTPIATSSSYPGLKNASTRGYEVGNSPFTFDSPISFKSTYREEVVEVDKKPGESLGMSVAGGVNSQRGDTPVYITNIAPNSLLKNTNGIDKGDILLAVNETELLGLSHERAVEALKLARDNCNKVTVRVLKV-----------PNLL----LMANTDNFIPSWMYWLKLPGYCQIPRMITLSRDAATGSLGFSIVGGNDPIYPFNTNSSLTDLSHNKEAPYRPIMIKSIVSGSPAHKNGRLKCGDILISINDFSLSNVSHSDAVNLFKSTQGPVHLKVVSWPGTII 2003
            +  T SG+      D   +N+   T       L   + D  IT I   R++      +  VGG +TPL  I+IQ I+RDG IA DGRL PGD I K+N   +S   H     +L +  Q    ++LT+ R+      +    P A   +++    +L K + + ++G+KL  K ++ G++I  VL    A   G+L+++DR+L IN HDL +G+   A  +I++ +  V  V+SR VR ++PDI + AG   + + +P       PG         E  N+P     P+    T  E+VV + K PGESLGM+VAGG + +  D P+Y+ ++ P  ++     I  GDILL V+  EL  +S   AV  LK      + + ++ L+V           P  L     MA   ++ PSW+ WL+LP      + I L R+ A GSLGF IVGG +    +N N              +P  IKSIV G+PA+ +GR++CGDIL+++N  S S + H+    L K  +G + L +VSWPGT +
Sbjct:  135 LRRTKSGSAVANHADQGRENSENTTAPEVFPRLYHLIPDGEITSIKINRVDPSESLSIRLVGGSETPLVHIIIQHIYRDGVIARDGRLLPGDIILKVNGMDISNVPHNYAVRLLRQPCQ---VLWLTVMREQKFRSRNNGQAPDAYRPRDDSFHVILNKSSPEEQLGIKLVRKVDEPGVFIFNVLDGGVAYRHGQLEENDRVLAINGHDLRYGSPESAAHLIQASERRVHLVVSRQVRQRSPDIFQEAGWNSNGSWSP------GPG---------ERSNTP----KPLHPTITCHEKVVNIQKDPGESLGMTVAGGASHREWDLPIYVISVEPGGVISRDGRIKTGDILLNVDGVELTEVSRSEAVALLK---RTSSSIVLKALEVKEYEPQEDCSSPAALDSNHNMAPPSDWSPSWVMWLELPRCLYNCKDIVLRRNTA-GSLGFCIVGGYEE---YNGN--------------KPFFIKSIVEGTPAYNDGRIRCGDILLAVNGRSTSGMIHACLARLLKELKGRITLTIVSWPGTFL 632          
BLAST of Ligand of Numb protein X 2 vs. Ensembl Human
Match: LNX1 (ligand of numb-protein X 1 [Source:HGNC Symbol;Acc:HGNC:6657])

HSP 1 Score: 253.447 bits (646), Expect = 2.958e-73
Identity = 180/541 (33.27%), Postives = 274/541 (50.65%), Query Frame = 3
Query:  462 ISNTNSGNNFPKPQDCFYQNNSFYTPLNHLDNLEFNVEDFTITIINPERLE----FGVSFVGGFDTPLQCIVIQEIFRDGRIAMDGRLRPGDQITKINEYYLSQASHIECRDVLSRISQSGDTIYLTIHRD----IVDKRWLPVA---KEEILTFVLEKPT-DRKMGLKLAGKTNKSGLYIQEVLPDSQASLDGRLKKDDRILKINEHDLVFGTQNEALEIIKSVKDSVKFVISRIVRPQTPDIIRAAGTEPDSNMTPIATSSSYPGLKNASTRGYEVGNSPFTFDSPISFKSTYREEVVEVDKKPGESLGMSVAGGVNSQRGDTPVYITNIAPNSLLKNTNGIDKGDILLAVNETELLGLSHERAVEALKLARDNCNKVTVRVLKV-----------PNLL----LMANTDNFIPSWMYWLKLPGYCQIPRMITLSRDAATGSLGFSIVGGNDPIYPFNTNSSLTDLSHNKEAPYRPIMIKSIVSGSPAHKNGRLKCGDILISINDFSLSNVSHSDAVNLFKSTQGPVHLKVVSWPGTII 2003
            +  T SG+      D   +N+   T       L   + D  IT I   R++      +  VGG +TPL  I+IQ I+RDG IA DGRL PGD I K+N   +S   H     +L +  Q    ++LT+ R+      +    P A   +++    +L K + + ++G+KL  K ++ G++I  VL    A   G+L+++DR+L IN HDL +G+   A  +I++ +  V  V+SR VR ++PDI + AG   + + +P       PG         E  N+P     P+    T  E+VV + K PGESLGM+VAGG + +  D P+Y+ ++ P  ++     I  GDILL V+  EL  +S   AV  LK      + + ++ L+V           P  L     MA   ++ PSW+ WL+LP      + I L R+ A GSLGF IVGG +    +N N              +P  IKSIV G+PA+ +GR++CGDIL+++N  S S + H+    L K  +G + L +VSWPGT +
Sbjct:  231 LRRTKSGSAVANHADQGRENSENTTAPEVFPRLYHLIPDGEITSIKINRVDPSESLSIRLVGGSETPLVHIIIQHIYRDGVIARDGRLLPGDIILKVNGMDISNVPHNYAVRLLRQPCQ---VLWLTVMREQKFRSRNNGQAPDAYRPRDDSFHVILNKSSPEEQLGIKLVRKVDEPGVFIFNVLDGGVAYRHGQLEENDRVLAINGHDLRYGSPESAAHLIQASERRVHLVVSRQVRQRSPDIFQEAGWNSNGSWSP------GPG---------ERSNTP----KPLHPTITCHEKVVNIQKDPGESLGMTVAGGASHREWDLPIYVISVEPGGVISRDGRIKTGDILLNVDGVELTEVSRSEAVALLKRTS---SSIVLKALEVKEYEPQEDCSSPAALDSNHNMAPPSDWSPSWVMWLELPRCLYNCKDIVLRRNTA-GSLGFCIVGGYEE---YNGN--------------KPFFIKSIVEGTPAYNDGRIRCGDILLAVNGRSTSGMIHACLARLLKELKGRITLTIVSWPGTFL 728          
BLAST of Ligand of Numb protein X 2 vs. Ensembl Human
Match: PATJ (PATJ crumbs cell polarity complex component [Source:HGNC Symbol;Acc:HGNC:28881])

HSP 1 Score: 186.808 bits (473), Expect = 9.793e-50
Identity = 150/483 (31.06%), Postives = 234/483 (48.45%), Query Frame = 3
Query:  585 ITIINPERLEFGVSFVGGFDTPLQCIVIQEIFRDGRIAMDGRLRPGDQITKINEYYLSQASHIECRDVLSRISQSGDTIYLTIHRDIVDKRWLPVAKEEILTFVLEKPTDRKMGLKLAGKTNKSGLYIQEVLPDSQASLDGRLKKDDRILKINEHDLVFGTQNEALEIIKSVKDSVKFVISRIVRPQTPDIIRAAGTEPDSNMTPIATSSSYP-------GLKNASTRGYEVGNSPFTFDSPISFKSTYREEVVEVDKKPGESLGMSVAGGVNSQRGDTPVYITNIAPNSLLKNTNGIDKGDILLAVNETELLGLSHERAVEALKLARDNCNKVTVRVLKVPNL-LLMANTDNFIPSWMYWLKLPGYCQI--------PRMITLSRDAATGSLGFSIVGGNDPIYPFNTNSSLTDLSHNKEAPYRPIMIKSIVSGSPAHKNGRLKCGDILISINDFSLSNVSHSDAVNLFKSTQGPVHLKVVS 1985
            I  I+  R   G+S VGG DTPL  IVI E++ +G  A DGRL  GDQI ++N   L  +SH E    ++ + Q+   + L ++RD  +  +      EI    L+K   R +GL + GK N SG++I +++    A LDGRL + D+IL +N  D+   +Q     I+K  +  V+  I R+ R  +    R   ++        A SS +P       GL+N       VG    +  S  +  +      VE++++  ++LG+S+AGG  S  GD PV+I  I  + +   T  +  GD ++++N   L GLSH   V  LK A     ++ ++V+   N+  + A  +N   S  Y L  P             P++ITL + +    LGFSIVGG          S   DL         PI +K++ +   A  +GRLK GD ++++N  +L  V+H  AV + K  +G V L V+S
Sbjct:  221 IIEISKGRSGLGLSIVGGKDTPLNAIVIHEVYEEGAAARDGRLWAGDQILEVNGVDLRNSSHEEA---ITALRQTPQKVRLVVYRD--EAHYRDEENLEIFPVDLQKKAGRGLGLSIVGKRNGSGVFISDIVKGGAADLDGRLIQGDQILSVNGEDMRNASQETVATILKCAQGLVQLEIGRL-RAGSWTSARTT-SQNSQGSQQSAHSSCHPSFAPVITGLQNL------VGTKRVSDPSQKNSGTDMEPRTVEINRELSDALGISIAGGRGSPLGDIPVFIAMIQASGVAARTQKLKVGDRIVSINGQPLDGLSHADVVNLLKNA---YGRIILQVVADTNISAIAAQLENM--STGYHLGSPTAEHHPEDTETPPPKIITLEKGSE--GLGFSIVGG--------YGSPHGDL---------PIYVKTVFAKGAAADDGRLKRGDQILAVNGETLEGVTHEQAVAILKHQRGTVTLTVLS 666          
BLAST of Ligand of Numb protein X 2 vs. Ensembl Celegans
Match: mpz-1 (Multiple PDZ domain protein [Source:UniProtKB/TrEMBL;Acc:G1K0W2])

HSP 1 Score: 106.301 bits (264), Expect = 6.157e-24
Identity = 75/257 (29.18%), Postives = 122/257 (47.47%), Query Frame = 3
Query:  615 FGVSFVGGFDTPLQCIVIQEIFRDGRIAMDGRLRPGDQITKINEYYLSQASHIECRDVLSRISQSGDTIYLTIHRDIVDKRWL--PVAKEEILTFVLEKPTDRKMGLKLAGKTNKSGLYIQEVLPDSQASLDGRLKKDDRILKINEHDLVFGTQNEALEIIKSVKDSVKFVISRIVRPQTPDIIRAA-------GTEPDSN------MTPIATSSSYPGLKNASTRGYEVGNSPFT-------FDSPISFKSTYREE 1319
             G+S VGG DT L  +VI E++ DG  A DGRL+PGDQ+ ++N   L   +H +    L R       + L I+RD+  +  L  P     I    L K T R +G+ + G+ N+ G+Y+ E++    A  DGRL   D+IL++N  D+    Q +   ++K++   V   + R    +T + + AA        T P +       + P+A + S P    +++    V ++P T          PI   ++ REE
Sbjct:   49 LGLSIVGGADTVLGTVVIHEVYSDGAAAHDGRLKPGDQVLEVNGTSLRGVTHDQSIAYLRRTPPK---VRLLIYRDVNLQLSLLDPTQIYNIFEIDLVKKTGRGLGISIVGRKNEPGVYVSEIVKGGLAESDGRLMTGDQILEVNGKDVRGCMQEDVAAMLKTITGKVHLKLGRWKITETANRVHAATQALAKSATTPRTTENNNDPVRPVAVAVSSPAATPSTSASVTVTSAPATSVPEPNVVVEPIPGPTSAREE 302          

HSP 2 Score: 67.0106 bits (162), Expect = 2.379e-11
Identity = 65/239 (27.20%), Postives = 104/239 (43.51%), Query Frame = 3
Query: 1311 REEVVEVDKKPGESLGMSVAGGVNSQRGDTPVYITNIAPNSLLKNTNGIDKGDILLAVNETELLGLSHERAVEALKLARDNCNKVTVRVLKVPNLLLMANTDNFIPSWMYWLKLPGYCQIPRMITLSRDAATGSLGFSIVG-GNDPIYPFNTNSSLTDLSHNKEAPYRPIMIKSIVSGSPAHKNGRLKCGDILISINDFSLSNVSHSDAVNLFKSTQGPVHLKVVSWPGTII*TANQIQ 2024
            RE ++E+DK  G+ LG+S+ GG ++  G   V I  +  +    +   +  GD +L VN T L G++H++++  L   R    KV + + +  NL L        P+ +Y +           I L +    G LG SIVG  N+P                       + +  IV G  A  +GRL  GD ++ +N   +      D   + K+  G VHLK+  W   I  TAN++ 
Sbjct:   36 RETMIEIDKD-GKGLGLSIVGGADTVLGT--VVIHEVYSDGAAAHDGRLKPGDQVLEVNGTSLRGVTHDQSIAYL---RRTPPKVRLLIYRDVNLQLSL----LDPTQIYNI---------FEIDLVKKTGRG-LGISIVGRKNEP----------------------GVYVSEIVKGGLAESDGRLMTGDQILEVNGKDVRGCMQEDVAAMLKTITGKVHLKLGRW--KITETANRVH 230          
BLAST of Ligand of Numb protein X 2 vs. Ensembl Celegans
Match: mpz-1 (Multiple PDZ domain protein [Source:UniProtKB/TrEMBL;Acc:G1K0W2])

HSP 1 Score: 105.145 bits (261), Expect = 4.964e-23
Identity = 73/257 (28.40%), Postives = 125/257 (48.64%), Query Frame = 3
Query:  615 FGVSFVGGFDTPLQCIVIQEIFRDGRIAMDGRLRPGDQITKINEYYLSQASHIECRDVLSRISQSGDTIYLTIHRDIVDKRWL--PVAKEEILTFVLEKPTDRKMGLKLAGKTNKSGLYIQEVLPDSQASLDGRLKKDDRILKINEHDLVFGTQNEALEIIKSVKDSVKFVISRIVRPQTPDIIRAA-------GTEPDSN------MTPIATSSSYPGLKNASTRGYEVGNSPFT-------FDSPISFKSTYREE 1319
             G+S VGG DT L  +VI E++ DG  A DGRL+PGDQ+ ++N   L   +H +    ++ + ++   + L I+RD+  +  L  P     I    L K T R +G+ + G+ N+ G+Y+ E++    A  DGRL   D+IL++N  D+    Q +   ++K++   V   + R    +T + + AA        T P +       + P+A + S P    +++    V ++P T          PI   ++ REE
Sbjct:  559 LGLSIVGGADTVLGTVVIHEVYSDGAAAHDGRLKPGDQVLEVNGTSLRGVTHDQS---IAYLRRTPPKVRLLIYRDVNLQLSLLDPTQIYNIFEIDLVKKTGRGLGISIVGRKNEPGVYVSEIVKGGLAESDGRLMTGDQILEVNGKDVRGCMQEDVAAMLKTITGKVHLKLGRWKITETANRVHAATQALAKSATTPRTTENNNDPVRPVAVAVSSPAATPSTSASVTVTSAPATSVPEPNVVVEPIPGPTSAREE 812          

HSP 2 Score: 67.3958 bits (163), Expect = 3.070e-11
Identity = 65/239 (27.20%), Postives = 104/239 (43.51%), Query Frame = 3
Query: 1311 REEVVEVDKKPGESLGMSVAGGVNSQRGDTPVYITNIAPNSLLKNTNGIDKGDILLAVNETELLGLSHERAVEALKLARDNCNKVTVRVLKVPNLLLMANTDNFIPSWMYWLKLPGYCQIPRMITLSRDAATGSLGFSIVG-GNDPIYPFNTNSSLTDLSHNKEAPYRPIMIKSIVSGSPAHKNGRLKCGDILISINDFSLSNVSHSDAVNLFKSTQGPVHLKVVSWPGTII*TANQIQ 2024
            RE ++E+DK  G+ LG+S+ GG ++  G   V I  +  +    +   +  GD +L VN T L G++H++++  L   R    KV + + +  NL L        P+ +Y +           I L +    G LG SIVG  N+P                       + +  IV G  A  +GRL  GD ++ +N   +      D   + K+  G VHLK+  W   I  TAN++ 
Sbjct:  546 RETMIEIDKD-GKGLGLSIVGGADTVLGT--VVIHEVYSDGAAAHDGRLKPGDQVLEVNGTSLRGVTHDQSIAYL---RRTPPKVRLLIYRDVNLQLSL----LDPTQIYNI---------FEIDLVKKTGRG-LGISIVGRKNEP----------------------GVYVSEIVKGGLAESDGRLMTGDQILEVNGKDVRGCMQEDVAAMLKTITGKVHLKLGRW--KITETANRVH 740          

HSP 3 Score: 52.7582 bits (125), Expect = 8.488e-7
Identity = 37/117 (31.62%), Postives = 53/117 (45.30%), Query Frame = 3
Query: 1638 YWLKLPGYCQIPRMITLSRDAATGSLGFSIVGGNDPI-----YPFNTNSSLTDLSHNKEAPYRPIMIKSIVSGSPAHKNGRLKCGDILISINDFSLSNVSHSDAVNLFKSTQGPVHL 1973
            YW +        R +TL R+    S G SIVGG   +      P   N+               I IKS++  SPA ++G++  GD +IS+ND  L + +H  AVN  K+   PV  
Sbjct:   28 YWGEA-------RTVTLVREP-NKSFGISIVGGRVEVSQKGGLPGTGNTVCG------------IFIKSVLPNSPAGRSGQMNMGDRVISVNDVDLRDATHEQAVNAIKNASNPVRF 124          
BLAST of Ligand of Numb protein X 2 vs. Ensembl Celegans
Match: mpz-1 (Multiple PDZ domain protein [Source:UniProtKB/TrEMBL;Acc:G1K0W2])

HSP 1 Score: 105.531 bits (262), Expect = 5.242e-23
Identity = 75/257 (29.18%), Postives = 123/257 (47.86%), Query Frame = 3
Query:  615 FGVSFVGGFDTPLQCIVIQEIFRDGRIAMDGRLRPGDQITKINEYYLSQASHIECRDVLSRISQSGDTIYLTIHRDIVDKRWL--PVAKEEILTFVLEKPTDRKMGLKLAGKTNKSGLYIQEVLPDSQASLDGRLKKDDRILKINEHDLVFGTQNEALEIIKSVKDSVKFVISRIVRPQTPDIIRAA-------GTEPDSN------MTPIATSSSYPGLKNASTRGYEVGNSPFT-------FDSPISFKSTYREE 1319
             G+S VGG DT L  +VI E++ DG  A DGRL+PGDQ+ ++N   L   +H +    L R   +   + L I+RD+  +  L  P     I    L K T R +G+ + G+ N+ G+Y+ E++    A  DGRL   D+IL++N  D+    Q +   ++K++   V   + R    +T + + AA        T P +       + P+A + S P    +++    V ++P T          PI   ++ REE
Sbjct: 1763 LGLSIVGGADTVLGTVVIHEVYSDGAAAHDGRLKPGDQVLEVNGTSLRGVTHDQSIAYLRR---TPPKVRLLIYRDVNLQLSLLDPTQIYNIFEIDLVKKTGRGLGISIVGRKNEPGVYVSEIVKGGLAESDGRLMTGDQILEVNGKDVRGCMQEDVAAMLKTITGKVHLKLGRWKITETANRVHAATQALAKSATTPRTTENNNDPVRPVAVAVSSPAATPSTSASVTVTSAPATSVPEPNVVVEPIPGPTSAREE 2016          

HSP 2 Score: 67.3958 bits (163), Expect = 3.348e-11
Identity = 65/239 (27.20%), Postives = 104/239 (43.51%), Query Frame = 3
Query: 1311 REEVVEVDKKPGESLGMSVAGGVNSQRGDTPVYITNIAPNSLLKNTNGIDKGDILLAVNETELLGLSHERAVEALKLARDNCNKVTVRVLKVPNLLLMANTDNFIPSWMYWLKLPGYCQIPRMITLSRDAATGSLGFSIVG-GNDPIYPFNTNSSLTDLSHNKEAPYRPIMIKSIVSGSPAHKNGRLKCGDILISINDFSLSNVSHSDAVNLFKSTQGPVHLKVVSWPGTII*TANQIQ 2024
            RE ++E+DK  G+ LG+S+ GG ++  G   V I  +  +    +   +  GD +L VN T L G++H++++  L   R    KV + + +  NL L        P+ +Y +           I L +    G LG SIVG  N+P                       + +  IV G  A  +GRL  GD ++ +N   +      D   + K+  G VHLK+  W   I  TAN++ 
Sbjct: 1750 RETMIEIDKD-GKGLGLSIVGGADTVLGT--VVIHEVYSDGAAAHDGRLKPGDQVLEVNGTSLRGVTHDQSIAYL---RRTPPKVRLLIYRDVNLQLSL----LDPTQIYNI---------FEIDLVKKTGRG-LGISIVGRKNEP----------------------GVYVSEIVKGGLAESDGRLMTGDQILEVNGKDVRGCMQEDVAAMLKTITGKVHLKLGRW--KITETANRVH 1944          

HSP 3 Score: 53.1434 bits (126), Expect = 7.461e-7
Identity = 43/146 (29.45%), Postives = 63/146 (43.15%), Query Frame = 3
Query: 1551 NCNKVTVRVLKVPNLLLMANTDNFIPSWMYWLKLPGYCQIPRMITLSRDAATGSLGFSIVGGNDPI-----YPFNTNSSLTDLSHNKEAPYRPIMIKSIVSGSPAHKNGRLKCGDILISINDFSLSNVSHSDAVNLFKSTQGPVHL 1973
            N ++VT R     +  L       + S  YW +        R +TL R+    S G SIVGG   +      P   N+               I IKS++  SPA ++G++  GD +IS+ND  L + +H  AVN  K+   PV  
Sbjct: 1204 NMSRVTSRTPSTGSESLQNQARQLVRS-KYWGEA-------RTVTLVREP-NKSFGISIVGGRVEVSQKGGLPGTGNTVCG------------IFIKSVLPNSPAGRSGQMNMGDRVISVNDVDLRDATHEQAVNAIKNASNPVRF 1328          
BLAST of Ligand of Numb protein X 2 vs. Ensembl Celegans
Match: mpz-1 (Multiple PDZ domain protein [Source:UniProtKB/TrEMBL;Acc:G1K0W2])

HSP 1 Score: 105.531 bits (262), Expect = 5.391e-23
Identity = 75/257 (29.18%), Postives = 123/257 (47.86%), Query Frame = 3
Query:  615 FGVSFVGGFDTPLQCIVIQEIFRDGRIAMDGRLRPGDQITKINEYYLSQASHIECRDVLSRISQSGDTIYLTIHRDIVDKRWL--PVAKEEILTFVLEKPTDRKMGLKLAGKTNKSGLYIQEVLPDSQASLDGRLKKDDRILKINEHDLVFGTQNEALEIIKSVKDSVKFVISRIVRPQTPDIIRAA-------GTEPDSN------MTPIATSSSYPGLKNASTRGYEVGNSPFT-------FDSPISFKSTYREE 1319
             G+S VGG DT L  +VI E++ DG  A DGRL+PGDQ+ ++N   L   +H +    L R   +   + L I+RD+  +  L  P     I    L K T R +G+ + G+ N+ G+Y+ E++    A  DGRL   D+IL++N  D+    Q +   ++K++   V   + R    +T + + AA        T P +       + P+A + S P    +++    V ++P T          PI   ++ REE
Sbjct:  988 LGLSIVGGADTVLGTVVIHEVYSDGAAAHDGRLKPGDQVLEVNGTSLRGVTHDQSIAYLRR---TPPKVRLLIYRDVNLQLSLLDPTQIYNIFEIDLVKKTGRGLGISIVGRKNEPGVYVSEIVKGGLAESDGRLMTGDQILEVNGKDVRGCMQEDVAAMLKTITGKVHLKLGRWKITETANRVHAATQALAKSATTPRTTENNNDPVRPVAVAVSSPAATPSTSASVTVTSAPATSVPEPNVVVEPIPGPTSAREE 1241          

HSP 2 Score: 67.3958 bits (163), Expect = 3.196e-11
Identity = 65/239 (27.20%), Postives = 104/239 (43.51%), Query Frame = 3
Query: 1311 REEVVEVDKKPGESLGMSVAGGVNSQRGDTPVYITNIAPNSLLKNTNGIDKGDILLAVNETELLGLSHERAVEALKLARDNCNKVTVRVLKVPNLLLMANTDNFIPSWMYWLKLPGYCQIPRMITLSRDAATGSLGFSIVG-GNDPIYPFNTNSSLTDLSHNKEAPYRPIMIKSIVSGSPAHKNGRLKCGDILISINDFSLSNVSHSDAVNLFKSTQGPVHLKVVSWPGTII*TANQIQ 2024
            RE ++E+DK  G+ LG+S+ GG ++  G   V I  +  +    +   +  GD +L VN T L G++H++++  L   R    KV + + +  NL L        P+ +Y +           I L +    G LG SIVG  N+P                       + +  IV G  A  +GRL  GD ++ +N   +      D   + K+  G VHLK+  W   I  TAN++ 
Sbjct:  975 RETMIEIDKD-GKGLGLSIVGGADTVLGT--VVIHEVYSDGAAAHDGRLKPGDQVLEVNGTSLRGVTHDQSIAYL---RRTPPKVRLLIYRDVNLQLSL----LDPTQIYNI---------FEIDLVKKTGRG-LGISIVGRKNEP----------------------GVYVSEIVKGGLAESDGRLMTGDQILEVNGKDVRGCMQEDVAAMLKTITGKVHLKLGRW--KITETANRVH 1169          

HSP 3 Score: 53.9138 bits (128), Expect = 4.083e-7
Identity = 43/146 (29.45%), Postives = 63/146 (43.15%), Query Frame = 3
Query: 1551 NCNKVTVRVLKVPNLLLMANTDNFIPSWMYWLKLPGYCQIPRMITLSRDAATGSLGFSIVGGNDPI-----YPFNTNSSLTDLSHNKEAPYRPIMIKSIVSGSPAHKNGRLKCGDILISINDFSLSNVSHSDAVNLFKSTQGPVHL 1973
            N ++VT R     +  L       + S  YW +        R +TL R+    S G SIVGG   +      P   N+               I IKS++  SPA ++G++  GD +IS+ND  L + +H  AVN  K+   PV  
Sbjct:  429 NMSRVTSRTPSTGSESLQNQARQLVRS-KYWGEA-------RTVTLVREP-NKSFGISIVGGRVEVSQKGGLPGTGNTVCG------------IFIKSVLPNSPAGRSGQMNMGDRVISVNDVDLRDATHEQAVNAIKNASNPVRF 553          
BLAST of Ligand of Numb protein X 2 vs. Ensembl Celegans
Match: mpz-1 (Multiple PDZ domain protein [Source:UniProtKB/TrEMBL;Acc:G1K0W2])

HSP 1 Score: 105.531 bits (262), Expect = 5.484e-23
Identity = 75/257 (29.18%), Postives = 123/257 (47.86%), Query Frame = 3
Query:  615 FGVSFVGGFDTPLQCIVIQEIFRDGRIAMDGRLRPGDQITKINEYYLSQASHIECRDVLSRISQSGDTIYLTIHRDIVDKRWL--PVAKEEILTFVLEKPTDRKMGLKLAGKTNKSGLYIQEVLPDSQASLDGRLKKDDRILKINEHDLVFGTQNEALEIIKSVKDSVKFVISRIVRPQTPDIIRAA-------GTEPDSN------MTPIATSSSYPGLKNASTRGYEVGNSPFT-------FDSPISFKSTYREE 1319
             G+S VGG DT L  +VI E++ DG  A DGRL+PGDQ+ ++N   L   +H +    L R   +   + L I+RD+  +  L  P     I    L K T R +G+ + G+ N+ G+Y+ E++    A  DGRL   D+IL++N  D+    Q +   ++K++   V   + R    +T + + AA        T P +       + P+A + S P    +++    V ++P T          PI   ++ REE
Sbjct: 1781 LGLSIVGGADTVLGTVVIHEVYSDGAAAHDGRLKPGDQVLEVNGTSLRGVTHDQSIAYLRR---TPPKVRLLIYRDVNLQLSLLDPTQIYNIFEIDLVKKTGRGLGISIVGRKNEPGVYVSEIVKGGLAESDGRLMTGDQILEVNGKDVRGCMQEDVAAMLKTITGKVHLKLGRWKITETANRVHAATQALAKSATTPRTTENNNDPVRPVAVAVSSPAATPSTSASVTVTSAPATSVPEPNVVVEPIPGPTSAREE 2034          

HSP 2 Score: 67.3958 bits (163), Expect = 3.527e-11
Identity = 65/239 (27.20%), Postives = 104/239 (43.51%), Query Frame = 3
Query: 1311 REEVVEVDKKPGESLGMSVAGGVNSQRGDTPVYITNIAPNSLLKNTNGIDKGDILLAVNETELLGLSHERAVEALKLARDNCNKVTVRVLKVPNLLLMANTDNFIPSWMYWLKLPGYCQIPRMITLSRDAATGSLGFSIVG-GNDPIYPFNTNSSLTDLSHNKEAPYRPIMIKSIVSGSPAHKNGRLKCGDILISINDFSLSNVSHSDAVNLFKSTQGPVHLKVVSWPGTII*TANQIQ 2024
            RE ++E+DK  G+ LG+S+ GG ++  G   V I  +  +    +   +  GD +L VN T L G++H++++  L   R    KV + + +  NL L        P+ +Y +           I L +    G LG SIVG  N+P                       + +  IV G  A  +GRL  GD ++ +N   +      D   + K+  G VHLK+  W   I  TAN++ 
Sbjct: 1768 RETMIEIDKD-GKGLGLSIVGGADTVLGT--VVIHEVYSDGAAAHDGRLKPGDQVLEVNGTSLRGVTHDQSIAYL---RRTPPKVRLLIYRDVNLQLSL----LDPTQIYNI---------FEIDLVKKTGRG-LGISIVGRKNEP----------------------GVYVSEIVKGGLAESDGRLMTGDQILEVNGKDVRGCMQEDVAAMLKTITGKVHLKLGRW--KITETANRVH 1962          

HSP 3 Score: 53.1434 bits (126), Expect = 7.660e-7
Identity = 43/146 (29.45%), Postives = 63/146 (43.15%), Query Frame = 3
Query: 1551 NCNKVTVRVLKVPNLLLMANTDNFIPSWMYWLKLPGYCQIPRMITLSRDAATGSLGFSIVGGNDPI-----YPFNTNSSLTDLSHNKEAPYRPIMIKSIVSGSPAHKNGRLKCGDILISINDFSLSNVSHSDAVNLFKSTQGPVHL 1973
            N ++VT R     +  L       + S  YW +        R +TL R+    S G SIVGG   +      P   N+               I IKS++  SPA ++G++  GD +IS+ND  L + +H  AVN  K+   PV  
Sbjct: 1222 NMSRVTSRTPSTGSESLQNQARQLVRS-KYWGEA-------RTVTLVREP-NKSFGISIVGGRVEVSQKGGLPGTGNTVCG------------IFIKSVLPNSPAGRSGQMNMGDRVISVNDVDLRDATHEQAVNAIKNASNPVRF 1346          
BLAST of Ligand of Numb protein X 2 vs. Ensembl Fly
Match: scrib (gene:FBgn0263289 transcript:FBtr0308623)

HSP 1 Score: 75.485 bits (184), Expect = 1.522e-13
Identity = 53/189 (28.04%), Postives = 92/189 (48.68%), Query Frame = 3
Query:  615 FGVSFVGG-------FDTPLQCIVIQEIFRDGRIAMDGRLRPGDQITKINEYYLSQASHIECRDVLSRISQSGDTIYLTIHRDIVDKRWLPVAKEEILTFVLEKPTDRKMGLKLAGKTN----------KSGLYIQEVLPDSQASLDGRLKKDDRILKINEHDLVFGTQNEALEIIKSVKDSVKFVISR 1130
             G S +GG       F T    I I  I   G  +  G+LR GD+I K+NE  +S+A+H   +D +  + + GD I LTI  D      LP   +E+L   L K    ++G+ + G  N            G+++ ++     A  DGRLK   R+L++N H L+  +  +A+ ++++  + ++ V+ +
Sbjct: 1249 LGFSIIGGTDHSCVPFGTREPGIFISHIVPGGIASKCGKLRMGDRILKVNEADVSKATH---QDAVLELLKPGDEIKLTIQHD-----PLPPGFQEVL---LSKAEGERLGMHIKGGLNGQRGNPADPSDEGVFVSKINSVGAARRDGRLKVGMRLLEVNGHSLLGASHQDAVNVLRNAGNEIQLVVCK 1426          

HSP 2 Score: 62.3882 bits (150), Expect = 1.340e-9
Identity = 78/296 (26.35%), Postives = 114/296 (38.51%), Query Frame = 3
Query:  762 ASHIECRDVLSRISQSGDTIYLTIHRDIVDKRWL-PVAKEEILTFVLEKPTDRKMGLKLAGKTNKS---------GLYIQEVLPDSQASLDGRLKKDDRILKINEHDLVFGTQNEA-LEIIKSVKDSVKFVISRIVRPQTPDIIRAAGTEPDSNMTPIATSSSYPGLKNASTRGYEVGNSPFTFDSPISFKSTYREEVVEVDKKPGESLGMSVAGGVNSQRG------DTPVYITNIAPNSLLKNTNGIDKGDILLAVNETELLGLSHERAVEALKLARDNCNKVTVRVLKVPNLL 1598
            A+  E   V   I++S  T   T+   I D +   P+  EE+   VL K     +G  + G T+ S         G++I  ++P   AS  G+L+  DRILK+NE D+   T  +A LE++K   D +K  I     P                          PG +                              V + K  GE LGM + GG+N QRG      D  V+++ I      +    +  G  LL VN   LLG SH+ AV  L+ A +    V  +     NL+
Sbjct: 1201 AAPTELGRVTETITKS--TFTETVMTRITDNQLAEPLISEEV---VLPK-NQGSLGFSIIGGTDHSCVPFGTREPGIFISHIVPGGIASKCGKLRMGDRILKVNEADVSKATHQDAVLELLKP-GDEIKLTIQHDPLP--------------------------PGFQE-----------------------------VLLSKAEGERLGMHIKGGLNGQRGNPADPSDEGVFVSKINSVGAARRDGRLKVGMRLLEVNGHSLLGASHQDAVNVLRNAGNEIQLVVCKGYDKSNLI 1434          
BLAST of Ligand of Numb protein X 2 vs. Ensembl Fly
Match: scrib (gene:FBgn0263289 transcript:FBtr0308632)

HSP 1 Score: 75.0998 bits (183), Expect = 1.661e-13
Identity = 53/189 (28.04%), Postives = 92/189 (48.68%), Query Frame = 3
Query:  615 FGVSFVGG-------FDTPLQCIVIQEIFRDGRIAMDGRLRPGDQITKINEYYLSQASHIECRDVLSRISQSGDTIYLTIHRDIVDKRWLPVAKEEILTFVLEKPTDRKMGLKLAGKTN----------KSGLYIQEVLPDSQASLDGRLKKDDRILKINEHDLVFGTQNEALEIIKSVKDSVKFVISR 1130
             G S +GG       F T    I I  I   G  +  G+LR GD+I K+NE  +S+A+H   +D +  + + GD I LTI  D      LP   +E+L   L K    ++G+ + G  N            G+++ ++     A  DGRLK   R+L++N H L+  +  +A+ ++++  + ++ V+ +
Sbjct: 1274 LGFSIIGGTDHSCVPFGTREPGIFISHIVPGGIASKCGKLRMGDRILKVNEADVSKATH---QDAVLELLKPGDEIKLTIQHD-----PLPPGFQEVL---LSKAEGERLGMHIKGGLNGQRGNPADPSDEGVFVSKINSVGAARRDGRLKVGMRLLEVNGHSLLGASHQDAVNVLRNAGNEIQLVVCK 1451          

HSP 2 Score: 62.7734 bits (151), Expect = 1.076e-9
Identity = 78/296 (26.35%), Postives = 114/296 (38.51%), Query Frame = 3
Query:  762 ASHIECRDVLSRISQSGDTIYLTIHRDIVDKRWL-PVAKEEILTFVLEKPTDRKMGLKLAGKTNKS---------GLYIQEVLPDSQASLDGRLKKDDRILKINEHDLVFGTQNEA-LEIIKSVKDSVKFVISRIVRPQTPDIIRAAGTEPDSNMTPIATSSSYPGLKNASTRGYEVGNSPFTFDSPISFKSTYREEVVEVDKKPGESLGMSVAGGVNSQRG------DTPVYITNIAPNSLLKNTNGIDKGDILLAVNETELLGLSHERAVEALKLARDNCNKVTVRVLKVPNLL 1598
            A+  E   V   I++S  T   T+   I D +   P+  EE+   VL K     +G  + G T+ S         G++I  ++P   AS  G+L+  DRILK+NE D+   T  +A LE++K   D +K  I     P                          PG +                              V + K  GE LGM + GG+N QRG      D  V+++ I      +    +  G  LL VN   LLG SH+ AV  L+ A +    V  +     NL+
Sbjct: 1226 AAPTELGRVTETITKS--TFTETVMTRITDNQLAEPLISEEV---VLPK-NQGSLGFSIIGGTDHSCVPFGTREPGIFISHIVPGGIASKCGKLRMGDRILKVNEADVSKATHQDAVLELLKP-GDEIKLTIQHDPLP--------------------------PGFQE-----------------------------VLLSKAEGERLGMHIKGGLNGQRGNPADPSDEGVFVSKINSVGAARRDGRLKVGMRLLEVNGHSLLGASHQDAVNVLRNAGNEIQLVVCKGYDKSNLI 1459          
BLAST of Ligand of Numb protein X 2 vs. Ensembl Fly
Match: scrib (gene:FBgn0263289 transcript:FBtr0308630)

HSP 1 Score: 74.7146 bits (182), Expect = 2.331e-13
Identity = 53/189 (28.04%), Postives = 92/189 (48.68%), Query Frame = 3
Query:  615 FGVSFVGG-------FDTPLQCIVIQEIFRDGRIAMDGRLRPGDQITKINEYYLSQASHIECRDVLSRISQSGDTIYLTIHRDIVDKRWLPVAKEEILTFVLEKPTDRKMGLKLAGKTN----------KSGLYIQEVLPDSQASLDGRLKKDDRILKINEHDLVFGTQNEALEIIKSVKDSVKFVISR 1130
             G S +GG       F T    I I  I   G  +  G+LR GD+I K+NE  +S+A+H   +D +  + + GD I LTI  D      LP   +E+L   L K    ++G+ + G  N            G+++ ++     A  DGRLK   R+L++N H L+  +  +A+ ++++  + ++ V+ +
Sbjct: 1274 LGFSIIGGTDHSCVPFGTREPGIFISHIVPGGIASKCGKLRMGDRILKVNEADVSKATH---QDAVLELLKPGDEIKLTIQHD-----PLPPGFQEVL---LSKAEGERLGMHIKGGLNGQRGNPADPSDEGVFVSKINSVGAARRDGRLKVGMRLLEVNGHSLLGASHQDAVNVLRNAGNEIQLVVCK 1451          

HSP 2 Score: 62.7734 bits (151), Expect = 1.125e-9
Identity = 78/296 (26.35%), Postives = 114/296 (38.51%), Query Frame = 3
Query:  762 ASHIECRDVLSRISQSGDTIYLTIHRDIVDKRWL-PVAKEEILTFVLEKPTDRKMGLKLAGKTNKS---------GLYIQEVLPDSQASLDGRLKKDDRILKINEHDLVFGTQNEA-LEIIKSVKDSVKFVISRIVRPQTPDIIRAAGTEPDSNMTPIATSSSYPGLKNASTRGYEVGNSPFTFDSPISFKSTYREEVVEVDKKPGESLGMSVAGGVNSQRG------DTPVYITNIAPNSLLKNTNGIDKGDILLAVNETELLGLSHERAVEALKLARDNCNKVTVRVLKVPNLL 1598
            A+  E   V   I++S  T   T+   I D +   P+  EE+   VL K     +G  + G T+ S         G++I  ++P   AS  G+L+  DRILK+NE D+   T  +A LE++K   D +K  I     P                          PG +                              V + K  GE LGM + GG+N QRG      D  V+++ I      +    +  G  LL VN   LLG SH+ AV  L+ A +    V  +     NL+
Sbjct: 1226 AAPTELGRVTETITKS--TFTETVMTRITDNQLAEPLISEEV---VLPK-NQGSLGFSIIGGTDHSCVPFGTREPGIFISHIVPGGIASKCGKLRMGDRILKVNEADVSKATHQDAVLELLKP-GDEIKLTIQHDPLP--------------------------PGFQE-----------------------------VLLSKAEGERLGMHIKGGLNGQRGNPADPSDEGVFVSKINSVGAARRDGRLKVGMRLLEVNGHSLLGASHQDAVNVLRNAGNEIQLVVCKGYDKSNLI 1459          
BLAST of Ligand of Numb protein X 2 vs. Ensembl Fly
Match: scrib (gene:FBgn0263289 transcript:FBtr0308622)

HSP 1 Score: 74.7146 bits (182), Expect = 2.369e-13
Identity = 53/189 (28.04%), Postives = 92/189 (48.68%), Query Frame = 3
Query:  615 FGVSFVGG-------FDTPLQCIVIQEIFRDGRIAMDGRLRPGDQITKINEYYLSQASHIECRDVLSRISQSGDTIYLTIHRDIVDKRWLPVAKEEILTFVLEKPTDRKMGLKLAGKTN----------KSGLYIQEVLPDSQASLDGRLKKDDRILKINEHDLVFGTQNEALEIIKSVKDSVKFVISR 1130
             G S +GG       F T    I I  I   G  +  G+LR GD+I K+NE  +S+A+H   +D +  + + GD I LTI  D      LP   +E+L   L K    ++G+ + G  N            G+++ ++     A  DGRLK   R+L++N H L+  +  +A+ ++++  + ++ V+ +
Sbjct: 1337 LGFSIIGGTDHSCVPFGTREPGIFISHIVPGGIASKCGKLRMGDRILKVNEADVSKATH---QDAVLELLKPGDEIKLTIQHD-----PLPPGFQEVL---LSKAEGERLGMHIKGGLNGQRGNPADPSDEGVFVSKINSVGAARRDGRLKVGMRLLEVNGHSLLGASHQDAVNVLRNAGNEIQLVVCK 1514          

HSP 2 Score: 60.8474 bits (146), Expect = 3.991e-9
Identity = 60/225 (26.67%), Postives = 87/225 (38.67%), Query Frame = 3
Query:  945 TNKSGLYIQEVLPDSQASLDGRLKKDDRILKINEHDLVFGTQNEA-LEIIKSVKDSVKFVISRIVRPQTPDIIRAAGTEPDSNMTPIATSSSYPGLKNASTRGYEVGNSPFTFDSPISFKSTYREEVVEVDKKPGESLGMSVAGGVNSQRG------DTPVYITNIAPNSLLKNTNGIDKGDILLAVNETELLGLSHERAVEALKLARDNCNKVTVRVLKVPNLL 1598
            T + G++I  ++P   AS  G+L+  DRILK+NE D+   T  +A LE++K   D +K  I     P                          PG +                              V + K  GE LGM + GG+N QRG      D  V+++ I      +    +  G  LL VN   LLG SH+ AV  L+ A +    V  +     NL+
Sbjct: 1354 TREPGIFISHIVPGGIASKCGKLRMGDRILKVNEADVSKATHQDAVLELLKP-GDEIKLTIQHDPLP--------------------------PGFQE-----------------------------VLLSKAEGERLGMHIKGGLNGQRGNPADPSDEGVFVSKINSVGAARRDGRLKVGMRLLEVNGHSLLGASHQDAVNVLRNAGNEIQLVVCKGYDKSNLI 1522          
BLAST of Ligand of Numb protein X 2 vs. Ensembl Fly
Match: scrib (gene:FBgn0263289 transcript:FBtr0308625)

HSP 1 Score: 74.7146 bits (182), Expect = 2.493e-13
Identity = 53/189 (28.04%), Postives = 92/189 (48.68%), Query Frame = 3
Query:  615 FGVSFVGG-------FDTPLQCIVIQEIFRDGRIAMDGRLRPGDQITKINEYYLSQASHIECRDVLSRISQSGDTIYLTIHRDIVDKRWLPVAKEEILTFVLEKPTDRKMGLKLAGKTN----------KSGLYIQEVLPDSQASLDGRLKKDDRILKINEHDLVFGTQNEALEIIKSVKDSVKFVISR 1130
             G S +GG       F T    I I  I   G  +  G+LR GD+I K+NE  +S+A+H   +D +  + + GD I LTI  D      LP   +E+L   L K    ++G+ + G  N            G+++ ++     A  DGRLK   R+L++N H L+  +  +A+ ++++  + ++ V+ +
Sbjct: 1249 LGFSIIGGTDHSCVPFGTREPGIFISHIVPGGIASKCGKLRMGDRILKVNEADVSKATH---QDAVLELLKPGDEIKLTIQHD-----PLPPGFQEVL---LSKAEGERLGMHIKGGLNGQRGNPADPSDEGVFVSKINSVGAARRDGRLKVGMRLLEVNGHSLLGASHQDAVNVLRNAGNEIQLVVCK 1426          

HSP 2 Score: 62.003 bits (149), Expect = 1.957e-9
Identity = 78/296 (26.35%), Postives = 114/296 (38.51%), Query Frame = 3
Query:  762 ASHIECRDVLSRISQSGDTIYLTIHRDIVDKRWL-PVAKEEILTFVLEKPTDRKMGLKLAGKTNKS---------GLYIQEVLPDSQASLDGRLKKDDRILKINEHDLVFGTQNEA-LEIIKSVKDSVKFVISRIVRPQTPDIIRAAGTEPDSNMTPIATSSSYPGLKNASTRGYEVGNSPFTFDSPISFKSTYREEVVEVDKKPGESLGMSVAGGVNSQRG------DTPVYITNIAPNSLLKNTNGIDKGDILLAVNETELLGLSHERAVEALKLARDNCNKVTVRVLKVPNLL 1598
            A+  E   V   I++S  T   T+   I D +   P+  EE+   VL K     +G  + G T+ S         G++I  ++P   AS  G+L+  DRILK+NE D+   T  +A LE++K   D +K  I     P                          PG +                              V + K  GE LGM + GG+N QRG      D  V+++ I      +    +  G  LL VN   LLG SH+ AV  L+ A +    V  +     NL+
Sbjct: 1201 AAPTELGRVTETITKS--TFTETVMTRITDNQLAEPLISEEV---VLPK-NQGSLGFSIIGGTDHSCVPFGTREPGIFISHIVPGGIASKCGKLRMGDRILKVNEADVSKATHQDAVLELLKP-GDEIKLTIQHDPLP--------------------------PGFQE-----------------------------VLLSKAEGERLGMHIKGGLNGQRGNPADPSDEGVFVSKINSVGAARRDGRLKVGMRLLEVNGHSLLGASHQDAVNVLRNAGNEIQLVVCKGYDKSNLI 1434          
BLAST of Ligand of Numb protein X 2 vs. Ensembl Zebrafish
Match: lnx2a (ligand of numb-protein X 2a [Source:ZFIN;Acc:ZDB-GENE-060228-2])

HSP 1 Score: 256.529 bits (654), Expect = 9.068e-75
Identity = 174/490 (35.51%), Postives = 266/490 (54.29%), Query Frame = 3
Query:  612 EFGVSFVGGFDTPLQCIVIQEIFRDGRIAMDGRLRPGDQITKINEYYLSQASHIECRDVLSRISQSGDTIYLTIHRDIVDKRWLPVAKEE-------ILTFVLEKPTDRKMGLKLAGKTNKSGLYIQEVLPDSQASLDGRLKKDDRILKINEHDLVFGTQNEALEIIKSVKDSVKFVISRIVRPQTPDIIRAAGTEPD----SNMTPI---ATSSSYPGLKNASTRGYEVGNSPFTFDSPISFKSTYREEVVEVDKKPGESLGMSVAGGVNSQRGDTPVYITNIAPNSLLKNTNGIDKGDILLAVNETELLGLSHERAVEALKLARDNCNKVTVRVLKV-----PNL---LLMANTDNF----IPSWMYWLKLPGYCQIPRMITLSRDAATGSLGFSIVGGNDPIYPFNTNSSLTDLSHNKEAPYRPIMIKSIVSGSPAHKNGRLKCGDILISINDFSLSNVSHSDAVNLFKSTQGPVHLKVVSWPGTII 2003
            E G+S VGG +TPL  +VIQE++RDG IA DGRL  GDQI ++N   +S   H   R  L+R      T+ LT+ R+       P A          I   + ++ +  ++G+KL  +T+++G++I ++L    A+ DGRL  +DR+L +NEHDL  GT   A +II++  + V  +ISR  + QT  +   +    D     ++ P+   AT S  P L  A +          +    +S     +E+ + V K+P ESLGM+VAGG  S+ G+ P+++T++ P+  L     I +GD+LL++N  +L  LSH  AV  LK +  +C+ V ++ L+V     P L   LL  + +++     PSW+ WL LP Y      I L R +  GS GFSIVGG    Y  N         H+ +A      IK+IV G+PA+ +GRLKCGD+++++N  S + +SHS  V + K  +  V L VVSWPG++I
Sbjct:  249 EMGISIVGGNETPLINVVIQEVYRDGVIARDGRLLAGDQILQVNNVDISNVPHNFARSTLARPCA---TLQLTVLRERRCSARPPAATASPKGSPASIRITLHKRESSEQLGIKLVRRTDEAGVFILDLLEGGLAAKDGRLCSNDRVLAVNEHDLRHGTPELAAQIIQASGERVNLLISRSSK-QTMAVHTGSTLTRDIWSHDHIPPLPSTATPSPVPSLHLARS----------STQRDLSQCVNCKEKHITVKKEPHESLGMTVAGGRGSKSGELPIFVTSVQPHGCLSRDGRIKRGDVLLSINGQDLTYLSHSEAVGTLKSSATSCS-VQLKALEVTMVEEPGLDEELLPPHENDYDASWSPSWVLWLGLPSYLHSSHEIVLRR-SHPGSWGFSIVGG----YEEN---------HSNQA----FFIKTIVLGTPAYYDGRLKCGDMIVAVNGLSTAGMSHSALVPMLKEQRSRVALTVVSWPGSLI 705          
BLAST of Ligand of Numb protein X 2 vs. Ensembl Zebrafish
Match: lnx2a (ligand of numb-protein X 2a [Source:ZFIN;Acc:ZDB-GENE-060228-2])

HSP 1 Score: 256.529 bits (654), Expect = 1.621e-74
Identity = 174/490 (35.51%), Postives = 266/490 (54.29%), Query Frame = 3
Query:  612 EFGVSFVGGFDTPLQCIVIQEIFRDGRIAMDGRLRPGDQITKINEYYLSQASHIECRDVLSRISQSGDTIYLTIHRDIVDKRWLPVAKEE-------ILTFVLEKPTDRKMGLKLAGKTNKSGLYIQEVLPDSQASLDGRLKKDDRILKINEHDLVFGTQNEALEIIKSVKDSVKFVISRIVRPQTPDIIRAAGTEPD----SNMTPI---ATSSSYPGLKNASTRGYEVGNSPFTFDSPISFKSTYREEVVEVDKKPGESLGMSVAGGVNSQRGDTPVYITNIAPNSLLKNTNGIDKGDILLAVNETELLGLSHERAVEALKLARDNCNKVTVRVLKV-----PNL---LLMANTDNF----IPSWMYWLKLPGYCQIPRMITLSRDAATGSLGFSIVGGNDPIYPFNTNSSLTDLSHNKEAPYRPIMIKSIVSGSPAHKNGRLKCGDILISINDFSLSNVSHSDAVNLFKSTQGPVHLKVVSWPGTII 2003
            E G+S VGG +TPL  +VIQE++RDG IA DGRL  GDQI ++N   +S   H   R  L+R      T+ LT+ R+       P A          I   + ++ +  ++G+KL  +T+++G++I ++L    A+ DGRL  +DR+L +NEHDL  GT   A +II++  + V  +ISR  + QT  +   +    D     ++ P+   AT S  P L  A +          +    +S     +E+ + V K+P ESLGM+VAGG  S+ G+ P+++T++ P+  L     I +GD+LL++N  +L  LSH  AV  LK +  +C+ V ++ L+V     P L   LL  + +++     PSW+ WL LP Y      I L R +  GS GFSIVGG    Y  N         H+ +A      IK+IV G+PA+ +GRLKCGD+++++N  S + +SHS  V + K  +  V L VVSWPG++I
Sbjct:  281 EMGISIVGGNETPLINVVIQEVYRDGVIARDGRLLAGDQILQVNNVDISNVPHNFARSTLARPCA---TLQLTVLRERRCSARPPAATASPKGSPASIRITLHKRESSEQLGIKLVRRTDEAGVFILDLLEGGLAAKDGRLCSNDRVLAVNEHDLRHGTPELAAQIIQASGERVNLLISRSSK-QTMAVHTGSTLTRDIWSHDHIPPLPSTATPSPVPSLHLARS----------STQRDLSQCVNCKEKHITVKKEPHESLGMTVAGGRGSKSGELPIFVTSVQPHGCLSRDGRIKRGDVLLSINGQDLTYLSHSEAVGTLKSSATSCS-VQLKALEVTMVEEPGLDEELLPPHENDYDASWSPSWVLWLGLPSYLHSSHEIVLRR-SHPGSWGFSIVGG----YEEN---------HSNQA----FFIKTIVLGTPAYYDGRLKCGDMIVAVNGLSTAGMSHSALVPMLKEQRSRVALTVVSWPGSLI 737          
BLAST of Ligand of Numb protein X 2 vs. Ensembl Zebrafish
Match: lnx2a (ligand of numb-protein X 2a [Source:ZFIN;Acc:ZDB-GENE-060228-2])

HSP 1 Score: 256.529 bits (654), Expect = 1.621e-74
Identity = 174/490 (35.51%), Postives = 266/490 (54.29%), Query Frame = 3
Query:  612 EFGVSFVGGFDTPLQCIVIQEIFRDGRIAMDGRLRPGDQITKINEYYLSQASHIECRDVLSRISQSGDTIYLTIHRDIVDKRWLPVAKEE-------ILTFVLEKPTDRKMGLKLAGKTNKSGLYIQEVLPDSQASLDGRLKKDDRILKINEHDLVFGTQNEALEIIKSVKDSVKFVISRIVRPQTPDIIRAAGTEPD----SNMTPI---ATSSSYPGLKNASTRGYEVGNSPFTFDSPISFKSTYREEVVEVDKKPGESLGMSVAGGVNSQRGDTPVYITNIAPNSLLKNTNGIDKGDILLAVNETELLGLSHERAVEALKLARDNCNKVTVRVLKV-----PNL---LLMANTDNF----IPSWMYWLKLPGYCQIPRMITLSRDAATGSLGFSIVGGNDPIYPFNTNSSLTDLSHNKEAPYRPIMIKSIVSGSPAHKNGRLKCGDILISINDFSLSNVSHSDAVNLFKSTQGPVHLKVVSWPGTII 2003
            E G+S VGG +TPL  +VIQE++RDG IA DGRL  GDQI ++N   +S   H   R  L+R      T+ LT+ R+       P A          I   + ++ +  ++G+KL  +T+++G++I ++L    A+ DGRL  +DR+L +NEHDL  GT   A +II++  + V  +ISR  + QT  +   +    D     ++ P+   AT S  P L  A +          +    +S     +E+ + V K+P ESLGM+VAGG  S+ G+ P+++T++ P+  L     I +GD+LL++N  +L  LSH  AV  LK +  +C+ V ++ L+V     P L   LL  + +++     PSW+ WL LP Y      I L R +  GS GFSIVGG    Y  N         H+ +A      IK+IV G+PA+ +GRLKCGD+++++N  S + +SHS  V + K  +  V L VVSWPG++I
Sbjct:  281 EMGISIVGGNETPLINVVIQEVYRDGVIARDGRLLAGDQILQVNNVDISNVPHNFARSTLARPCA---TLQLTVLRERRCSARPPAATASPKGSPASIRITLHKRESSEQLGIKLVRRTDEAGVFILDLLEGGLAAKDGRLCSNDRVLAVNEHDLRHGTPELAAQIIQASGERVNLLISRSSK-QTMAVHTGSTLTRDIWSHDHIPPLPSTATPSPVPSLHLARS----------STQRDLSQCVNCKEKHITVKKEPHESLGMTVAGGRGSKSGELPIFVTSVQPHGCLSRDGRIKRGDVLLSINGQDLTYLSHSEAVGTLKSSATSCS-VQLKALEVTMVEEPGLDEELLPPHENDYDASWSPSWVLWLGLPSYLHSSHEIVLRR-SHPGSWGFSIVGG----YEEN---------HSNQA----FFIKTIVLGTPAYYDGRLKCGDMIVAVNGLSTAGMSHSALVPMLKEQRSRVALTVVSWPGSLI 737          
BLAST of Ligand of Numb protein X 2 vs. Ensembl Zebrafish
Match: lnx1 (ligand of numb-protein X 1 [Source:ZFIN;Acc:ZDB-GENE-030131-9439])

HSP 1 Score: 245.358 bits (625), Expect = 2.687e-70
Identity = 169/530 (31.89%), Postives = 266/530 (50.19%), Query Frame = 3
Query:  549 LDNLEFNVEDFTITIINPERLE----FGVSFVGGFDTPLQCIVIQEIFRDGRIAMDGRLRPGDQITKINEYYLSQASHIECRDVLSRISQSGDTIYLTIHRDIVDK--------------RWLPVAKEEILTFVLEKPTDRKMGLKLAGKTNKSGLYIQEVLPDSQASLDGRLKKDDRILKINEHDLVFGTQNEALEIIKSVKDSVKFVISRIVRPQTPDIIRAA--GTEPDSNMTPIATSSSYPGLKNASTRGYEVGNSPFTFDSPISFKSTYREEVVEVDKKPGESLGMSVAGGVNSQRGDTPVYITNIAPNSLLKNTNGIDKGDILLAVNETELLGLSHERAVEALKLARDNCNKVTVRVLKV--PN-----------------------LLLMANTDNFIPSWMYWLKLPGYCQIPRMITLSRDAATGSLGFSIVGGNDPIYPFNTNSSLTDLSHNKEAPYRPIMIKSIVSGSPAHKNGRLKCGDILISINDFSLSNVSHSDAVNLFKSTQGPVHLKVVSWPGTII 2003
            L  L   + D  +T I   R +      +S VGG +TPL  I+IQ+I+R+G IA DGRL PGD I K+N   +S   H  C  V + + Q    + LT+ R+   +                  +  + +   ++++  D ++G+KL  + ++ G++I  +L    A+ DGRL+ DDR+L IN HDL +G    A  +I++ +D V F++SR      PDI++ A    E     +P+    +                     DS    K    E+ V + K+P +SLGM+VAGG++S+  D PVY+TN+ PN ++     I KGDILL VN  +L G++   AV  LK   +  + V ++VL++  PN                       + L    D++ P W+ WL+LP +    + I L R + +GSLGFSIVGG + +   N N S                I+SIV G+PA+ +GR++CGDIL+ +N  S   ++H+  V L K  +G + L +VSWPG+++
Sbjct:  270 LPQLHHLIPDGEVTSIKITRADPCEPLAISIVGGNETPLVRILIQDIYREGVIARDGRLLPGDMILKVNGIDISNVPH--CYAVAA-LKQPCTLLRLTVLREQRHRYRSHHHSPTEAFPAHTATIRDDSLHVVLVKRAPDEQLGIKLVRRPDEHGVFIFHLLEGGLAARDGRLRVDDRVLAINGHDLRYGAPEHAALLIQASEDRVHFIVSRQTHIPAPDILQEAPWNMEGPPPYSPVDIEHTL-------------------LDS--CQKPACYEKTVTLLKEPHDSLGMTVAGGMSSRGWDLPVYVTNVDPNGVVGQEGSIRKGDILLNVNGVDLTGVTRSEAVANLK---NTSSPVVLQVLEMRPPNESSLDCMPPLHSPCALSPSSPGDVKLPPPNDDYAPLWVSWLQLPRHLYCCKDIVLRR-STSGSLGFSIVGGQEEL---NCNQSF--------------FIRSIVEGTPAYNDGRIRCGDILLEVNGKSTWGMTHTALVRLLKELRGRITLTIVSWPGSLL 754          
BLAST of Ligand of Numb protein X 2 vs. Ensembl Zebrafish
Match: lnx1 (ligand of numb-protein X 1 [Source:ZFIN;Acc:ZDB-GENE-030131-9439])

HSP 1 Score: 244.973 bits (624), Expect = 4.444e-70
Identity = 169/530 (31.89%), Postives = 266/530 (50.19%), Query Frame = 3
Query:  549 LDNLEFNVEDFTITIINPERLE----FGVSFVGGFDTPLQCIVIQEIFRDGRIAMDGRLRPGDQITKINEYYLSQASHIECRDVLSRISQSGDTIYLTIHRDIVDK--------------RWLPVAKEEILTFVLEKPTDRKMGLKLAGKTNKSGLYIQEVLPDSQASLDGRLKKDDRILKINEHDLVFGTQNEALEIIKSVKDSVKFVISRIVRPQTPDIIRAA--GTEPDSNMTPIATSSSYPGLKNASTRGYEVGNSPFTFDSPISFKSTYREEVVEVDKKPGESLGMSVAGGVNSQRGDTPVYITNIAPNSLLKNTNGIDKGDILLAVNETELLGLSHERAVEALKLARDNCNKVTVRVLKV--PN-----------------------LLLMANTDNFIPSWMYWLKLPGYCQIPRMITLSRDAATGSLGFSIVGGNDPIYPFNTNSSLTDLSHNKEAPYRPIMIKSIVSGSPAHKNGRLKCGDILISINDFSLSNVSHSDAVNLFKSTQGPVHLKVVSWPGTII 2003
            L  L   + D  +T I   R +      +S VGG +TPL  I+IQ+I+R+G IA DGRL PGD I K+N   +S   H  C  V + + Q    + LT+ R+   +                  +  + +   ++++  D ++G+KL  + ++ G++I  +L    A+ DGRL+ DDR+L IN HDL +G    A  +I++ +D V F++SR      PDI++ A    E     +P+    +                     DS    K    E+ V + K+P +SLGM+VAGG++S+  D PVY+TN+ PN ++     I KGDILL VN  +L G++   AV  LK   +  + V ++VL++  PN                       + L    D++ P W+ WL+LP +    + I L R + +GSLGFSIVGG + +   N N S                I+SIV G+PA+ +GR++CGDIL+ +N  S   ++H+  V L K  +G + L +VSWPG+++
Sbjct:  281 LPQLHHLIPDGEVTSIKITRADPCEPLAISIVGGNETPLVRILIQDIYREGVIARDGRLLPGDMILKVNGIDISNVPH--CYAVAA-LKQPCTLLRLTVLREQRHRYRSHHHSPTEAFPAHTATIRDDSLHVVLVKRAPDEQLGIKLVRRPDEHGVFIFHLLEGGLAARDGRLRVDDRVLAINGHDLRYGAPEHAALLIQASEDRVHFIVSRQTHIPAPDILQEAPWNMEGPPPYSPVDIEHTL-------------------LDS--CQKPACYEKTVTLLKEPHDSLGMTVAGGMSSRGWDLPVYVTNVDPNGVVGQEGSIRKGDILLNVNGVDLTGVTRSEAVANLK---NTSSPVVLQVLEMRPPNESSLDCMPPLHSPCALSPSSPGDVKLPPPNDDYAPLWVSWLQLPRHLYCCKDIVLRR-STSGSLGFSIVGGQEEL---NCNQSF--------------FIRSIVEGTPAYNDGRIRCGDILLEVNGKSTWGMTHTALVRLLKELRGRITLTIVSWPGSLL 765          
BLAST of Ligand of Numb protein X 2 vs. Ensembl Xenopus
Match: ddx54 (DEAD-box helicase 54 [Source:Xenbase;Acc:XB-GENE-1011576])

HSP 1 Score: 247.669 bits (631), Expect = 1.284e-71
Identity = 170/500 (34.00%), Postives = 263/500 (52.60%), Query Frame = 3
Query:  585 ITIINPER----LEFGVSFVGGFDTPLQCIVIQEIFRDGRIAMDGRLRPGDQITKINEYYLSQASHIECRDVLSRISQSGDTIYLTIHRDIVDKRWLPVA---------KEEILTFVLEKP-TDRKMGLKLAGKTNKSGLYIQEVLPDSQASLDGRLKKDDRILKINEHDLVFGTQNEALEIIKSVKDSVKFVISRIVRPQTPDIIRAAGTEPDSNMTPIATSSSYPGLKNASTRGYEVGNSPFTFDSPISFKSTYREEVVEVDKKPGESLGMSVAGGVNSQRGDTPVYITNIAPNSLLKNTNGIDKGDILLAVNETELLGLSHERAVEALKLARDNCNKVTVRVLKV-------PNLLLMANTD------NFIPSWMYWLKLPGYCQIPRMITLSRDAATGSLGFSIVGGNDPIYPFNTNSSLTDLSHNKEAPYRPIMIKSIVSGSPAHKNGRLKCGDILISINDFSLSNVSHSDAVNLFKSTQGPVHLKVVSWPGTII 2003
            IT I   R    +E G+S VGG +TPL  +VIQEI+RDG IA DGRL  GDQI ++N + +S  SH   R VLS   Q    ++LT+ R+   +R+   A         ++E     L K  ++ ++G+KL  +T++SG++I ++L    A+ DGRL  +DR+L IN  DL  GT   A +II+   + V   +SR  + Q  +I R  G     + T                   +V +   +    ++     +E+ + V K+P ESLGM+VAGG  S+ G+ P+++T++ P+  L   + I +GD+LL++N  +L  LSH  AV  LK A    + V+++ ++V       P    M+         ++ PSW+ WL LP        + L R ++ GS GFSIVGG    Y  N  +             +P  IK+IV G+PA+ +GRLKCGD++I++N  S   +SHS  V + K  +  V L V+SWPG+++
Sbjct:  229 ITTIEIHRSNPYIELGISIVGGNETPLINVVIQEIYRDGVIARDGRLLAGDQILQVNNFDISNVSHNYARWVLS---QPCTVLHLTVLRE---RRFGSRAHGHGDGGSQRDESFHITLNKRGSNEQLGIKLVRRTDESGVFILDLLEGGLAAQDGRLHSNDRVLAINGLDLKHGTPELAAQIIQGSGERVNLTVSRPGKHQPGNITRDLGMNQPHHHT------------------QQVYHHRPSAHKDLAQCVKCQEKHITVKKEPQESLGMTVAGGRGSKSGELPIFVTSVQPHGCLARDSRIKRGDVLLSINGIDLTNLSHSEAVAMLK-ASATSSVVSLKAIEVEVIEEQTPGKEEMSTVSENEYDASWSPSWVMWLGLPSCLHSCHDVVLRR-SSLGSWGFSIVGG----YEENHTN-------------QPFFIKTIVLGTPAYYDGRLKCGDMIIAVNGLSTVGMSHSALVPMLKEQRNKVTLSVISWPGSLV 685          
BLAST of Ligand of Numb protein X 2 vs. Ensembl Xenopus
Match: LNX1 (ligand of numb-protein X 1 [Source:NCBI gene;Acc:100487348])

HSP 1 Score: 236.113 bits (601), Expect = 1.105e-67
Identity = 174/505 (34.46%), Postives = 258/505 (51.09%), Query Frame = 3
Query:  570 VEDFTITIINPERLEF----GVSFVGGFDTPLQCIVIQEIFRDGRIAMDGRLRPGDQITKINEYYLSQASHIECRDVLSRISQSGDTIYLTIHRDIVDK-RWLPVAKEE------ILTFVLEKPT-DRKMGLKLAGKTNKSGLYIQEVLPDSQASLDGRLKKDDRILKINEHDLVFGTQNEALEIIKSVKDSVKFVISRIVRPQTPDIIRAAGTEPDSNMTPIATSSSYPGLKNASTRGYEVGNSPFTFDSPISFKSTYREEVVEVDKKPGESLGMSVAGGVNSQRGDTPVYITNIAPNSLLKNTNGIDKGDILLAVNETELLGLSHERAVEALKLARDNCNKVTVRVLK--------VPNLLLMANTDN-------FIPSWMYWLKLPGYCQIPRMITLSRDAATGSLGFSIVGGNDPIYPFNTNSSLTDLSHNKEAPYRPIMIKSIVSGSPAHKNGRLKCGDILISINDFSLSNVSHSDAVNLFKSTQGPVHLKVVSWPGTII 2003
            + D  IT I   R +     G+  VGG +TPL  I+IQ I++DG I  DGRL PGD I K+N   +S   H      LS + Q    + LT+ R+   K R   V  E+       +  VL K + D ++G+KL  + ++ G+YI  +L    A+ DG L+++DR+L IN HDL  GT   A ++I++ ++ V F++SR  R QTPDI++ A    ++N +P   ++          R Y        F+   S      E+VV + K   ESLGM+VAGG ++   D P+++T++  + ++     +  GDILL VN   L G+S   AV  LK +  +   +    +K        + N L M    N       + P W+ WL LP Y    R + L R+ A GSLGFSIVGG+D            D S  K     P  IKSI+ G+PAH +GRL+CGDIL+ +N    S + ++  V + K  +G V L +VSWPG+ +
Sbjct:  176 IPDGEITCIKINRADLNEILGIRIVGGNETPLTQIIIQHIYQDGVIGRDGRLLPGDMILKVNGIDISSVPHTYA---LSILRQPSKVLRLTVLREQRYKCRTNGVTMEQHSPQDDSIHVVLNKSSHDVQLGIKLVRRRDEPGIYIFNLLEGGVAARDGYLQENDRVLSINGHDLRNGTPEIAAQLIQASEEGVYFIVSRHSRHQTPDILQEARWH-NNNDSPATCTNE---------RNY--------FNKNASRTVLCHEKVVSITKDNTESLGMTVAGGASNWEWDLPIFVTSVDADGVIGRDGRLKTGDILLNVNGINLTGVSRSEAVSLLKNSSSSSVVLKALEIKEYEPEEDNLNNALYMDYLQNGSEQNREWSPVWVMWLNLPHYLYSCREVVLRRNTA-GSLGFSIVGGSD------------DCSRIK-----PFFIKSILEGTPAHHDGRLRCGDILLEVNGRCTSGMPYNSLVRMLKEIRGRVVLTIVSWPGSYL 641          
BLAST of Ligand of Numb protein X 2 vs. Ensembl Xenopus
Match: LNX1 (ligand of numb-protein X 1 [Source:NCBI gene;Acc:100487348])

HSP 1 Score: 237.269 bits (604), Expect = 2.930e-67
Identity = 171/507 (33.73%), Postives = 260/507 (51.28%), Query Frame = 3
Query:  570 VEDFTITIINPERLEF----GVSFVGGFDTPLQCIVIQEIFRDGRIAMDGRLRPGDQITKINEYYLSQASHIECRDVLSRISQSGDTIYLTIHRD---------IVDKRWLPVAKEEILTFVLEKPT-DRKMGLKLAGKTNKSGLYIQEVLPDSQASLDGRLKKDDRILKINEHDLVFGTQNEALEIIKSVKDSVKFVISRIVRPQTPDIIRAAGTEPDSNMTPIATSSSYPGLKNASTRGYEVGNSPFTFDSPISFKSTYREEVVEVDKKPGESLGMSVAGGVNSQRGDTPVYITNIAPNSLLKNTNGIDKGDILLAVNETELLGLSHERAVEALKLARDNCNKVTVRVLK--------VPNLLLMANTDN-------FIPSWMYWLKLPGYCQIPRMITLSRDAATGSLGFSIVGGNDPIYPFNTNSSLTDLSHNKEAPYRPIMIKSIVSGSPAHKNGRLKCGDILISINDFSLSNVSHSDAVNLFKSTQGPVHLKVVSWPGTII 2003
            + D  IT I   R +     G+  VGG +TPL  I+IQ I++DG I  DGRL PGD I K+N   +S   H      LS + Q    + LT+ R+         +  ++  P  +++ +  VL K + D ++G+KL  + ++ G+YI  +L    A+ DG L+++DR+L IN HDL  GT   A ++I++ ++ V F++SR  R QTPDI++ A    ++N +P   ++          R Y        F+   S      E+VV + K   ESLGM+VAGG ++   D P+++T++  + ++     +  GDILL VN   L G+S   AV  LK +  +   +    +K        + N L M    N       + P W+ WL LP Y    R + L R+ A GSLGFSIVGG+D            D S  K     P  IKSI+ G+PAH +GRL+CGDIL+ +N    S + ++  V + K  +G V L +VSWPG+ +
Sbjct:  277 IPDGEITCIKINRADLNEILGIRIVGGNETPLTQIIIQHIYQDGVIGRDGRLLPGDMILKVNGIDISSVPHTY---ALSILRQPSKVLRLTVLREQRYKCRTNGVTMEQHSP--QDDSIHVVLNKSSHDVQLGIKLVRRRDEPGIYIFNLLEGGVAARDGYLQENDRVLSINGHDLRNGTPEIAAQLIQASEEGVYFIVSRHSRHQTPDILQEARWH-NNNDSPATCTNE---------RNY--------FNKNASRTVLCHEKVVSITKDNTESLGMTVAGGASNWEWDLPIFVTSVDADGVIGRDGRLKTGDILLNVNGINLTGVSRSEAVSLLKNSSSSSVVLKALEIKEYEPEEDNLNNALYMDYLQNGSEQNREWSPVWVMWLNLPHYLYSCREVVLRRNTA-GSLGFSIVGGSD------------DCSRIK-----PFFIKSILEGTPAHHDGRLRCGDILLEVNGRCTSGMPYNSLVRMLKEIRGRVVLTIVSWPGSYL 742          
BLAST of Ligand of Numb protein X 2 vs. Ensembl Xenopus
Match: c1qb (complement C1q B chain [Source:Xenbase;Acc:XB-GENE-6251287])

HSP 1 Score: 200.675 bits (509), Expect = 1.155e-54
Identity = 160/505 (31.68%), Postives = 243/505 (48.12%), Query Frame = 3
Query:  585 ITIINPERLEFGVSFVGGFDTPLQCIVIQEIFRDGRIAMDGRLRPGDQITKINEYYLSQASHIECRDVLSRISQSGDTIYLTIHRDIVDKRWLPVAKE------------EILTFVLEKPTDRK--MGLKLAGKTNKSGLYIQEVLPDSQASLDGRLKKDDRILKINEHDLVFGTQNEALEIIKSVKDSVKFVISRIVRPQTPDIIRAAGTEPDSNMTPIATSSSYPGL---KNASTRGYEVGNSPFTFDSPISFKSTYREEVVEVDKKPGESLGMSVAGGVNSQRGDTPVYITNIAPNSLLKNTNGIDKGDILLAVNETELLGLSHERAVEALKLARDNCNKVTVRVLKVPNLLLMANTDNFI---------------PSWMYWLKLPGYCQIPRMITLSRDAATGSLGFSIVGGNDPIYPFNTNSSLTDLSHNKEAPYRPIMIKSIVSGSPAHKNGRLKCGDILISINDFSLSNVSHSDAVNLFKSTQGPVHLKVVSWPGTII 2003
            I  ++PE    G+  VGG DTPL  IV+QEI  D  +A DG++ PGD I ++N   +S  +H +    ++ + Q    + LT+   + +K + P +              +++   L K  DR   +G+KL  KT + G+++ ++L    A  DGRLK +D++L IN H+L  GT   A +II+S +  V FV+ R +  Q  DI   + +   SN          P L   +  ST   +V   P              E+ V V K+  ESLG+++ GG    +   P+Y+++I P   L     I KGD+LL++N T+L  LS+  A+ ALK    N    TV VLK   + +    D  +               P W+YWL LP      R ITL R  ++ S GFSIVGG      F                 +P  IK+IV G+PA  + RLKCGD ++ +N  S   +S++  + + K  +  V L VVSWPG+++
Sbjct:  219 IHRVDPEN-PLGMRIVGGKDTPLGNIVVQEILTDSLVATDGKVTPGDHILEVNGTNISNVTHSQ---AIALLRQPCSVLQLTL---VQEKGFSPQSSRTENSTGGSPHSTKVIQVTLTK-RDRSEPLGIKLVRKTEEPGIFVLDLLDGGLAYKDGRLKCNDKVLSINGHNLKHGTPETAAQIIQSSEARVNFVVLRHMIDQPVDINEESSSSGSSNGGSPVHPRKRPSLRPNRRKSTHHKDVNPGP-----------PDHEKSVNVKKEQYESLGITIGGG-RDLKNKLPIYVSSIQPVGCLFRDGRIRKGDVLLSINGTDLTSLSYSDAISALK---TNAASHTV-VLKALEVTVGERLDEPVEHAAGVTREPGGIWSPLWVYWLALPSSLHWCRHITL-RKTSSESWGFSIVGG------FEEGKG-----------DQPFFIKTIVPGTPAFYDKRLKCGDEIVEVNGVSAVGMSNAQLIPMLKEQKNRVTLTVVSWPGSLV 681          
BLAST of Ligand of Numb protein X 2 vs. Ensembl Xenopus
Match: nphp3 (nephronophthisis 3 (adolescent) [Source:Xenbase;Acc:XB-GENE-487873])

HSP 1 Score: 185.652 bits (470), Expect = 6.221e-50
Identity = 144/485 (29.69%), Postives = 234/485 (48.25%), Query Frame = 3
Query:  573 EDFTITIINPERLEFGVSFVGGFDTPLQCIVIQEIFRDGRIAMDGRLRPGDQITKINEYYLSQASHIECRDVLSRISQSGDTIYLTIHRDIVDKRWLPVAKEEILTFVLEKPTDRKMGLKLAGKTNKSGLYIQEVLPDSQASLDGRLKKDDRILKINEHDLVFGTQNEALEIIKSVKDSVKFVISRIVRPQTPDIIRAAGTEPDSNMTPIATSSSYPGLKN---ASTRGYEVGNSPFTFDSPISFKSTYREEVVEVDKKPGESLGMSVAGGVNSQRGDTPVYITNIAPNSLLKNTNGIDKGDILLAVNETELLGLSHERAVEALKLARDNCNKVTVRVLKVPNLLLMANTDNFIPSWMYWLKLP-----------GYCQIPRMITLSRDAATGSLGFSIVGGNDPIYPFNTNSSLTDLSHNKEAPYRPIMIKSIVSGSPAHKNGRLKCGDILISINDFSLSNVSHSDAVNLFKSTQGPVHLKVVS 1985
            ++ TI I +  R   G+S VGG DTPL+ IVI E++ +G  A DGRL  GDQI ++N   L  ASH    D ++ + Q+   + LT++RD  + ++      +I    L+K   R +GL + GK   SG++I +++    A +DGRL + D+I+ +N  D+   +Q     ++K  +  V   I R+   +    + +  T   S +  +++    P       +S + Y          S     +      VE+++ P ++LG+S+AGG  S  GD PV+I  I  + +   T+ +  GD L+++N+  + GLSH   V  LK A      + ++V+   N+       + I S +  + L            G   +P++I L +      LGFSIVGG          S   DL         PI +K+I S   A  +GRLK GD ++S+N  SL  V+H +AV + K  +G V L V+S
Sbjct:  141 QEMTIEI-SKGRSGLGLSIVGGNDTPLEAIVIHEVYEEGAAARDGRLWAGDQILEVNGVDLRNASH---EDAITALRQTPQKVQLTVYRD--EAQYKDEENLDIFHVELQKKAGRGLGLSIVGKRTGSGVFISDIVKGGAADIDGRLMQGDQIMSVNGDDMRNASQEIVATVLKCAQGLVHLEIGRL---RVGSWLASKKTFEASQINQMSSHGVLPPSLTPVISSMQDYASSKKSSADSSQRHSGTDLEPRTVEINRGPYDALGISIAGGKGSPLGDIPVFIAMIQASGVAARTHKLKVGDRLVSINQQPVDGLSHAEVVNILKHA---FGTIVLQVVADTNI-------SAIASQLESMSLGQGVSSEHQVEDGESPVPKIIHLEKGGD--GLGFSIVGG--------YGSPQGDL---------PIYVKTIFSKGAAAADGRLKRGDQILSVNGESLEGVTHDEAVAILKKQRGNVTLSVLS 587          

HSP 2 Score: 71.2478 bits (173), Expect = 3.362e-12
Identity = 65/230 (28.26%), Postives = 97/230 (42.17%), Query Frame = 3
Query: 1317 EVVEVDKKPGESLGMSVAGGVNSQRGDTPVYITNIAPNSLLKNTNGIDKGDILLAVNETELLGLSHERAVEALKLARDNC------NKVTVRVLKV-PNLLLMANTDNFIPSWMYWLKLPGYCQI--PRMITLSRDAATGSLGFSIVGGNDPIYPFNTNSSLTDLSHNKEAPYRPIMIKSIVSGSPAHKNGRLKCGDILISINDFSLSNVSHSDAVNLFKSTQGPVHLKV 1979
             ++E++K     LG+S+AG  N  R    +++  I P+        I  GD LL +N   + G SH+ A   +K A          NK  V+ + V P+ L   N  + +PS+      P  C I   + +T+        LG SIVGGND                    P   I+I  +     A ++GRL  GD ++ +N   L N SH DA+   + T   V L V
Sbjct:   21 HIIELEKDK-NGLGLSLAG--NKDRSRMSIFVVAINPDGPAGQDGRIHVGDELLEINNQIIYGKSHQNASAIIKGAPSTLKLVFIRNKDAVQQMAVNPDPLPERNMPSPLPSFD-----PATCPIIPGQEMTIEISKGRSGLGLSIVGGND-------------------TPLEAIVIHEVYEEGAAARDGRLWAGDQILEVNGVDLRNASHEDAITALRQTPQKVQLTV 223          
BLAST of Ligand of Numb protein X 2 vs. Ensembl Mouse
Match: Lnx2 (ligand of numb-protein X 2 [Source:MGI Symbol;Acc:MGI:2155959])

HSP 1 Score: 262.692 bits (670), Expect = 3.756e-77
Identity = 179/508 (35.24%), Postives = 264/508 (51.97%), Query Frame = 3
Query:  564 FNVEDFTITIINPER----LEFGVSFVGGFDTPLQCIVIQEIFRDGRIAMDGRLRPGDQITKINEYYLSQASHIECRDVLSRISQSGDTIYLTIHRDIVDKRWLPVA---------KEEILTFVLEK-PTDRKMGLKLAGKTNKSGLYIQEVLPDSQASLDGRLKKDDRILKINEHDLVFGTQNEALEIIKSVKDSVKFVISRIVRPQTPDIIRAAGTEPDSNMTPIATSSSYPGLKNASTRGYEVGNSPFTFDSPISFKSTYREEVVEVDKKPGESLGMSVAGGVNSQRGDTPVYITNIAPNSLLKNTNGIDKGDILLAVNETELLGLSHERAVEALKLARDNCNKVTVRVLKV-------------PNLLLMANTD-NFIPSWMYWLKLPGYCQIPRMITLSRDAATGSLGFSIVGGNDPIYPFNTNSSLTDLSHNKEAPYRPIMIKSIVSGSPAHKNGRLKCGDILISINDFSLSNVSHSDAVNLFKSTQGPVHLKVVSWPGTII 2003
             ++ +  IT I   R    ++ G+S VGG +TPL  IVIQE++RDG IA DGRL  GDQI ++N Y +S  SH   R VLS   Q   T+ LT+ R+   +R+   A         ++E+   +L K  +  ++G+KL  +T++ G++I ++L    A+ DGRL  +DR+L IN HDL  GT   A +II++  + V   I+R  +PQ  +  R AG    SN      S S PG     TR                   T +E+ + V K+P ESLGM+VAGG  S+ G+ P+++T++ P+  L     I +GD+LL +N  +L  LSH  AV  LK A      V ++ L+V             P+       D ++ PSW+ WL LP        I L R +  GS GFSIVGG    Y  N  +             +P  IK+IV G+PA+ +GRLKCGD+++++N  S   +SHS  V + K  +  V L V+ WPG+++
Sbjct:  223 LSLPEGEITTIEIHRSNPYIQLGISIVGGNETPLINIVIQEVYRDGVIARDGRLLAGDQILQVNNYDISNVSHNHARAVLS---QPCSTLQLTVLRE---RRFGSRANSHADGSAPRDEVFQVLLHKRDSTEQLGIKLVRRTDEPGVFILDLLEGGLAAQDGRLNSNDRVLAINGHDLKHGTPELAAQIIQASGERVNLTIARPGKPQPSNGSREAGAHSSSNHAQ-PPSHSRPGSHKDLTRCV-----------------TCQEKHITVKKEPHESLGMTVAGGRGSKSGELPIFVTSVPPHGCLARDGRIKRGDVLLNINGIDLTNLSHSEAVAMLK-ASAASPAVILKALEVQIAEEAAQATEEQPSAFSENEYDASWSPSWVMWLGLPSALHSCHDIVLRR-SYLGSWGFSIVGG----YEENHTN-------------QPFFIKTIVLGTPAYYDGRLKCGDMIVAVNGLSTVGMSHSALVPMLKEQRNKVTLTVICWPGSLV 687          
BLAST of Ligand of Numb protein X 2 vs. Ensembl Mouse
Match: Lnx1 (ligand of numb-protein X 1 [Source:MGI Symbol;Acc:MGI:1278335])

HSP 1 Score: 243.817 bits (621), Expect = 8.841e-71
Identity = 174/521 (33.40%), Postives = 264/521 (50.67%), Query Frame = 3
Query:  543 NHLDNLEFNVEDFT------ITIINPERLE----FGVSFVGGFDTPLQCIVIQEIFRDGRIAMDGRLRPGDQITKINEYYLSQASHIECRDVLSRISQSGDTIYLTIHRDI---------VDKRWLPVAKEEILTFVLEKPT-DRKMGLKLAGKTNKSGLYIQEVLPDSQASLDGRLKKDDRILKINEHDLVFGTQNEALEIIKSVKDSVKFVISRIVRPQTPDIIRAAGTEPDSNMTPIATSSSYPGLKNASTRGYEVGNSPFTFDSPISFKSTYREEVVEVDKKPGESLGMSVAGGVNSQRGDTPVYITNIAPNSLLKNTNGIDKGDILLAVNETELLGLSHERAVEALKLARDNCNKVTVRVLKVPN---------LLLMANTD-----NFIPSWMYWLKLPGYCQIPRMITLSRDAATGSLGFSIVGGNDPIYPFNTNSSLTDLSHNKEAPYRPIMIKSIVSGSPAHKNGRLKCGDILISINDFSLSNVSHSDAVNLFKSTQGPVHLKVVSWPGTII 2003
            NH+D    N E+ T      IT I   R +      +  VGG +TPL  I+IQ I+RDG IA DGRL PGD I K+N   +S   H     +L +  Q    + LT+ R+          V   + P  +++    +L K + + ++G+KL  + ++ G++I  VL    A   G+L+++DR+L IN HDL FG+   A  +I++ +  V  V+SR VR  +PDI + AG   +   +P       PG +N +++                  +T  E+VV V K P ESLGM+V GG + +  D P+Y+ ++ P  ++     I  GDILL VN  EL  +S   AV  LK A    + V ++ L+V             L +N +     ++ PSW+ WL+LP Y    + + L R+ A GSLGF IVGG +            + S NK     P  IKSIV G+PA+ +GR++CGDIL+++N  S S + H+    + K  +G + L + SWPGT +
Sbjct:  146 NHVDQGRDNSENTTVPEDGEITSIKINRADPSESLSIRLVGGSETPLVHIIIQHIYRDGVIARDGRLLPGDIILKVNGMDISNVPHNYAVRLLRQPCQ---VLRLTVLREQKFRSRSNAHVPDSYGP--RDDSFHVILNKSSPEEQLGIKLVRRVDEPGVFIFNVLNGGVADRHGQLEENDRVLAINGHDLRFGSPESAAHLIQASERRVHLVVSRQVRQSSPDIFQEAGWISNGQQSP------GPGERNTASKP----------------AATCHEKVVSVWKDPSESLGMTVGGGASHREWDLPIYVISVEPGGVISRDGRIKTGDILLNVNGIELTEVSRTEAVAILKSA---PSSVVLKALEVKEQEAQEDCSPAALDSNHNVTPPGDWSPSWVMWLELPQYLCNCKDVILRRNTA-GSLGFCIVGGYE------------EYSGNK-----PFFIKSIVEGTPAYNDGRIRCGDILLAVNGRSTSGMIHACLARMLKELKGRITLTIASWPGTFL 618          
BLAST of Ligand of Numb protein X 2 vs. Ensembl Mouse
Match: Lnx1 (ligand of numb-protein X 1 [Source:MGI Symbol;Acc:MGI:1278335])

HSP 1 Score: 240.35 bits (612), Expect = 4.381e-70
Identity = 169/506 (33.40%), Postives = 258/506 (50.99%), Query Frame = 3
Query:  570 VEDFTITIINPERLE----FGVSFVGGFDTPLQCIVIQEIFRDGRIAMDGRLRPGDQITKINEYYLSQASHIECRDVLSRISQSGDTIYLTIHRDI---------VDKRWLPVAKEEILTFVLEKPT-DRKMGLKLAGKTNKSGLYIQEVLPDSQASLDGRLKKDDRILKINEHDLVFGTQNEALEIIKSVKDSVKFVISRIVRPQTPDIIRAAGTEPDSNMTPIATSSSYPGLKNASTRGYEVGNSPFTFDSPISFKSTYREEVVEVDKKPGESLGMSVAGGVNSQRGDTPVYITNIAPNSLLKNTNGIDKGDILLAVNETELLGLSHERAVEALKLARDNCNKVTVRVLKVPN---------LLLMANTD-----NFIPSWMYWLKLPGYCQIPRMITLSRDAATGSLGFSIVGGNDPIYPFNTNSSLTDLSHNKEAPYRPIMIKSIVSGSPAHKNGRLKCGDILISINDFSLSNVSHSDAVNLFKSTQGPVHLKVVSWPGTII 2003
            + D  IT I   R +      +  VGG +TPL  I+IQ I+RDG IA DGRL PGD I K+N   +S   H     +L +  Q    + LT+ R+          V   + P  +++    +L K + + ++G+KL  + ++ G++I  VL    A   G+L+++DR+L IN HDL FG+   A  +I++ +  V  V+SR VR  +PDI + AG   +   +P       PG +N +++                  +T  E+VV V K P ESLGM+V GG + +  D P+Y+ ++ P  ++     I  GDILL VN  EL  +S   AV  LK A    + V ++ L+V             L +N +     ++ PSW+ WL+LP Y    + + L R+ A GSLGF IVGG +            + S NK     P  IKSIV G+PA+ +GR++CGDIL+++N  S S + H+    + K  +G + L + SWPGT +
Sbjct:  112 IPDGEITSIKINRADPSESLSIRLVGGSETPLVHIIIQHIYRDGVIARDGRLLPGDIILKVNGMDISNVPHNYAVRLLRQPCQ---VLRLTVLREQKFRSRSNAHVPDSYGP--RDDSFHVILNKSSPEEQLGIKLVRRVDEPGVFIFNVLNGGVADRHGQLEENDRVLAINGHDLRFGSPESAAHLIQASERRVHLVVSRQVRQSSPDIFQEAGWISNGQQSP------GPGERNTASKP----------------AATCHEKVVSVWKDPSESLGMTVGGGASHREWDLPIYVISVEPGGVISRDGRIKTGDILLNVNGIELTEVSRTEAVAILKSA---PSSVVLKALEVKEQEAQEDCSPAALDSNHNVTPPGDWSPSWVMWLELPQYLCNCKDVILRRNTA-GSLGFCIVGGYE------------EYSGNK-----PFFIKSIVEGTPAYNDGRIRCGDILLAVNGRSTSGMIHACLARMLKELKGRITLTIASWPGTFL 569          
BLAST of Ligand of Numb protein X 2 vs. Ensembl Mouse
Match: Lnx1 (ligand of numb-protein X 1 [Source:MGI Symbol;Acc:MGI:1278335])

HSP 1 Score: 240.35 bits (612), Expect = 4.381e-70
Identity = 169/506 (33.40%), Postives = 258/506 (50.99%), Query Frame = 3
Query:  570 VEDFTITIINPERLE----FGVSFVGGFDTPLQCIVIQEIFRDGRIAMDGRLRPGDQITKINEYYLSQASHIECRDVLSRISQSGDTIYLTIHRDI---------VDKRWLPVAKEEILTFVLEKPT-DRKMGLKLAGKTNKSGLYIQEVLPDSQASLDGRLKKDDRILKINEHDLVFGTQNEALEIIKSVKDSVKFVISRIVRPQTPDIIRAAGTEPDSNMTPIATSSSYPGLKNASTRGYEVGNSPFTFDSPISFKSTYREEVVEVDKKPGESLGMSVAGGVNSQRGDTPVYITNIAPNSLLKNTNGIDKGDILLAVNETELLGLSHERAVEALKLARDNCNKVTVRVLKVPN---------LLLMANTD-----NFIPSWMYWLKLPGYCQIPRMITLSRDAATGSLGFSIVGGNDPIYPFNTNSSLTDLSHNKEAPYRPIMIKSIVSGSPAHKNGRLKCGDILISINDFSLSNVSHSDAVNLFKSTQGPVHLKVVSWPGTII 2003
            + D  IT I   R +      +  VGG +TPL  I+IQ I+RDG IA DGRL PGD I K+N   +S   H     +L +  Q    + LT+ R+          V   + P  +++    +L K + + ++G+KL  + ++ G++I  VL    A   G+L+++DR+L IN HDL FG+   A  +I++ +  V  V+SR VR  +PDI + AG   +   +P       PG +N +++                  +T  E+VV V K P ESLGM+V GG + +  D P+Y+ ++ P  ++     I  GDILL VN  EL  +S   AV  LK A    + V ++ L+V             L +N +     ++ PSW+ WL+LP Y    + + L R+ A GSLGF IVGG +            + S NK     P  IKSIV G+PA+ +GR++CGDIL+++N  S S + H+    + K  +G + L + SWPGT +
Sbjct:  112 IPDGEITSIKINRADPSESLSIRLVGGSETPLVHIIIQHIYRDGVIARDGRLLPGDIILKVNGMDISNVPHNYAVRLLRQPCQ---VLRLTVLREQKFRSRSNAHVPDSYGP--RDDSFHVILNKSSPEEQLGIKLVRRVDEPGVFIFNVLNGGVADRHGQLEENDRVLAINGHDLRFGSPESAAHLIQASERRVHLVVSRQVRQSSPDIFQEAGWISNGQQSP------GPGERNTASKP----------------AATCHEKVVSVWKDPSESLGMTVGGGASHREWDLPIYVISVEPGGVISRDGRIKTGDILLNVNGIELTEVSRTEAVAILKSA---PSSVVLKALEVKEQEAQEDCSPAALDSNHNVTPPGDWSPSWVMWLELPQYLCNCKDVILRRNTA-GSLGFCIVGGYE------------EYSGNK-----PFFIKSIVEGTPAYNDGRIRCGDILLAVNGRSTSGMIHACLARMLKELKGRITLTIASWPGTFL 569          
BLAST of Ligand of Numb protein X 2 vs. Ensembl Mouse
Match: Lnx1 (ligand of numb-protein X 1 [Source:MGI Symbol;Acc:MGI:1278335])

HSP 1 Score: 241.506 bits (615), Expect = 7.143e-70
Identity = 169/506 (33.40%), Postives = 258/506 (50.99%), Query Frame = 3
Query:  570 VEDFTITIINPERLE----FGVSFVGGFDTPLQCIVIQEIFRDGRIAMDGRLRPGDQITKINEYYLSQASHIECRDVLSRISQSGDTIYLTIHRDI---------VDKRWLPVAKEEILTFVLEKPT-DRKMGLKLAGKTNKSGLYIQEVLPDSQASLDGRLKKDDRILKINEHDLVFGTQNEALEIIKSVKDSVKFVISRIVRPQTPDIIRAAGTEPDSNMTPIATSSSYPGLKNASTRGYEVGNSPFTFDSPISFKSTYREEVVEVDKKPGESLGMSVAGGVNSQRGDTPVYITNIAPNSLLKNTNGIDKGDILLAVNETELLGLSHERAVEALKLARDNCNKVTVRVLKVPN---------LLLMANTD-----NFIPSWMYWLKLPGYCQIPRMITLSRDAATGSLGFSIVGGNDPIYPFNTNSSLTDLSHNKEAPYRPIMIKSIVSGSPAHKNGRLKCGDILISINDFSLSNVSHSDAVNLFKSTQGPVHLKVVSWPGTII 2003
            + D  IT I   R +      +  VGG +TPL  I+IQ I+RDG IA DGRL PGD I K+N   +S   H     +L +  Q    + LT+ R+          V   + P  +++    +L K + + ++G+KL  + ++ G++I  VL    A   G+L+++DR+L IN HDL FG+   A  +I++ +  V  V+SR VR  +PDI + AG   +   +P       PG +N +++                  +T  E+VV V K P ESLGM+V GG + +  D P+Y+ ++ P  ++     I  GDILL VN  EL  +S   AV  LK A    + V ++ L+V             L +N +     ++ PSW+ WL+LP Y    + + L R+ A GSLGF IVGG +            + S NK     P  IKSIV G+PA+ +GR++CGDIL+++N  S S + H+    + K  +G + L + SWPGT +
Sbjct:  171 IPDGEITSIKINRADPSESLSIRLVGGSETPLVHIIIQHIYRDGVIARDGRLLPGDIILKVNGMDISNVPHNYAVRLLRQPCQ---VLRLTVLREQKFRSRSNAHVPDSYGP--RDDSFHVILNKSSPEEQLGIKLVRRVDEPGVFIFNVLNGGVADRHGQLEENDRVLAINGHDLRFGSPESAAHLIQASERRVHLVVSRQVRQSSPDIFQEAGWISNGQQSP------GPGERNTASKP----------------AATCHEKVVSVWKDPSESLGMTVGGGASHREWDLPIYVISVEPGGVISRDGRIKTGDILLNVNGIELTEVSRTEAVAILKSA---PSSVVLKALEVKEQEAQEDCSPAALDSNHNVTPPGDWSPSWVMWLELPQYLCNCKDVILRRNTA-GSLGFCIVGGYE------------EYSGNK-----PFFIKSIVEGTPAYNDGRIRCGDILLAVNGRSTSGMIHACLARMLKELKGRITLTIASWPGTFL 628          
BLAST of Ligand of Numb protein X 2 vs. UniProt/SwissProt
Match: sp|Q8N448|LNX2_HUMAN (Ligand of Numb protein X 2 OS=Homo sapiens OX=9606 GN=LNX2 PE=1 SV=1)

HSP 1 Score: 266.159 bits (679), Expect = 1.130e-77
Identity = 181/508 (35.63%), Postives = 266/508 (52.36%), Query Frame = 3
Query:  585 ITIINPER----LEFGVSFVGGFDTPLQCIVIQEIFRDGRIAMDGRLRPGDQITKINEYYLSQASHIECRDVLSRISQSGDTIYLTIHRDIVDKRWLPVA---------KEEILTFVLEK-PTDRKMGLKLAGKTNKSGLYIQEVLPDSQASLDGRLKKDDRILKINEHDLVFGTQNEALEIIKSVKDSVKFVISRIVRPQTPDIIRAAGTEPDS--NMTPIATSSSYPGLKNASTRGYEVGNSPFTFDSPISFKS-----TYREEVVEVDKKPGESLGMSVAGGVNSQRGDTPVYITNIAPNSLLKNTNGIDKGDILLAVNETELLGLSHERAVEALKLARDNCNKVTVRVLKV-------------PNLLLMANTD-NFIPSWMYWLKLPGYCQIPRMITLSRDAATGSLGFSIVGGNDPIYPFNTNSSLTDLSHNKEAPYRPIMIKSIVSGSPAHKNGRLKCGDILISINDFSLSNVSHSDAVNLFKSTQGPVHLKVVSWPGTII 2003
            IT I   R    ++ G+S VGG +TPL  IVIQE++RDG IA DGRL  GDQI ++N Y +S  SH   R VLS   Q  +T++LT+ R+   +R+   A         +EEI    L K  +  ++G+KL  +T++ G++I ++L    A+ DGRL  +DR+L IN HDL +GT   A +II++  + V   I+R  +PQ  + IR AG    S  + TP                       P  +  P S K      T +E+ + V K+P ESLGM+VAGG  S+ G+ P+++T++ P+  L     I +GD+LL +N  +L  LSH  AV  LK A      V ++ L+V             P+       D ++ PSW+ WL LP        I L R +  GS GFSIVGG +  +   TN              +P  IK+IV G+PA+ +GRLKCGD+++++N  S   +SHS  V + K  +  V L V+ WPG+++
Sbjct:  231 ITTIEIHRSNPYIQLGISIVGGNETPLINIVIQEVYRDGVIARDGRLLAGDQILQVNNYNISNVSHNYARAVLS---QPCNTLHLTVLRE---RRFGNRAHNHSDSNSPREEIFQVALHKRDSGEQLGIKLVRRTDEPGVFILDLLEGGLAAQDGRLSSNDRVLAINGHDLKYGTPELAAQIIQASGERVNLTIARPGKPQPGNTIREAGNHSSSSQHHTP-----------------------PPYYSRPSSHKDLTQCVTCQEKHITVKKEPHESLGMTVAGGRGSKSGELPIFVTSVPPHGCLARDGRIKRGDVLLNINGIDLTNLSHSEAVAMLK-ASAASPAVALKALEVQIVEEATQNAEEQPSTFSENEYDASWSPSWVMWLGLPSTLHSCHDIVLRR-SYLGSWGFSIVGGYEENH---TN--------------QPFFIKTIVLGTPAYYDGRLKCGDMIVAVNGLSTVGMSHSALVPMLKEQRNKVTLTVICWPGSLV 690          
BLAST of Ligand of Numb protein X 2 vs. UniProt/SwissProt
Match: sp|Q91XL2|LNX2_MOUSE (Ligand of Numb protein X 2 OS=Mus musculus OX=10090 GN=Lnx2 PE=1 SV=2)

HSP 1 Score: 262.692 bits (670), Expect = 2.627e-76
Identity = 179/508 (35.24%), Postives = 264/508 (51.97%), Query Frame = 3
Query:  564 FNVEDFTITIINPER----LEFGVSFVGGFDTPLQCIVIQEIFRDGRIAMDGRLRPGDQITKINEYYLSQASHIECRDVLSRISQSGDTIYLTIHRDIVDKRWLPVA---------KEEILTFVLEK-PTDRKMGLKLAGKTNKSGLYIQEVLPDSQASLDGRLKKDDRILKINEHDLVFGTQNEALEIIKSVKDSVKFVISRIVRPQTPDIIRAAGTEPDSNMTPIATSSSYPGLKNASTRGYEVGNSPFTFDSPISFKSTYREEVVEVDKKPGESLGMSVAGGVNSQRGDTPVYITNIAPNSLLKNTNGIDKGDILLAVNETELLGLSHERAVEALKLARDNCNKVTVRVLKV-------------PNLLLMANTD-NFIPSWMYWLKLPGYCQIPRMITLSRDAATGSLGFSIVGGNDPIYPFNTNSSLTDLSHNKEAPYRPIMIKSIVSGSPAHKNGRLKCGDILISINDFSLSNVSHSDAVNLFKSTQGPVHLKVVSWPGTII 2003
             ++ +  IT I   R    ++ G+S VGG +TPL  IVIQE++RDG IA DGRL  GDQI ++N Y +S  SH   R VLS   Q   T+ LT+ R+   +R+   A         ++E+   +L K  +  ++G+KL  +T++ G++I ++L    A+ DGRL  +DR+L IN HDL  GT   A +II++  + V   I+R  +PQ  +  R AG    SN      S S PG     TR                   T +E+ + V K+P ESLGM+VAGG  S+ G+ P+++T++ P+  L     I +GD+LL +N  +L  LSH  AV  LK A      V ++ L+V             P+       D ++ PSW+ WL LP        I L R +  GS GFSIVGG    Y  N  +             +P  IK+IV G+PA+ +GRLKCGD+++++N  S   +SHS  V + K  +  V L V+ WPG+++
Sbjct:  223 LSLPEGEITTIEIHRSNPYIQLGISIVGGNETPLINIVIQEVYRDGVIARDGRLLAGDQILQVNNYDISNVSHNHARAVLS---QPCSTLQLTVLRE---RRFGSRANSHADGSAPRDEVFQVLLHKRDSTEQLGIKLVRRTDEPGVFILDLLEGGLAAQDGRLNSNDRVLAINGHDLKHGTPELAAQIIQASGERVNLTIARPGKPQPSNGSREAGAHSSSNHAQ-PPSHSRPGSHKDLTRCV-----------------TCQEKHITVKKEPHESLGMTVAGGRGSKSGELPIFVTSVPPHGCLARDGRIKRGDVLLNINGIDLTNLSHSEAVAMLK-ASAASPAVILKALEVQIAEEAAQATEEQPSAFSENEYDASWSPSWVMWLGLPSALHSCHDIVLRR-SYLGSWGFSIVGG----YEENHTN-------------QPFFIKTIVLGTPAYYDGRLKCGDMIVAVNGLSTVGMSHSALVPMLKEQRNKVTLTVICWPGSLV 687          
BLAST of Ligand of Numb protein X 2 vs. UniProt/SwissProt
Match: sp|Q8TBB1|LNX1_HUMAN (E3 ubiquitin-protein ligase LNX OS=Homo sapiens OX=9606 GN=LNX1 PE=1 SV=1)

HSP 1 Score: 253.447 bits (646), Expect = 1.421e-72
Identity = 180/541 (33.27%), Postives = 274/541 (50.65%), Query Frame = 3
Query:  462 ISNTNSGNNFPKPQDCFYQNNSFYTPLNHLDNLEFNVEDFTITIINPERLE----FGVSFVGGFDTPLQCIVIQEIFRDGRIAMDGRLRPGDQITKINEYYLSQASHIECRDVLSRISQSGDTIYLTIHRD----IVDKRWLPVA---KEEILTFVLEKPT-DRKMGLKLAGKTNKSGLYIQEVLPDSQASLDGRLKKDDRILKINEHDLVFGTQNEALEIIKSVKDSVKFVISRIVRPQTPDIIRAAGTEPDSNMTPIATSSSYPGLKNASTRGYEVGNSPFTFDSPISFKSTYREEVVEVDKKPGESLGMSVAGGVNSQRGDTPVYITNIAPNSLLKNTNGIDKGDILLAVNETELLGLSHERAVEALKLARDNCNKVTVRVLKV-----------PNLL----LMANTDNFIPSWMYWLKLPGYCQIPRMITLSRDAATGSLGFSIVGGNDPIYPFNTNSSLTDLSHNKEAPYRPIMIKSIVSGSPAHKNGRLKCGDILISINDFSLSNVSHSDAVNLFKSTQGPVHLKVVSWPGTII 2003
            +  T SG+      D   +N+   T       L   + D  IT I   R++      +  VGG +TPL  I+IQ I+RDG IA DGRL PGD I K+N   +S   H     +L +  Q    ++LT+ R+      +    P A   +++    +L K + + ++G+KL  K ++ G++I  VL    A   G+L+++DR+L IN HDL +G+   A  +I++ +  V  V+SR VR ++PDI + AG   + + +P       PG         E  N+P     P+    T  E+VV + K PGESLGM+VAGG + +  D P+Y+ ++ P  ++     I  GDILL V+  EL  +S   AV  LK      + + ++ L+V           P  L     MA   ++ PSW+ WL+LP      + I L R+ A GSLGF IVGG +    +N N              +P  IKSIV G+PA+ +GR++CGDIL+++N  S S + H+    L K  +G + L +VSWPGT +
Sbjct:  231 LRRTKSGSAVANHADQGRENSENTTAPEVFPRLYHLIPDGEITSIKINRVDPSESLSIRLVGGSETPLVHIIIQHIYRDGVIARDGRLLPGDIILKVNGMDISNVPHNYAVRLLRQPCQ---VLWLTVMREQKFRSRNNGQAPDAYRPRDDSFHVILNKSSPEEQLGIKLVRKVDEPGVFIFNVLDGGVAYRHGQLEENDRVLAINGHDLRYGSPESAAHLIQASERRVHLVVSRQVRQRSPDIFQEAGWNSNGSWSP------GPG---------ERSNTP----KPLHPTITCHEKVVNIQKDPGESLGMTVAGGASHREWDLPIYVISVEPGGVISRDGRIKTGDILLNVDGVELTEVSRSEAVALLKRTS---SSIVLKALEVKEYEPQEDCSSPAALDSNHNMAPPSDWSPSWVMWLELPRCLYNCKDIVLRRNTA-GSLGFCIVGGYEE---YNGN--------------KPFFIKSIVEGTPAYNDGRIRCGDILLAVNGRSTSGMIHACLARLLKELKGRITLTIVSWPGTFL 728          
BLAST of Ligand of Numb protein X 2 vs. UniProt/SwissProt
Match: sp|O70263|LNX1_MOUSE (E3 ubiquitin-protein ligase LNX OS=Mus musculus OX=10090 GN=Lnx1 PE=1 SV=1)

HSP 1 Score: 241.891 bits (616), Expect = 2.394e-68
Identity = 169/506 (33.40%), Postives = 258/506 (50.99%), Query Frame = 3
Query:  570 VEDFTITIINPERLE----FGVSFVGGFDTPLQCIVIQEIFRDGRIAMDGRLRPGDQITKINEYYLSQASHIECRDVLSRISQSGDTIYLTIHRDI---------VDKRWLPVAKEEILTFVLEKPT-DRKMGLKLAGKTNKSGLYIQEVLPDSQASLDGRLKKDDRILKINEHDLVFGTQNEALEIIKSVKDSVKFVISRIVRPQTPDIIRAAGTEPDSNMTPIATSSSYPGLKNASTRGYEVGNSPFTFDSPISFKSTYREEVVEVDKKPGESLGMSVAGGVNSQRGDTPVYITNIAPNSLLKNTNGIDKGDILLAVNETELLGLSHERAVEALKLARDNCNKVTVRVLKVPN---------LLLMANTD-----NFIPSWMYWLKLPGYCQIPRMITLSRDAATGSLGFSIVGGNDPIYPFNTNSSLTDLSHNKEAPYRPIMIKSIVSGSPAHKNGRLKCGDILISINDFSLSNVSHSDAVNLFKSTQGPVHLKVVSWPGTII 2003
            + D  IT I   R +      +  VGG +TPL  I+IQ I+RDG IA DGRL PGD I K+N   +S   H     +L +  Q    + LT+ R+          V   + P  +++    +L K + + ++G+KL  + ++ G++I  VL    A   G+L+++DR+L IN HDL FG+   A  +I++ +  V  V+SR VR  +PDI + AG   +   +P       PG +N +++                  +T  E+VV V K P ESLGM+V GG + +  D P+Y+ ++ P  ++     I  GDILL VN  EL  +S   AV  LK A    + V ++ L+V             L +N +     ++ PSW+ WL+LP Y    + + L R+ A GSLGF IVGG +            + S NK     P  IKSIV G+PA+ +GR++CGDIL+++N  S S + H+    + K  +G + L + SWPGT +
Sbjct:  271 IPDGEITSIKINRADPSESLSIRLVGGSETPLVHIIIQHIYRDGVIARDGRLLPGDIILKVNGMDISNVPHNYAVRLLRQPCQ---VLRLTVLREQKFRSRSNAHVPDSYGP--RDDSFHVILNKSSPEEQLGIKLVRRVDEPGVFIFNVLNGGVADRHGQLEENDRVLAINGHDLRFGSPESAAHLIQASERRVHLVVSRQVRQSSPDIFQEAGWISNGQQSP------GPGERNTASKP----------------AATCHEKVVSVWKDPSESLGMTVGGGASHREWDLPIYVISVEPGGVISRDGRIKTGDILLNVNGIELTEVSRTEAVAILKSAP---SSVVLKALEVKEQEAQEDCSPAALDSNHNVTPPGDWSPSWVMWLELPQYLCNCKDVILRRNTA-GSLGFCIVGGYE------------EYSGNK-----PFFIKSIVEGTPAYNDGRIRCGDILLAVNGRSTSGMIHACLARMLKELKGRITLTIASWPGTFL 728          
BLAST of Ligand of Numb protein X 2 vs. UniProt/SwissProt
Match: sp|Q8VBX6|MPDZ_MOUSE (Multiple PDZ domain protein OS=Mus musculus OX=10090 GN=Mpdz PE=1 SV=2)

HSP 1 Score: 179.874 bits (455), Expect = 1.731e-45
Identity = 137/467 (29.34%), Postives = 226/467 (48.39%), Query Frame = 3
Query:  615 FGVSFVGGFDTPLQCIVIQEIFRDGRIAMDGRLRPGDQITKINEYYLSQASHIECRDVLSRISQSGDTIYLTIHRDIVDKRWLPVAKEEI---LTFVLEKPTDRKMGLKLAGKTNKSGLYIQEVLPDSQASLDGRLKKDDRILKINEHDLVFGTQNEALEIIKSVKDSVKFVISRIVRPQTPDIIRAAGTEPDSNMTPIATSSSYPGLKNASTRGYEVGNSPFTFDSPISFKSTYREEVVEVDKKPGESLGMSVAGGVNSQRGDTPVYITNIAPNSLLKNTNGIDKGDILLAVNETELLGLSHERAVEALKLARDNCNKVTVRVLKVPNL-LLMANTDNFIPSWMYWLKL------PGYCQIPRMITLSRDAATGSLGFSIVGGNDPIYPFNTNSSLTDLSHNKEAPYRPIMIKSIVSGSPAHKNGRLKCGDILISINDFSLSNVSHSDAVNLFKSTQGPVHLKVVS 1985
             G+S VGG DT L  I+I E++ +G    DGRL  GDQI ++N   L +A+H E  +VL +  Q    + LT++RD       P  +E++    T  L+K   + +GL + GK N +G+++ +++    A  DGRL + D+IL +N  D+   TQ     ++K    +V   + R+         R + +   S  +  + +    G+  + +   E  +      S I    T     VE+ K P +SLG+S+AGGV S  GD P++I  + PN +   T  +  GD ++ +  T   G++H +AV  +K A      + V+V+   ++ ++  +        + +  L      P     P+  T++ D     LGFSIVGG          S   DL         PI +K++ +   A ++GRLK GD +I++N  SL  V+H +AV + K T+G V L V+S
Sbjct: 1624 LGLSIVGGSDTLLGAIIIHEVYEEGAACKDGRLWAGDQILEVNGIDLRKATHDEAINVLRQTPQR---VRLTLYRD-----EAPYKEEDVCDTFTIELQKRPGKGLGLSIVGKRNDTGVFVSDIVKGGIADADGRLMQGDQILMVNGEDVRHATQEAVAALLKCSLGAVTLEVGRVKAAPFHSERRPSQSSQVSESSLSSFTPPLSGINTSES--LESNSKKNALASEIQGLRT-----VEIKKGPADSLGLSIAGGVGSPLGDVPIFIAMMHPNGVAAQTQKLRVGDRIVTICGTSTDGMTHTQAVNLMKNA---SGSIEVQVVAGGDVSVVTGHQQELANPCLAFTGLTSSSIFPDDLGPPQSKTITLDRGPDGLGFSIVGG--------YGSPHGDL---------PIYVKTVFAKGAAAEDGRLKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMVLS 2055          

HSP 2 Score: 68.9366 bits (167), Expect = 1.457e-10
Identity = 85/378 (22.49%), Postives = 155/378 (41.01%), Query Frame = 3
Query:  891 FVLEKPTDRKMGLKLAGKTNKS----GLYIQEVLPDSQASLDGRLKKDDRILKINEHDL-VFGTQNEALEIIKSVKDSVKFVISRIVRPQTPDIIRAAGTEPDSNMTPIATSSSYPGLKNASTRGYEVGNSPFTFDSPISFKSTYREEVVEVDKKPGESLGMSVAGGVNSQRGDTPVYITNIAPNSLLKNTNGIDKGDILLAVNETELLGLSHERAVEALKLARDNCNKVTVR--VLKVPNLLLMANTDNFIPSWMYWLKLPGYCQIPRM-----ITLSRDAATGSLGFSIVG--GNDPIYPFNTNSSLTDLSHNKEAPYRPIMIKSIVSGSPAHKNGRLKCGDILISINDFSLSNVSHSDAVNLFKSTQGPVHLKVV 1982
            F L KP    +G  + G  +++    G+++QE+   S A  DGRLK+ D+IL IN   L    T  +A+ I++  KD+V+ VI+R                   ++ P+++         AST             +P+ ++     E+V      G  LG  + GG       T V +  I P  +      +  GD +L + +T+L G+S E+  + L+   +    +  R  V + P    +  T +   S    +++    Q         + L+++     LG +I G  G+  + P                    I +KSI   S    +GR++ GD +I+++  +L   ++  AV + + T   V L ++
Sbjct:  139 FELLKPPCGGLGFSVVGLRSENRGELGIFVQEIQEGSVAHRDGRLKETDQILAINGQVLDQTITHQQAISILQKAKDTVQLVIAR------------------GSLPPVSSPRISRSPSAASTIS--------AHSNPMHWQHVETIELV----NDGSGLGFGIIGGKA-----TGVIVKTILPGGVADQHGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQCGNRVKLMIARGAVEETPASSSLGITLSSSTSSTSEMRVDASTQKNDESETFDVELTKNVQ--GLGITIAGYIGDKKLEPSG------------------IFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVRLTLM 461          

HSP 3 Score: 60.4622 bits (145), Expect = 6.012e-8
Identity = 53/223 (23.77%), Postives = 91/223 (40.81%), Query Frame = 3
Query: 1317 EVVEVDKKPGESLGMSVAGGVNSQRGDTPVYITNIAPNSLLKNTNGIDKGDILLAVNETEL-LGLSHERAVEALKLARDNCNKVTVRVLKVPNLLLMANTDNFIPSWMYWLKLPGYCQIPRMITLSRDAATGSLGFSIVGGNDPIYPFNTNSSLTDLSHNKEAPYRPIMIKSIVSGSPAHKNGRLKCGDILISINDFSLSNVSHSDAVNLFKSTQGPVHLKVV 1982
            E+ E+ K P   LG SV G  +  RG+  +++  I   S+      + + D +LA+N   L   ++H++A+  L+ A+D    V  R    P      +      S +     P + Q    I L  D +   LGF I+GG                          +++K+I+ G  A ++GRL  GD ++ I D  L+ +S      + +     V L + 
Sbjct:  137 EIFELLKPPCGGLGFSVVGLRSENRGELGIFVQEIQEGSVAHRDGRLKETDQILAINGQVLDQTITHQQAISILQKAKDTVQLVIARGSLPPVSSPRISRSPSAASTISAHSNPMHWQHVETIELVNDGS--GLGFGIIGGK----------------------ATGVIVKTILPGGVADQHGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQCGNRVKLMIA 335          

HSP 4 Score: 53.5286 bits (127), Expect = 7.756e-6
Identity = 40/105 (38.10%), Postives = 51/105 (48.57%), Query Frame = 3
Query: 1671 PRMITLSRDAATGSLGFSIVGGNDPIYPFNTNSSLTDLSHNKEAPYRPIMIKSIVSGSPAHKNGRLKCGDILISINDFSLSNVSHSDAVNLFKSTQGPVHLKVVS 1985
            PR + L R+ +  SLG SIVGG          S L+    N E   R I IK ++  SPA KNG LK GD +I ++   L + SH  AV   +    PV   V S
Sbjct: 1137 PRRVELWREPSK-SLGISIVGGR------GMGSRLS----NGEV-MRGIFIKHVLEDSPAGKNGTLKPGDRIIEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQS 1229          
BLAST of Ligand of Numb protein X 2 vs. TrEMBL
Match: A0A504YN76 (Ligand of Numb protein X 2 OS=Fasciola gigantica OX=46835 GN=FGIG_03645 PE=4 SV=1)

HSP 1 Score: 469.929 bits (1208), Expect = 1.858e-149
Identity = 277/661 (41.91%), Postives = 386/661 (58.40%), Query Frame = 3
Query:  171 DRLMSVTVTSSPCQEFIPKSEIDPNLIKQCQGLFVSCCYSTAGCTFKAVGREVAAHEWQCPYGQKSPEXXXXXXXXXXXXXVFQT--------DAAGVSINGSQDISNTNSGNNFPKPQDCFYQNNSFYTPLN----HLDNLEFNVED--FTITIINPERLEFGVSFVGGFDTPLQCIVIQEIFRDGRIAMDGRLRPGDQITKINEYYLSQASHIECRDVLSRISQSGDTIYLTIHRDIVDKRWLPV----------AKEEILTFVLEKPTDRKMGLKLAGKTNKSGLYIQEVLPDSQASLDGRLKKDDRILKINEHDLVFGTQNEALEIIKSVKDSVKFVISRIVRPQTPDIIRAAGTEPDSNMTPIATSS-----SYPGLKNAST-----------RGYE-VGNSPFTFDSPISFKS-TYREEVVEVDKKPGESLGMSVAGGVNSQRGDTPVYITNIAPNSLLKNTNGIDKGDILLAVNETELLGLSHERAVEALKLARDNCNKVTVRVLKVPNLLLMANTDNFIPSWMYWLKLPGYCQIPRMITLSRDAATGSLGFSIVGGNDPIYP------FNTNSSLTDLSH--NKEAPYRPIMIKSIVSGSPAHKNGRLKCGDILISINDFSLSNVSHSDAVNLFKSTQGPVHLKVVSWPGTII 2003
            D+L+ +   S  C+E + + +++ +L   C+G  V+C  +  GC +  +  +  AH W C +    P++   +     +  V  +        D       G + + N +S  +    Q   +Q ++   P +      +  +F VE    +I +    R E G+S VGG DTPL C++IQEI+ DG  A DGRLRPGDQI ++N   L+ A+H++   +LS  S +G    LT++R+   +    +          AK+E+L  VL K  ++++G+KLAGK N  GLY+  ++PD QA LDGRL+KDDRIL+IN  DL  GTQ +A ++I   KD V  VI R +RPQTPDIIRAA  E  S     +TS      + P    A T           RG   + N P   D  ++  +   +E V+ + K+PGESLGMSVAGGV SQRGD P+Y+TN+APN L+  +  + +GDILLAVN+ ELLGLSHERAVEALK ARD C +VT+R+LK P   L     NFIPSW++WL+LP YCQIPR++ L RD   G LGFSI+GGND  +P       NT +  TD S    K    RPI+IKSIV GSP + +GRLKCGDIL+S++ + L+N+SH+ AV L K   G V L++VSWPGTI+
Sbjct:  333 DKLLVICPNSEHCREILARCDLESHLAYWCRGAVVACVNNKLGCPYLGLRAKQPAHRWNCQFQPSVPQTITIADAPQISDRVAASTSPQNSPRDQRSSDSGGPRLLGNESSVKSAAPSQSGSHQESTSSAPCSTKETSTEAAQFAVEGQIGSIDLKLDGRSELGISLVGGCDTPLLCMIIQEIYLDGIAARDGRLRPGDQILEVNGEELAHATHLQACLMLS--SLTGSVCRLTVYREQAVEAGHSLSSPASQHRIDAKQELLRIVLPKSQEKRLGIKLAGKKNCLGLYVLGLVPDGQAQLDGRLRKDDRILEINGVDLSNGTQEQAAQLIADAKDQVTLVILRQLRPQTPDIIRAASGENVSKCVVFSTSGQQSTVASPAPVRAITCTTAGNPPPPPRGITTLSNVPLEPDVQLAAGARVCQERVLVLTKRPGESLGMSVAGGVASQRGDVPIYVTNLAPNGLVARSGRVFRGDILLAVNDIELLGLSHERAVEALKNARDTCTQVTLRLLKGPECSL--EDRNFIPSWLFWLQLPRYCQIPRLVVLVRDPVIG-LGFSIIGGND-FFPDANETVTNTTAKETDGSDGTRKTPTPRPIVIKSIVPGSPCYWDGRLKCGDILLSVDHYPLTNISHAHAVALLKHCTGEVKLRIVSWPGTIV 987          
BLAST of Ligand of Numb protein X 2 vs. TrEMBL
Match: A0A0X3PH35 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=TR160888 PE=4 SV=1)

HSP 1 Score: 458.373 bits (1178), Expect = 1.769e-148
Identity = 280/675 (41.48%), Postives = 385/675 (57.04%), Query Frame = 3
Query:  171 DRLMSVTVTSSPCQEFIPKSEIDPNLIKQCQGLFVSCCYSTAGCTFKAVGREVAAHEWQCPYGQKSPEX-------XXXXXXXXXXXXVFQTDAAGVSINGSQDISNTNSGNNFPKPQDCFYQNNSFYTPLNHLDNLEFN---------VEDFTITIIN-----PERLEFGVSFVGGFDTPLQCIVIQEIFRDGRIAMDGRLRPGDQITKINEYYLSQASHIECRDVLSRISQSGDTIYLTIHRDIVDKRWL---------------PVAKEEILTFVLEKPTDRKMGLKLAGKTNKSGLYIQEVLPDSQASLDGRLKKDDRILKINEHDLVFGTQNEALEIIKSVKDSVKFVISRIVRPQTPDIIRAAG----TEPDSNMTPIATSSSYPGLKNASTRGYEVGNSPFTFD--SPISFKS----TYREEVVEVDKKPGESLGMSVAGGVNSQRGDTPVYITNIAPNSLLKNTNGIDKGDILLAVNETELLGLSHERAVEALKLARDNCNKVTVRVLKVPNLLLMANTDNFIPSWMYWLKLPGYCQIPRMITLSRDAATGSLGFSIVGGN-----DPIYPFNTNSSLTDLSHNK-------------EAPYRPIMIKSIVSGSPAHKNGRLKCGDILISINDFSLSNVSHSDAVNLFKSTQGPVHLKVVSWPGTII 2003
            D+L+ +   +  C E + + +++ +L   C+G  + C  +  GC F+A       H  +C +  +S  +              S+   V QT     S  GS   S    G   P P     Q+ +    +N    +  +         + D  +T I       ERL  G+SFVGG DTPL C+VIQEI+ DG +A+DGRLRPGDQI + N   L+QA+H + R +LS I+ S     LT++R+                      P  +EEIL   L K  D+++G+KL GK N  GLYI  V+PDS+A LDGRL KDDRIL+IN  DL  GTQ+EA  II+S  + V  V++R++RPQTPDIIR A      +  ++ T     +  P L         VG +  +    SP S KS      RE+V+ ++K+PGESLGM+VAGGV SQRGDTPVY+T+  P S++     + KGD+LLAVNE ELLGLSHERAVEALK  R  C+KVT+R+L+ P         NF+PSW+YWL+LP YCQIP+ I LSR +A+GS GFSIVGGN     DP  P  T + LT+ S  +              +  +PI++KSIV G+PAH++GRLKCGD+++++N FSL++VSH+ AV L K+  G V ++VVSWPGTI+
Sbjct:   37 DKLLVICPNTEHCDEVLCRCDLESHLTYWCRGSVIPCLNAKTGCQFRAARALHTEHRRECRFQTRSTTANFSGGGGGGIVGPGSAFDVVHQTSPVVRSSTGSGAKSAVRFG---PMPSRRAAQDQTGRADVNASSLVVGSKPRTRSVSPIRDCEVTTIELPWQPNERL--GISFVGGSDTPLLCVVIQEIYLDGLVALDGRLRPGDQILETNGVDLTQATHHQARVLLSSITAS-RPCTLTVYRERASSETGSLNSGKLSSTATGDNPFEREEILHINLLKRLDKRLGIKLVGKKNLPGLYILGVVPDSEADLDGRLHKDDRILEINGVDLREGTQDEAANIIRSAGEHVSLVVARVIRPQTPDIIRTASGDIVIDYGADCTATTAGAGPPALVPPV-----VGPATLSLGAISPPSLKSPSTRLCREQVLVINKRPGESLGMTVAGGVASQRGDTPVYVTDFDPGSVVGRMGRLSKGDVLLAVNEVELLGLSHERAVEALKSTRKTCSKVTLRLLEGPE--TSTAKGNFLPSWLYWLQLPRYCQIPKTIVLSRTSASGSFGFSIVGGNNSMSADPASP--TMTVLTNASQREVTRPSATSSSSCVSSSPQPIVVKSIVPGTPAHRDGRLKCGDLILAVNQFSLADVSHAYAVALLKNCVGDVQIRVVSWPGTIV 696          
BLAST of Ligand of Numb protein X 2 vs. TrEMBL
Match: A0A4E0RU30 (Ligand of Numb protein X 2 OS=Fasciola hepatica OX=6192 GN=D915_003900 PE=4 SV=1)

HSP 1 Score: 465.692 bits (1197), Expect = 8.849e-148
Identity = 278/664 (41.87%), Postives = 386/664 (58.13%), Query Frame = 3
Query:  171 DRLMSVTVTSSPCQEFIPKSEIDPNLIKQCQGLFVSCCYSTAGCTFKAVGREVAAHEWQCPYGQKSPEXXXXXXXXXXXXXVFQTDAAGVSINGSQDISNTNSG------------NNFPKPQDCFYQNNS---FYTPLNHLDNLEFNVED--FTITIINPERLEFGVSFVGGFDTPLQCIVIQEIFRDGRIAMDGRLRPGDQITKINEYYLSQASHIECRDVLSRISQSGDTIYLTIHRDIVDKRWLPV----------AKEEILTFVLEKPTDRKMGLKLAGKTNKSGLYIQEVLPDSQASLDGRLKKDDRILKINEHDLVFGTQNEALEIIKSVKDSVKFVISRIVRPQTPDIIRAAGTEPDSNMTPIATSS-----SYPGLKNAST-----------RGYE-VGNSPFTFDSPISFKS-TYREEVVEVDKKPGESLGMSVAGGVNSQRGDTPVYITNIAPNSLLKNTNGIDKGDILLAVNETELLGLSHERAVEALKLARDNCNKVTVRVLKVPNLLLMANTDNFIPSWMYWLKLPGYCQIPRMITLSRDAATGSLGFSIVGGNDPIYP------FNTNSSLTDL--SHNKEAPYRPIMIKSIVSGSPAHKNGRLKCGDILISINDFSLSNVSHSDAVNLFKSTQGPVHLKVVSWPGTII 2003
            D+L+ +   S  C+E + + +++ +L   C+G  V+C  +  GC +  +  +  AH W C +    P++   +     +  V    A+  S N  +D  +++SG            +  P      +++ S     T     +  +F VE    +I +    R E G+S VGG DTPL C++IQEI+ DG  A DGRLRPGDQI ++N   L+  +H++   +LS  S +G    LT++R+   +    +          AK+E+L  VL K  ++++G+KLAGK N  GLY+  ++PD QA LDGRL+KDDRIL+IN  DL  GTQ +A ++I   KD V  VI R VRPQTPDIIRAA  E  S     +TS      + P    A T           RG   + N P   D  ++  +   +E V+ + K+PGESLGMSVAGGV SQRGD P+Y+TN+APN L+  +  + +GDILLAVN+ ELLGLSHERAVEALK ARD C +VT+R+LK P   L     NFIPSW++WL+LP YCQIPR++ L RD   G LGFSI+GGND  +P       NT +  TD      K    RPI+IKSIV GSP + +GRLKCGDIL+S++ + L+N+SH+ AV L K   G V L++VSWPGTI+
Sbjct:  333 DKLLVICPNSEHCREILARCDLESHLAYWCRGAVVACVNNKLGCPYLGLRAKQPAHRWNCQFQPSVPQTITIADAPQISDRVA---ASTSSRNSPRDQRSSDSGGLRLLGNESSVKSAAPSQSGSHHESTSSAPCSTQETSAEAAQFAVEGQIGSIDLKLDGRSELGISLVGGCDTPLLCMIIQEIYLDGIAARDGRLRPGDQILEVNGEELAHVTHLQACLMLS--SLTGPVCRLTVYREQAVEAGHSLSSPASQHRIDAKQELLRIVLPKSQEKRLGIKLAGKRNCLGLYVLGLVPDGQAQLDGRLRKDDRILEINGVDLSNGTQEQAAQLIADAKDQVTLVILRQVRPQTPDIIRAASGENVSKCVVFSTSGQQSTVASPAPVRAITCTTTVNPPPPPRGITTLSNVPLEPDVQLAAGARVCQERVLVLTKRPGESLGMSVAGGVASQRGDVPIYVTNLAPNGLVARSGRVFRGDILLAVNDIELLGLSHERAVEALKNARDTCTQVTLRLLKGPECSL--EDRNFIPSWLFWLQLPRYCQIPRLVVLVRDPVIG-LGFSIIGGND-FFPDANETVTNTTAKETDGPDGTRKTPTPRPIVIKSIVPGSPCYWDGRLKCGDILLSVDHYPLTNISHAHAVALLKHCTGEVKLRIVSWPGTIV 987          
BLAST of Ligand of Numb protein X 2 vs. TrEMBL
Match: A0A0X3P7T5 (Ligand of Numb protein X 2 (Fragment) OS=Schistocephalus solidus OX=70667 GN=LNX2 PE=4 SV=1)

HSP 1 Score: 458.373 bits (1178), Expect = 5.427e-146
Identity = 280/675 (41.48%), Postives = 385/675 (57.04%), Query Frame = 3
Query:  171 DRLMSVTVTSSPCQEFIPKSEIDPNLIKQCQGLFVSCCYSTAGCTFKAVGREVAAHEWQCPYGQKSPEX-------XXXXXXXXXXXXVFQTDAAGVSINGSQDISNTNSGNNFPKPQDCFYQNNSFYTPLNHLDNLEFN---------VEDFTITIIN-----PERLEFGVSFVGGFDTPLQCIVIQEIFRDGRIAMDGRLRPGDQITKINEYYLSQASHIECRDVLSRISQSGDTIYLTIHRDIVDKRWL---------------PVAKEEILTFVLEKPTDRKMGLKLAGKTNKSGLYIQEVLPDSQASLDGRLKKDDRILKINEHDLVFGTQNEALEIIKSVKDSVKFVISRIVRPQTPDIIRAAG----TEPDSNMTPIATSSSYPGLKNASTRGYEVGNSPFTFD--SPISFKS----TYREEVVEVDKKPGESLGMSVAGGVNSQRGDTPVYITNIAPNSLLKNTNGIDKGDILLAVNETELLGLSHERAVEALKLARDNCNKVTVRVLKVPNLLLMANTDNFIPSWMYWLKLPGYCQIPRMITLSRDAATGSLGFSIVGGN-----DPIYPFNTNSSLTDLSHNK-------------EAPYRPIMIKSIVSGSPAHKNGRLKCGDILISINDFSLSNVSHSDAVNLFKSTQGPVHLKVVSWPGTII 2003
            D+L+ +   +  C E + + +++ +L   C+G  + C  +  GC F+A       H  +C +  +S  +              S+   V QT     S  GS   S    G   P P     Q+ +    +N    +  +         + D  +T I       ERL  G+SFVGG DTPL C+VIQEI+ DG +A+DGRLRPGDQI + N   L+QA+H + R +LS I+ S     LT++R+                      P  +EEIL   L K  D+++G+KL GK N  GLYI  V+PDS+A LDGRL KDDRIL+IN  DL  GTQ+EA  II+S  + V  V++R++RPQTPDIIR A      +  ++ T     +  P L         VG +  +    SP S KS      RE+V+ ++K+PGESLGM+VAGGV SQRGDTPVY+T+  P S++     + KGD+LLAVNE ELLGLSHERAVEALK  R  C+KVT+R+L+ P         NF+PSW+YWL+LP YCQIP+ I LSR +A+GS GFSIVGGN     DP  P  T + LT+ S  +              +  +PI++KSIV G+PAH++GRLKCGD+++++N FSL++VSH+ AV L K+  G V ++VVSWPGTI+
Sbjct:  237 DKLLVICPNTEHCDEVLCRCDLESHLTYWCRGSVIPCLNAKTGCQFRAARALHTEHRRECRFQTRSTTANFSGGGGGGIVGPGSAFDVVHQTSPVVRSSTGSGAKSAVRFG---PMPSRRAAQDQTGRADVNASSLVVGSKPRTRSVSPIRDCEVTTIELPWQPNERL--GISFVGGSDTPLLCVVIQEIYLDGLVALDGRLRPGDQILETNGVDLTQATHHQARVLLSSITAS-RPCTLTVYRERASSETGSLNSGKLSSTATGDNPFEREEILHINLLKRLDKRLGIKLVGKKNLPGLYILGVVPDSEADLDGRLHKDDRILEINGVDLREGTQDEAANIIRSAGEHVSLVVARVIRPQTPDIIRTASGDIVIDYGADCTATTAGAGPPALVPPV-----VGPATLSLGAISPPSLKSPSTRLCREQVLVINKRPGESLGMTVAGGVASQRGDTPVYVTDFDPGSVVGRMGRLSKGDVLLAVNEVELLGLSHERAVEALKSTRKTCSKVTLRLLEGPE--TSTAKGNFLPSWLYWLQLPRYCQIPKTIVLSRTSASGSFGFSIVGGNNSMSADPASP--TMTVLTNASQREVTRPSATSSSSCVSSSPQPIVVKSIVPGTPAHRDGRLKCGDLILAVNQFSLADVSHAYAVALLKNCVGDVQIRVVSWPGTIV 896          
BLAST of Ligand of Numb protein X 2 vs. TrEMBL
Match: A0A564XXP6 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS355 PE=4 SV=1)

HSP 1 Score: 449.899 bits (1156), Expect = 9.664e-145
Identity = 269/678 (39.68%), Postives = 378/678 (55.75%), Query Frame = 3
Query:  171 DRLMSVTVTSSPCQEFIPKSEIDPNLIKQCQGLFVSCCYSTAGCTFKAVGREVAAHEWQCPYGQKSPEXXXXXXXXXX------------------XXXVFQTDAAGVSINGSQDISNTNSGNNFPKPQDCFYQNNSFYTPLNHLDNLEFNVEDFTITIINPERLEFGVSFVGGFDTPLQCIVIQEIFRDGRIAMDGRLRPGDQITKINEYYLSQASHIECRDVLSRISQS-GDTIYLTIHRDIVDKRWL------------------------PVAKEEILTFVLEKPTDRKMGLKLAGKTNKSGLYIQEVLPDSQASLDGRLKKDDRILKINEHDLVFGTQNEALEIIKSVKDSVKFVISRIVRPQTPDIIRAAGTEPDSNMTPIATSSSYPGLKNASTRGYEVGNSPFTFDS---PISFKSTY----REEVVEVDKKPGESLGMSVAGGVNSQRGDTPVYITNIAPNSLLKNTNGIDKGDILLAVNETELLGLSHERAVEALKLARDNCNKVTVRVLKVPNLLLMANTDNFIPSWMYWLKLPGYCQIPRMITLSRDAATGSLGFSIVGGN----------DPIYPF-------NTNSSLTDLSHNKEAPYRPIMIKSIVSGSPAHKNGRLKCGDILISINDFSLSNVSHSDAVNLFKSTQGPVHLKVVSWPGTII 2003
            D+L+ +   S  C E + + +++ +L+  C+G  V C  +  GC F+A     + H  +C +  ++P ++  +++  S                        T+A  +S  GS     T S    P                +H+ + E      TI +        G+SFVGG DTPL CIVIQE++ DG +AMDGRLRPGDQI + N   L+QA+H + R  L+ +      +  LT++R+    R L                        P  +EEIL   L K +D+++G+KL GK N  G+YI  ++PDS+A LDGRL KDDRIL+IN  DL  GTQ EA  II++ ++ V  V++R++RP TP+++R+   E   +       SS     +A+TR       P    +   P S KS      RE+ + V+K PGESLGM+VAGGV SQRGDTPVYITN+ P  +L     + KGD+LLAVNE ELLGLSHE+AVEALK  R   +KVT+RVL+ P     +  +NF+PSW+YWL+LP YCQIPR I L R  A GSLGFSIVGGN           P+  F       + + S T  S +  +  +PI++KSIV GSPAH++GRLKCGD+++++N + L++VSH+ AV L K   G VH++VVSWPGTI+
Sbjct:   69 DKLLVICPNSEHCNEVLSRCDLESHLVYWCRGTVVPCSNAKTGCQFRAARALQSEHRRECRFQPRTPGTTHVAVSGGSPIVRPIATKSVVRFGPMPAVRRVATEAPLMSAEGSAFEETTPS----PPTTASSIGGGGGVRSASHIRDCEVT----TIELPWKPNASLGISFVGGSDTPLLCIVIQEVYLDGIVAMDGRLRPGDQILEANGIDLTQATHHQARTALTSVGGGVARSFELTVYRE----RALVSECGGSSSSGSSGRRRFGSTPENPFEREEILQVTLMKRSDKRLGIKLVGKKNLPGVYILGLVPDSEADLDGRLNKDDRILEINGIDLREGTQEEAANIIRTAEEHVALVVARVIRPHTPEMLRSGSGEIFMDFGGGGNGSSSTTSTSAATRSPGTAVPPPATSASVLPSSLKSPSTRLCREQEITVEKMPGESLGMTVAGGVASQRGDTPVYITNLVPTGVLGRAGQLAKGDVLLAVNEIELLGLSHEKAVEALKATRKTSSKVTIRVLEGPE--TSSGRENFLPSWLYWLQLPRYCQIPRTIILPR-TANGSLGFSIVGGNTAAGSDDSGTSPLTAFSRSVDFESRHPSATHGSSSVTSSPQPIVVKSIVPGSPAHRDGRLKCGDLILAVNQYPLTDVSHAHAVALLKHCVGDVHIRVVSWPGTIV 731          
BLAST of Ligand of Numb protein X 2 vs. Ensembl Cavefish
Match: lnx2a (ligand of numb-protein X 2a [Source:ZFIN;Acc:ZDB-GENE-060228-2])

HSP 1 Score: 251.906 bits (642), Expect = 1.931e-73
Identity = 171/499 (34.27%), Postives = 261/499 (52.30%), Query Frame = 3
Query:  585 ITIINPER----LEFGVSFVGGFDTPLQCIVIQEIFRDGRIAMDGRLRPGDQITKINEYYLSQASHIECRDVLSRISQSGDTIYLTIHRD---------IVDKRWLPVAKEEILTFVLEK-PTDRKMGLKLAGKTNKSGLYIQEVLPDSQASLDGRLKKDDRILKINEHDLVFGTQNEALEIIKSVKDSVKFVISRIVRPQTPDIIRAAGTEPDSNMTPIA-TSSSYPGLKNASTRGYEVGNSPFTFDSPISFKSTYREEVVEVDKKPGESLGMSVAGGVNSQRGDTPVYITNIAPNSLLKNTNGIDKGDILLAVNETELLGLSHERAVEALKLARDNCNKVTVRVLKVPN---------LLLMANTD---NFIPSWMYWLKLPGYCQIPRMITLSRDAATGSLGFSIVGGNDPIYPFNTNSSLTDLSHNKEAPYRPIMIKSIVSGSPAHKNGRLKCGDILISINDFSLSNVSHSDAVNLFKSTQGPVHLKVVSWPGTI 2000
            IT I   R    +E G+S VGG +TPL  IVIQE++RDG IA DGRL  GDQI ++N   +S   H   R  L R      T+ LT+ R+         +      P      +   L K  +  ++G+KL  +T+++G+++ ++L    A+ DGRL+ +DR+L +NEHDL  GT  +A +II++  + V  +ISR  + QT  +     +    +  P+  T++  P L                         T +E+ + V K+P ESLGM+VAGG  S+ G+ P+++T++ P+  L     I +GD+LL++N  +L  LSH  AV  LK +  + + V +R L+V           LL    +D   ++ PSW+ WL LP Y      I L R +  GS GFSIVGG    Y  N         H+ +A      IK+IV G+PA+ +GRLKCGD+++++N  S + +SHS  V + K  +  + L VVSWPG++
Sbjct:  222 ITTIEVHRSNPYVELGISIVGGNETPLINIVIQEVYRDGVIARDGRLLAGDQILQVNNVDISNMPHSFARSTLGRPCA---TLQLTVLRERRCTARPPAVAPTPSSPEGSPASMRITLHKRESTEQLGIKLVRRTDEAGVFVLDLLDGGLAAKDGRLRSNDRVLAVNEHDLRHGTPEQAAQIIQASGERVNLLISRPAK-QTMAVHTGRESWCHEHFLPLPRTAAPSPDLSQC---------------------VTCKEKHITVKKEPHESLGMTVAGGRGSKSGELPIFVTSVQPHGCLSRDGRIKRGDVLLSINGQDLTCLSHSEAVGTLKSSAAS-SSVQLRALEVSTVDEPGHDEGLLPHHESDYDASWSPSWVMWLGLPSYLHSSHEIILRR-SHPGSWGFSIVGG----YEEN---------HSNQA----FFIKTIVLGTPAYYDGRLKCGDMIVAVNGLSTAGMSHSALVPMLKEQRSRLALTVVSWPGSL 676          
BLAST of Ligand of Numb protein X 2 vs. Ensembl Cavefish
Match: lnx1 (ligand of numb-protein X 1 [Source:NCBI gene;Acc:103042826])

HSP 1 Score: 249.98 bits (637), Expect = 6.976e-71
Identity = 175/543 (32.23%), Postives = 269/543 (49.54%), Query Frame = 3
Query:  522 NSFYTPLNHLDNLEFNVEDFTITIINPERLE----FGVSFVGGFDTPLQCIVIQEIFRDGRIAMDGRLRPGDQITKINEYYLSQASHIECRDVLSRISQSGDTIYLTIHRDIVDKRWL-----------------PVAKEEILTFVLEKPT-DRKMGLKLAGKTNKSGLYIQEVLPDSQASLDGRLKKDDRILKINEHDLVFGTQNEALEIIKSVKDSVKFVISRIVRPQTPDIIRAA--GTEPDSNMTPIATSSSYPGLKNASTRGYEVGNSPFTFDSPISFKSTYREEVVEVDKKPGESLGMSVAGGVNSQRGDTPVYITNIAPNSLLKNTNGIDKGDILLAVNETELLGLSHERAVEALKLARDNCNKVTVRVLKV-------------------------PNLLLMANTDNFIPSWMYWLKLPGYCQIPRMITLSRDAATGSLGFSIVGGNDPIYPFNTNSSLTDLSHNKEAPYRPIMIKSIVSGSPAHKNGRLKCGDILISINDFSLSNVSHSDAVNLFKSTQGPVHLKVVSWPGTII 2003
            NS  + L  L  L   + D  +T +   R +      +S VGG +TPL  I+IQ+I+R+G IA DGRL PGD I K+N   ++   H      L+ + Q    + LT+ R+   +                    P+ +++ L  VL K   D ++G+KL  + ++ G++I  +L    A+ D RL+ DDR+L IN HDL +G    A  +I++  + V F++SR      PDI++ A    E     +P+    +                     DS    K    E+ V + K+P ESLGM+VAGG+NS+  D PVYITNI PN ++     I KGDILL VN  +L G++   AV  LK   +  + V +RVL++                          ++ +   +D++ P W+ WL+LP +    + I L R + +GSLGFSIVGG + I   N N S                I+SIV G+PA+ +GR++CGDIL+ +N  S   ++H+  V L K  +G + L +VSWPG+++
Sbjct:  451 NSKKSELFALPQLHHLIPDGEVTTVKITRADPCEPLAISIVGGNETPLVRILIQDIYREGVIARDGRLLPGDMILKVNGIDITNVPHCY---ALAALKQPCTLLRLTVLREQRHRYRSHHHHHTPSPGELYPGHGPMIRDDSLHVVLVKGAPDEQLGIKLVRRPDEHGVFIFHLLEGGLAARDARLRVDDRVLAINGHDLRYGAPEHAALLIQASVERVHFIVSRQTHVPAPDILQEAPWNMEGPPPYSPVDIEHTL-------------------LDS--CHKPACYEKTVTLSKEPNESLGMTVAGGMNSRGWDLPVYITNIDPNGVVSQEGSIRKGDILLNVNGVDLTGVTRGEAVANLK---NTSSPVVLRVLEMRPPDVSSLDCMPPLHSPCSLSPCSPSDIKMPLPSDDYSPLWVSWLQLPRHLYCCKDIVLRR-STSGSLGFSIVGGQEEI---NCNQSF--------------FIRSIVEGTPAYNDGRIRCGDILLEVNGKSTWGMTHTALVRLLKELRGRITLTIVSWPGSLL 948          
BLAST of Ligand of Numb protein X 2 vs. Ensembl Cavefish
Match: lnx1 (ligand of numb-protein X 1 [Source:NCBI gene;Acc:103042826])

HSP 1 Score: 249.595 bits (636), Expect = 1.409e-70
Identity = 181/568 (31.87%), Postives = 281/568 (49.47%), Query Frame = 3
Query:  438 VSINGSQDISNTNSGNNFPKPQDCFYQNNSFYTPLNHLDNLEFNVEDFTITIINPERLE-FGVSFVGGFDTPLQCIVIQEIFRDGRIAMDGRLRPGDQITKINEYYLSQASHIECRDVLSRISQSGDTIYLTIHRDIVDKRWL-----------------PVAKEEILTFVLEKPT-DRKMGLKLAGKTNKSGLYIQEVLPDSQASLDGRLKKDDRILKINEHDLVFGTQNEALEIIKSVKDSVKFVISRIVRPQTPDIIRAA--GTEPDSNMTPIATSSSYPGLKNASTRGYEVGNSPFTFDSPISFKSTYREEVVEVDKKPGESLGMSVAGGVNSQRGDTPVYITNIAPNSLLKNTNGIDKGDILLAVNETELLGLSHERAVEALKLARDNCNKVTVRVLKV-------------------------PNLLLMANTDNFIPSWMYWLKLPGYCQIPRMITLSRDAATGSLGFSIVGGNDPIYPFNTNSSLTDLSHNKEAPYRPIMIKSIVSGSPAHKNGRLKCGDILISINDFSLSNVSHSDAVNLFKSTQGPVHLKVVSWPGTII 2003
            V+ +G+++  N  + N    PQ+ F         L  L +L  + E  T+ I   +  E   +S VGG +TPL  I+IQ+I+R+G IA DGRL PGD I K+N   ++   H      L+ + Q    + LT+ R+   +                    P+ +++ L  VL K   D ++G+KL  + ++ G++I  +L    A+ D RL+ DDR+L IN HDL +G    A  +I++  + V F++SR      PDI++ A    E     +P+    +                     DS    K    E+ V + K+P ESLGM+VAGG+NS+  D PVYITNI PN ++     I KGDILL VN  +L G++   AV  LK   +  + V +RVL++                          ++ +   +D++ P W+ WL+LP +    + I L R + +GSLGFSIVGG + I   N N S                I+SIV G+PA+ +GR++CGDIL+ +N  S   ++H+  V L K  +G + L +VSWPG+++
Sbjct:  489 VANDGTEERDNLRNAN---IPQEVFA--------LPQLHHLIPDGEVTTVKITRADPCEPLAISIVGGNETPLVRILIQDIYREGVIARDGRLLPGDMILKVNGIDITNVPHCY---ALAALKQPCTLLRLTVLREQRHRYRSHHHHHTPSPGELYPGHGPMIRDDSLHVVLVKGAPDEQLGIKLVRRPDEHGVFIFHLLEGGLAARDARLRVDDRVLAINGHDLRYGAPEHAALLIQASVERVHFIVSRQTHVPAPDILQEAPWNMEGPPPYSPVDIEHTL-------------------LDS--CHKPACYEKTVTLSKEPNESLGMTVAGGMNSRGWDLPVYITNIDPNGVVSQEGSIRKGDILLNVNGVDLTGVTRGEAVANLK---NTSSPVVLRVLEMRPPDVSSLDCMPPLHSPCSLSPCSPSDIKMPLPSDDYSPLWVSWLQLPRHLYCCKDIVLRR-STSGSLGFSIVGGQEEI---NCNQSF--------------FIRSIVEGTPAYNDGRIRCGDILLEVNGKSTWGMTHTALVRLLKELRGRITLTIVSWPGSLL 1000          
BLAST of Ligand of Numb protein X 2 vs. Ensembl Cavefish
Match: lnx1 (ligand of numb-protein X 1 [Source:NCBI gene;Acc:103042826])

HSP 1 Score: 249.595 bits (636), Expect = 1.409e-70
Identity = 181/568 (31.87%), Postives = 281/568 (49.47%), Query Frame = 3
Query:  438 VSINGSQDISNTNSGNNFPKPQDCFYQNNSFYTPLNHLDNLEFNVEDFTITIINPERLE-FGVSFVGGFDTPLQCIVIQEIFRDGRIAMDGRLRPGDQITKINEYYLSQASHIECRDVLSRISQSGDTIYLTIHRDIVDKRWL-----------------PVAKEEILTFVLEKPT-DRKMGLKLAGKTNKSGLYIQEVLPDSQASLDGRLKKDDRILKINEHDLVFGTQNEALEIIKSVKDSVKFVISRIVRPQTPDIIRAA--GTEPDSNMTPIATSSSYPGLKNASTRGYEVGNSPFTFDSPISFKSTYREEVVEVDKKPGESLGMSVAGGVNSQRGDTPVYITNIAPNSLLKNTNGIDKGDILLAVNETELLGLSHERAVEALKLARDNCNKVTVRVLKV-------------------------PNLLLMANTDNFIPSWMYWLKLPGYCQIPRMITLSRDAATGSLGFSIVGGNDPIYPFNTNSSLTDLSHNKEAPYRPIMIKSIVSGSPAHKNGRLKCGDILISINDFSLSNVSHSDAVNLFKSTQGPVHLKVVSWPGTII 2003
            V+ +G+++  N  + N    PQ+ F         L  L +L  + E  T+ I   +  E   +S VGG +TPL  I+IQ+I+R+G IA DGRL PGD I K+N   ++   H      L+ + Q    + LT+ R+   +                    P+ +++ L  VL K   D ++G+KL  + ++ G++I  +L    A+ D RL+ DDR+L IN HDL +G    A  +I++  + V F++SR      PDI++ A    E     +P+    +                     DS    K    E+ V + K+P ESLGM+VAGG+NS+  D PVYITNI PN ++     I KGDILL VN  +L G++   AV  LK   +  + V +RVL++                          ++ +   +D++ P W+ WL+LP +    + I L R + +GSLGFSIVGG + I   N N S                I+SIV G+PA+ +GR++CGDIL+ +N  S   ++H+  V L K  +G + L +VSWPG+++
Sbjct:  489 VANDGTEERDNLRNAN---IPQEVFA--------LPQLHHLIPDGEVTTVKITRADPCEPLAISIVGGNETPLVRILIQDIYREGVIARDGRLLPGDMILKVNGIDITNVPHCY---ALAALKQPCTLLRLTVLREQRHRYRSHHHHHTPSPGELYPGHGPMIRDDSLHVVLVKGAPDEQLGIKLVRRPDEHGVFIFHLLEGGLAARDARLRVDDRVLAINGHDLRYGAPEHAALLIQASVERVHFIVSRQTHVPAPDILQEAPWNMEGPPPYSPVDIEHTL-------------------LDS--CHKPACYEKTVTLSKEPNESLGMTVAGGMNSRGWDLPVYITNIDPNGVVSQEGSIRKGDILLNVNGVDLTGVTRGEAVANLK---NTSSPVVLRVLEMRPPDVSSLDCMPPLHSPCSLSPCSPSDIKMPLPSDDYSPLWVSWLQLPRHLYCCKDIVLRR-STSGSLGFSIVGGQEEI---NCNQSF--------------FIRSIVEGTPAYNDGRIRCGDILLEVNGKSTWGMTHTALVRLLKELRGRITLTIVSWPGSLL 1000          
BLAST of Ligand of Numb protein X 2 vs. Ensembl Cavefish
Match: lnx2a (ligand of numb-protein X 2a [Source:ZFIN;Acc:ZDB-GENE-060228-2])

HSP 1 Score: 241.121 bits (614), Expect = 9.054e-69
Identity = 167/493 (33.87%), Postives = 259/493 (52.54%), Query Frame = 3
Query:  585 ITIINPER----LEFGVSFVGGFDTPLQCIVIQEIFRDGRIAMDGRLRPGDQITKINEYYLSQASHIECRDVLSRISQSGDTIYLTIHRD---------IVDKRWLPVAKEEILTFVLEK-PTDRKMGLKLAGKTNKSGLYIQEVLPDSQASLDGRLKKDDRILKINEHDLVFGTQNEALEIIKSVKDSVKFVISRIVRPQTPDIIRAAGTEPDSNMTPI---ATSSSYPGLKNASTRGYEVGNSPFTFDSPISFKSTYREEVVEVDKKPGESLGMSVAGGVNSQRGDTPVYITNIAPNSLLKNTNGIDKGDILLAVNETELLGLSHERAVEALKLARDNCNKVTVRVLKVPN---------LLLMANTD---NFIPSWMYWLKLPGYCQIPRMITLSRDAATGSLGFSIVGGNDPIYPFNTNSSLTDLSHNKEAPYRPIMIKSIVSGSPAHKNGRLKCGDILISINDFSLSNVSHSDAVNLFKSTQGPVHLK 1976
            IT I   R    +E G+S VGG +TPL  IVIQE++RDG IA DGRL  GDQI ++N   +S   H   R  L R      T+ LT+ R+         +      P      +   L K  +  ++G+KL  +T+++G+++ ++L    A+ DGRL+ +DR+L +NEHDL  GT  +A +II++  + V  +ISR  + QT  +     +    +  P+   A  S  P L+ + +  +            +S   T +E+ + V K+P ESLGM+VAGG  S+ G+ P+++T++ P+  L     I +GD+LL++N  +L  LSH  AV  LK +  + + V +R L+V           LL    +D   ++ PSW+ WL LP Y      I L R +  GS GFSIVGG    Y  N         H+ +A      IK+IV G+PA+ +GRLKCGD+++++N  S + +SHS  V + K  +  + L+
Sbjct:  268 ITTIEVHRSNPYVELGISIVGGNETPLINIVIQEVYRDGVIARDGRLLAGDQILQVNNVDISNMPHSFARSTLGRPCA---TLQLTVLRERRCTARPPAVAPTPSSPEGSPASMRITLHKRESTEQLGIKLVRRTDEAGVFVLDLLDGGLAAKDGRLRSNDRVLAVNEHDLRHGTPEQAAQIIQASGERVNLLISRPAK-QTMAVHTGRESWCHEHFLPLPRTAAPSPAPSLQLSRSSTHR----------DLSQCVTCKEKHITVKKEPHESLGMTVAGGRGSKSGELPIFVTSVQPHGCLSRDGRIKRGDVLLSINGQDLTCLSHSEAVGTLKSSAAS-SSVQLRALEVSTVDEPGHDEGLLPHHESDYDASWSPSWVMWLGLPSYLHSSHEIILRR-SHPGSWGFSIVGG----YEEN---------HSNQA----FFIKTIVLGTPAYYDGRLKCGDMIVAVNGLSTAGMSHSALVPMLKEQRSRLALQ 727          
BLAST of Ligand of Numb protein X 2 vs. Ensembl Sea Lamprey
Match: LNX2 (ligand of numb-protein X 2 [Source:HGNC Symbol;Acc:HGNC:20421])

HSP 1 Score: 149.058 bits (375), Expect = 5.933e-40
Identity = 117/369 (31.71%), Postives = 183/369 (49.59%), Query Frame = 3
Query:  954 SGLYIQEVLPDSQASLDGRLKKDDRILKINEHDLVFGTQNEALEIIKSVKDSVKFVISRIVRPQTPDIIRAAGTEPDSNMTPIATSSSYPGLKNASTRGYEVGNSPFTFDSPISFKSTYREEVVEVDKKPGESLGMSVAGGVNSQRGDTPVYITNIAPNSLLKNTNGI--DKGDILLA-VNETELL----GLSHERAVEALKLARDNC----NKVTVRVLKVPNLLLMANTDNFIPSW--MYWLK-LPGYCQI-----PRMITLSRDAATGSLGFSIVGGNDPIYPFNTNSSLTDLSHNKEAPYRPIMIKSIVSGSPAHKNGRLKCGDILISINDFSLSNVSHSDAVNLFKSTQGPVHLKVVSWPGTII 2003
            SG+++ ++L    A++DGRL+  DR+L IN HDL  GT   A ++I+  +D V  V+SR  +P  P      G    S+  P A   S P               P  +   +S   + +E+VV V K+  ESLGM+VAGG+ S+ G+ P+++T++  +  L     I  D G + L  V+E +      GL H+  + + K   ++     + V + +      LL+    ++  S+    W   L  YC        R   + R + +GS GFSIVGG      +  N S            +P  IKSIV G+PA+ +GRLKCGD+++++N    + +SH+  V L K  +G V L VVSWPG+I+
Sbjct:    9 SGVFVLDLLEGGPAAVDGRLRPSDRVLSINGHDLRQGTPEMAAQVIQGSEDRVHIVVSRPGKPGPPGPGGQDG---RSHAIPGAAHPSPP--------------KPCHYRE-LSQAVSCQEKVVTVRKEASESLGMTVAGGLASRSGELPIFVTSVQGHGCLGRDGRIHRDMGSVYLHPVSEIKACRLGTGLQHKGQLASFKKTHNSSIVKLSLVEIWITSEHAALLLNLPKSYYRSFNGRTWFSILYSYCASGSFLQSRKEVILRRSTSGSWGFSIVGG------YEENHS-----------NQPFFIKSIVLGTPAYNDGRLKCGDMIVAVNGHGTTGMSHAALVTLLKELRGKVTLTVVSWPGSIL 342          
BLAST of Ligand of Numb protein X 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004677.1 (pep scaffold:Pmarinus_7.0:GL479538:28591:32639:-1 gene:ENSPMAG00000004260.1 transcript:ENSPMAT00000004677.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 87.8113 bits (216), Expect = 2.235e-20
Identity = 53/180 (29.44%), Postives = 91/180 (50.56%), Query Frame = 3
Query:  660 IVIQEIFRDGRIAMDGRLRPGDQITKINEYYLSQASHIECRDVLSRISQSGDTIYLTIHRDIVDKRWLPVAKEEILTFVLEKPTDRKMGLKLAGKTNKSGLYIQEVLPDSQASLDGRLKKDDRILKINEHDLVFGTQNEALEIIKSVKDSVKFVISRIVRPQTPDIIRAAGTEPDSNMTP 1199
            I+I E++ +G  A DGRL  GDQI K+N   L  A+H    D ++ +  S   + L ++RD    R    +   + T  L K   R +GL + GK + +G+++ EV+    A  DGRL + D+IL ++  D+   +Q     I+K  +  VK  + R+   +   ++ +  T   S ++P
Sbjct:    4 IMIHEVYEEGAAAKDGRLWAGDQILKVNGTDLRSATH---EDAINALRASPQLVRLYVYRDEARYRGDDESALHVFTVELLKKAGRGLGLSIVGKKSGNGVFVSEVVHGGAAEADGRLTQGDQILSVDGEDVRSASQETVAAILKCAQGVVKMEVGRM---KVGSLLSSRRTSDTSQVSP 177          
BLAST of Ligand of Numb protein X 2 vs. Ensembl Sea Lamprey
Match: LIN7B (lin-7 homolog B, crumbs cell polarity complex component [Source:HGNC Symbol;Acc:HGNC:17788])

HSP 1 Score: 55.0694 bits (131), Expect = 4.430e-9
Identity = 32/79 (40.51%), Postives = 46/79 (58.23%), Query Frame = 3
Query: 1338 KPGESLGMSVAGGVNSQRGDTPVYITNIAPNSLLKNTNGIDKGDILLAVNETELLGLSHERAVEALKLARDNCNKVTVR 1574
            K  E LG +V GG   +  ++P+YI+ I P  +     G+ +GD LL+VN   + G  HERAVE LK A+ +  K+ VR
Sbjct:   75 KTDEGLGFNVMGG---KEQNSPIYISRIIPGGVADRQGGLKRGDQLLSVNGVSVEGEHHERAVELLKQAQGSV-KLVVR 149          
BLAST of Ligand of Numb protein X 2 vs. Ensembl Sea Lamprey
Match: lin7a (lin-7 homolog A (C. elegans) [Source:ZFIN;Acc:ZDB-GENE-040426-1665])

HSP 1 Score: 53.9138 bits (128), Expect = 1.344e-8
Identity = 33/85 (38.82%), Postives = 49/85 (57.65%), Query Frame = 3
Query: 1320 VVEVDKKPGESLGMSVAGGVNSQRGDTPVYITNIAPNSLLKNTNGIDKGDILLAVNETELLGLSHERAVEALKLARDNCNKVTVR 1574
            VVE+  K  E LG ++ GG   +  ++P+YI+ I P  +     G+ +GD LL+VN   + G  HE+AVE LK A+    K+ VR
Sbjct:   80 VVEL-PKTDEGLGFNIMGG---KEQNSPIYISRIIPGGVADRQGGLKRGDQLLSVNGVSVEGEHHEKAVELLKQAQGTV-KLVVR 159          
BLAST of Ligand of Numb protein X 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002205.1 (pep scaffold:Pmarinus_7.0:GL477144:51012:68257:1 gene:ENSPMAG00000001988.1 transcript:ENSPMAT00000002205.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 54.6842 bits (130), Expect = 5.853e-8
Identity = 58/214 (27.10%), Postives = 92/214 (42.99%), Query Frame = 3
Query:  921 MGLKLAGK-TNKSGL---YIQEVLPDSQASLDGRLKKDDRILKINEHDLVFGTQNEALEIIKSVK--DSVKFVISRIVRPQTPDIIRAAGTEPDSNMTPIATSSSYPGLKNASTRGYEVGNSPFTFDSPISFKSTYREEVVEVDKKPGESLGMSVAGGVNSQRG--DTPVYITNIAPNSLLKNTNGIDKGDILLAVNETELLGLSHERAVEALK 1538
            +G  L  + T  SGL   YI+ +LP   A  DGRL   DR++ +N  D+   +Q++ + I++ V    SV  ++SR                 D+ +TP A  +      +   +    G    T   P    +    E+   +  P   LG+SV G   S+ G  D  +Y+ +I           +  GD L+AVN   LLG S+  A+E L+
Sbjct:  397 LGFSLTSRDTPVSGLGHVYIKHILPRGAAIADGRLHAGDRLIMVNGVDVSSMSQDQVVSILRGVHPGSSVDLLVSR----------------HDALLTPPAQEARLVKQMHPDQQAERSGGMIVTASGPCECLNL---EIALSECGPA-GLGVSVKGN-RSRDGAHDLGIYVKSIIAGGAAAKDGRLRIGDQLVAVNREPLLGRSNAAAMETLR 589          
BLAST of Ligand of Numb protein X 2 vs. Ensembl Nematostella
Match: EDO33706 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRG3])

HSP 1 Score: 91.6633 bits (226), Expect = 5.630e-19
Identity = 129/542 (23.80%), Postives = 217/542 (40.04%), Query Frame = 3
Query:  549 LDNLEFNVEDF--TITIINPERLEFGVSFVGGFDTPLQCIVIQEIFRDGRIAMDGRLRPGDQITKINEYYLSQASHIECRDVLSRISQSGDTIYLTIHRDIVDKRW----------LPVAKEE--ILTFVLEKPTDRKMGLKLAG--KTNKSGLYIQEVLPDSQASLDGRLKKDDRILKINEHDLVFGTQNEALEIIKSVKDSVKFVISRIVRPQTPDIIRAAGT-----------------EPDSNMT---------PI-----------ATSSSYPGLKNASTRGYEV----GNSPFTFDSPISFKSTYREEVVEVDKKPGE-----------SLGMSVAG--GVNSQRGDTPVYITNIAPNSLLKNTNGIDKGDILLAVNETELLGLSHERAVEALKLARDNCNKVTVRVLKVPNLLLMANTDNFIPSWMYWLKLPGYCQIPRMITLSRDAATGSLGFSIVGGND----PIYPFNTNSSLTDLS-HNKEAPYRPIMIKSIVSGSPAH-----KNGRLKCGDILISINDFSLSNVSHSDA 1934
            LDNL  +V+    TITI      + GVS  G  D      V+  + R G IA+DGR+  GD I  +N+  L   S    R VL + S   D I ++I +     R           +P  + E  +    L +  +  +G+ +AG  +  + G++++ VL +S  +  G LK  D+IL+++ HDL   +  EA+E+I+  +  V+FV+  I   + P  +   G+                 EP   +T         PI           ++S  +P L+ A+    +      ++P   + P S++   RE   +     GE            LG+S+AG  GV   R    ++I ++      +    I + D +L VN T + G+SH +A   LK    +      R  +    L          S    +K P   Q     T     +    G  +  G      P+ P  +  SL   S         P ++  +  G         K+GRL+ GD LI+++D ++  +SH++ 
Sbjct: 1105 LDNLPDSVKSRMQTITIRRQMVGKLGVSLKGDEDG--SGCVVTSVMRGGAIAIDGRIGVGDHIVAVNDESLIGLSRHAARAVLRKQSLQKD-IVVSIDKQEASTREDSPAFLTPFDVPFVETESGLRVVELRREPEVGLGISIAGNKRGQRQGVHVRHVLENSSVARLGELKAGDQILEVDGHDLRNASHEEAVEVIRRARSPVRFVVRTIQDKEDPLSLDTMGSPSSFEGPVTTINARTSHEPSQPITARDDLHKDIPISAKNLDSPPRDSSSRDFPSLEQAAPHKEQTIEANVSAPDHSEMP-SYEDRIRELQAKYPDVTGEHLLVSLSKGNTGLGLSIAGGKGVAVNR----IFIVDVKSGGPAEQDGRIKQADEILEVNRTPVRGMSHYQASTVLKNTGTSVELALGRSREAAEYLSRTRQQASPHSTEPDIK-PSNIQ-----TTESTPSISPRGVEVAAGPRRTPPPVAPKPSTDSLKRSSPQAGSVTVSPTLLAELSGGQLVEYIDFVKDGRLRKGDQLIAVDDQAIVGLSHAEG 1632          

HSP 2 Score: 73.9442 bits (180), Expect = 1.841e-13
Identity = 108/432 (25.00%), Postives = 172/432 (39.81%), Query Frame = 3
Query:  921 MGLKLAGKTNKS--GLYIQEVLPDSQASLDGRLKKDDRILKINEHDLVFGTQNEALEIIKSVKDSVKFVISRIVRP-----QTPDIIRAAGTEPDSNMTPIATSSSYPGLKNASTRGYEVGNSPFTFDSPISFKSTYREEVVEVDKKPGESLGMSV--AGGVNSQRGDTPVYITNIAPNSLLK-----NTNGIDKGDILLAVNETELLGLSHERAV-------EALKLARDN--------CNKVTVRVL------------------KVPNLLLMANT----DNFIPSWMYWLKLPGYCQIPRMIT----LSRDAATGS-----------------------LGFSIVGGNDPIYPFNTNSSLTDLSHNKEAPYRPIMIKSIVSGSPAHKNGRLKCGDILISINDFSLSNVSHSDAVNLFKSTQGPVHLKVV 1982
            +GL +AG    +   ++I +V     A  DGR+K+ D IL++N   +   +  +A  ++K+   SV+  + R         +T        TEPD   + I T+ S P +   S RG EV   P     P++ K +             +SL  S   AG V      +P  +  ++   L++         + KGD L+AV++  ++GLSH           E    A+D           + T RVL                   +P L + A +    +N  P   Y L +P   +  +  T    + +D+ + S                       LGFSIVGG+         S   DL         PI +K++     A ++GRLK GD +I++N  SL  VSH  AV+  K T+G + L V+
Sbjct: 1437 LGLSIAGGKGVAVNRIFIVDVKSGGPAEQDGRIKQADEILEVNRTPVRGMSHYQASTVLKNTGTSVELALGRSREAAEYLSRTRQQASPHSTEPDIKPSNIQTTESTPSI---SPRGVEVAAGPRRTPPPVAPKPST------------DSLKRSSPQAGSVTV----SPTLLAELSGGQLVEYIDFVKDGRLRKGDQLIAVDDQAIVGLSHAEGTIVIHEVYEDGAAAKDGRLWAGDQILERTTGRVLLNVARLKPGNSSRPSSLSSLPQLQIGAESTSSIENSFPPVNYDLDIPSEPEANQRATPPLPVQQDSPSQSDDEEESESPLQTKIIELERGPEGLGFSIVGGH--------GSPHGDL---------PIYVKTVFPTGAASRDGRLKRGDQIIAVNGQSLVGVSHESAVSQLKKTRGKIILTVL 1832          

HSP 3 Score: 57.3806 bits (137), Expect = 2.067e-8
Identity = 56/241 (23.24%), Postives = 110/241 (45.64%), Query Frame = 3
Query:  879 EILTFVLEKPTDRKMGLKLAGKTNKS----GLYIQEVLPDSQASLDGRLKKDDRILKINEHDLVFG-TQNEALEIIKSVKDSVKFVISRIVRPQTPDIIRAAGTEPDSNMTPIATSSSYPGLKNASTRGYEVGNSPFTFDSPISFKSTYRE-EVVEVDKKPGESLGMSVAGGVNSQRGDTPVYITNIAPNSLLKNTNGIDKGDILLAVNETELLGLSHERAVEALKLARDNCNKVTVRVLK 1583
            E+ T VL KP    +G  + G  +++    G++IQE+  +  A  DGRL++ D+IL I+   L  G +  EA+ +++  +  V+ +++R   P+T      +G     + TP    S+   + +AST              P    + +R+ E +++    G  LG  + GG +S      V I  I P  +      + + D ++ + +  + G+  E+  + L+ A  +   V  R+++
Sbjct:  161 EVETVVLNKPGQGGLGFSVVGLKSENRGELGIFIQEIQEEGVAGRDGRLRESDQILSIDGQQLDSGISHEEAIVLLQKTRGEVELIVARGGIPRTGTSRTTSGASSVISRTP----SNVSLVSDASTT------------IPADDGTHWRQIETIDLHND-GTGLGFGIIGGRSSG-----VSIKTILPGGVADKDGRLQEHDQIMQIGDVNVGGMGSEQVAQVLRDAGSHVRLVISRLVE 379          

HSP 4 Score: 53.9138 bits (128), Expect = 2.624e-7
Identity = 83/385 (21.56%), Postives = 153/385 (39.74%), Query Frame = 3
Query:  951 KSGLYIQEVLPDSQASLDGRLKKDDRILKINEHDLVFGTQNEALEIIKSVKDSVKFVISRIVRP-QTPDIIRAAGTE----PDSNMTPIAT----SSSYPG------LKNASTRGYEVG---------NSPFTFDSPISFKS------------TYREEVVEVDKKPGESLGMSVAGGVNSQRGDTPVYITNIAPNSLLKNTNGIDKGDILLAVNETELLGLSHERAVEALK---LARDNCNKVTVRVLKVPNLLLMANTDNFIPSWMYWLKLPGYCQIP---RMITLSRDAATGSLGFSIVGGNDPIYPFNTNSSLTDLSHNKEAPYRPIMIKSIVSGSPAHKNGRLKCGDILISINDFSLSNVSHSDAVNLFKSTQGPVHLKV 1979
            K+ + I+ ++    A  DG L   DR++ +NE +L   + + A++ +K        VI  + +P   PD       +    PD+    + T    + S PG      + N    G +           +S F F  P+ F                R + + + ++    LG+S+ G  +     +   +T++     +     I  GD ++AVN+  L+GLS   A   L+   L +D    + V + K       A+T    P+++    +P + +     R++ L R+   G LG SI G                   NK    + + ++ ++  S   + G LK GD ++ ++   L N SH +AV + +  + PV   V
Sbjct:  961 KTVIVIRSLVHGGVAEQDGSLHPGDRLMSVNEVNLEHASLDFAVQTLKGTNRG--NVIIGVAKPIPVPDDYEEDSNQGESLPDTTRPFLPTFDLDNESRPGKADISLMDNIENNGKDSDTDSMVTSEQSSKFDFGPPLLFSGDSLDLDNLPDSVKSRMQTITIRRQMVGKLGVSLKGDEDG----SGCVVTSVMRGGAIAIDGRIGVGDHIVAVNDESLIGLSRHAARAVLRKQSLQKD----IVVSIDK-----QEASTREDSPAFLTPFDVP-FVETESGLRVVELRREPEVG-LGISIAG-------------------NKRGQRQGVHVRHVLENSSVARLGELKAGDQILEVDGHDLRNASHEEAVEVIRRARSPVRFVV 1309          
BLAST of Ligand of Numb protein X 2 vs. Ensembl Nematostella
Match: EDO45624 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSE9])

HSP 1 Score: 80.1073 bits (196), Expect = 1.604e-16
Identity = 73/308 (23.70%), Postives = 134/308 (43.51%), Query Frame = 3
Query:  615 FGVSFVGGFDTPLQCIVIQEIFRDGRIAMDGRLRPGDQITKINEYYLSQASHIECRDVLSRISQSGDTIYLTIHRDIVDKRWLPVAKEEILTFVLEKPTDRKMGLKLAGKTNKSGLYIQEVLPDSQASLDGRLKKDDRILKINEHDLVFGTQNEALEIIKSVKDSVKFVISRIVRPQTPDIIRAAGTEPDSNMTPIATSSSYPGLKNASTRGYEVGNSPFTFDSPISFKSTYREEVVEVDKKPGESLGMSVAGGVNSQRGDTPVYITNIAPNSLLKNTNGIDKGDILLAVNETELLGLSHERAVEALK 1538
             G+  +GG DTPL  + I++I         G LR GDQ+ ++N+  L   +H    +VL     +   + LT+ R     +  P    ++ T  L+K +   +G+ ++G    + + ++ V+P   A+ DGR++K DR+L +N       T  E L +++++   V+                 +G    +    +  +   P +K  +    E G S   F                           SV GG +S  GDTP+YI  +  +S   + +G++ GD +L VN   + G+++  A+EA++
Sbjct:    9 IGLMVIGGLDTPLGMLYIKDIQPGTPAEKCGHLRTGDQLLQVNDECLVGVTHAYALEVLK---NTPPLVKLTVAR-----KKDPDRDSDVFTVELKKDSKGSLGIHVSGGVGTNCIDVRHVVPLGVAAKDGRIRKGDRVLSVNGRSTKGLTHQEVLNLLQNLPRRVRLF---------------SGGNGKAFKEILQKTPPEPSVKEIT---LEKGPSGLGF---------------------------SVGGGRDSLYGDTPIYIKYVFKDS-ASSRSGLEIGDEVLEVNGRHMRGMTNVEALEAIR 262          

HSP 2 Score: 53.1434 bits (126), Expect = 1.411e-7
Identity = 54/205 (26.34%), Postives = 93/205 (45.37%), Query Frame = 3
Query: 1338 KPGESLGMSVAGGVNSQRGDTPVYITNIAPNSLLKNTNGIDKGDILLAVNETELLGLSHERAVEALKLARDNCNKVTVRVLKVPNLLLMANTDNFIPSWMYWLKLPGYCQIPRMITLSRDAATGSLGFSIVGGNDPIYPFNTNSSLTDLSHNKEAPYRPIMIKSIVSGSPAHKNGRLKCGDILISINDFSLSNVSHSDAVNLFKS 1952
            K  + +G+ V GG+++  G   +YI +I P +  +    +  GD LL VN+  L+G++H  A+E LK       K+TV   K P+     ++D F                   + L +D + GSLG  + GG        TN                I ++ +V    A K+GR++ GD ++S+N  S   ++H + +NL ++
Sbjct:    4 KEDQGIGLMVIGGLDTPLG--MLYIKDIQPGTPAEKCGHLRTGDQLLQVNDECLVGVTHAYALEVLK-NTPPLVKLTVARKKDPD----RDSDVF------------------TVELKKD-SKGSLGIHVSGG------VGTNC---------------IDVRHVVPLGVAAKDGRIRKGDRVLSVNGRSTKGLTHQEVLNLLQN 161          
BLAST of Ligand of Numb protein X 2 vs. Ensembl Nematostella
Match: EDO46059 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR65])

HSP 1 Score: 72.0182 bits (175), Expect = 2.368e-14
Identity = 67/226 (29.65%), Postives = 101/226 (44.69%), Query Frame = 3
Query: 1317 EVVEVD-KKPGESLGMSVAGGVNSQR--GDTPVYITNIAPNSLLKNTNGIDKGDILLAVNETELLGLSHERAVEALKLARDNCNKVT-VRVLKVPNLLLMANTDNFIPSWMYWLKLPGYCQIPRMITLSRDAATGSLGFSIVGGNDPIYPFNTNSSLTDLSHNKEAPY-RPIMIKSIVSGSPAHKNGRLKCGDILISINDFSLSNVSHSDAVNLFKSTQGPVHLKV 1979
            E +E+  ++ G  LG S+AGG ++     D  +YIT + P         +   D +L+VN T  + + H++AV+ALK A    ++VT VR  K  N                          P    +     +  LGFSI GG                S N+  P    I I  I+ G  A ++GRL+ GD +IS+N  +L +VSH DAV + K+T+  V + V
Sbjct:    3 ETLEITLERGGSGLGFSIAGGTDNPHVDDDFGIYITKVIPGGAAAQDGRLQVNDCILSVNGTNTVDIEHQQAVDALKAAG---SQVTLVREKKRGN-------------------------APTREEIVLIKGSKGLGFSIAGG----------------SGNQHVPGDNGIYITKIIEGGAAQQDGRLQVGDKIISVNLQNLEDVSHEDAVQVLKATKERVTIVV 184          

HSP 2 Score: 65.4698 bits (158), Expect = 3.231e-12
Identity = 68/241 (28.22%), Postives = 102/241 (42.32%), Query Frame = 3
Query:  879 EILTFVLEKPTDRKMGLKLAGKTNKS------GLYIQEVLPDSQASLDGRLKKDDRILKINEHDLVFGTQNEALEIIKSVKDSVKFVISRIVRPQTPDIIRAAGTEPDSNMTPIATSSSYPGLKNASTRGYEVGNSPFTFDSPISFKSTYREEVVEVDKKPGESLGMSVAGGVNSQR--GDTPVYITNIAPNSLLKNTNGIDKGDILLAVNETELLGLSHERAVEALKLARDNCNKVTVRV 1577
            E L   LE+     +G  +AG T+        G+YI +V+P   A+ DGRL+ +D IL +N      GT    +E                   Q  D ++AAG    S +T +              R  + GN+P             REE+V +  K  + LG S+AGG  +Q   GD  +YIT I      +    +  GD +++VN   L  +SHE AV+ LK  ++    V  R+
Sbjct:    3 ETLEITLER-GGSGLGFSIAGGTDNPHVDDDFGIYITKVIPGGAAAQDGRLQVNDCILSVN------GTNTVDIE-----------------HQQAVDALKAAG----SQVTLV--------------REKKRGNAP------------TREEIVLI--KGSKGLGFSIAGGSGNQHVPGDNGIYITKIIEGGAAQQDGRLQVGDKIISVNLQNLEDVSHEDAVQVLKATKERVTIVVSRL 187          

HSP 3 Score: 61.6178 bits (148), Expect = 7.441e-11
Identity = 51/183 (27.87%), Postives = 88/183 (48.09%), Query Frame = 3
Query:  615 FGVSFVGGFDTPLQ----CIVIQEIFRDGRIAMDGRLRPGDQITKINEYYLSQASHIECRDVLSRISQSGDTIYLTIHRDIVDKRWLPVAKEEILTFVLEKPTDRKMGLKLAGKTNK------SGLYIQEVLPDSQASLDGRLKKDDRILKINEHDLVFGTQNEALEIIKSVKDSVKFVISRI 1133
             G S  GG D P       I I ++   G  A DGRL+  D I  +N    +    IE +  +  +  +G  + L   +    KR     +EEI   VL K + + +G  +AG +        +G+YI +++    A  DGRL+  D+I+ +N  +L   +  +A++++K+ K+ V  V+SR+
Sbjct:   16 LGFSIAGGTDNPHVDDDFGIYITKVIPGGAAAQDGRLQVNDCILSVNG---TNTVDIEHQQAVDALKAAGSQVTLVREK----KRGNAPTREEI---VLIKGS-KGLGFSIAGGSGNQHVPGDNGIYITKIIEGGAAQQDGRLQVGDKIISVNLQNLEDVSHEDAVQVLKATKERVTIVVSRL 187          
BLAST of Ligand of Numb protein X 2 vs. Ensembl Nematostella
Match: EDO33432 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SS78])

HSP 1 Score: 71.633 bits (174), Expect = 8.589e-13
Identity = 91/374 (24.33%), Postives = 152/374 (40.64%), Query Frame = 3
Query:  915 RKMGLKLAG-------KTNKSGLYIQEVLPDSQASLDGRLKKDDRILKINEHDLVFGTQNEALEIIKSVKDSVKFVISR----IVRPQTPDIIRAAGTEPDSNMTPIATSSSYPGLKNASTRGYEVGNSPFTFDSPISFKSTYREEVVEVDKKPGESLGMSVAGGVNS---QRGDTPVYITNIAPNSLLKNTNGIDKGDILLAVNETELLGLSHERAVEALK---------LARDNC--NKVT--VRVLKVPNLLLMANTDNFIPSWMYWLKL----PGYCQIPRMITLSRDAATGSLGFSIVGGNDPI-YPFNTNSSLTDLSHNKEAPYRPIMIKSIV-SGSPAHKNGRLKCGDILISINDFSLSNVSHSDAV 1937
            + +G+ +AG       K N  G++I  +  +  A  DG L   D+ILK+N  D+   T ++A++++KS    +   + R    I +   P   +    + +   T +  +   P +++  TR                      +E + + +   + LG S+AGG  S   + GD  ++I+ IA +   +    +  GD +L++N  ++    H+ AV  L          + RD     K+T   R  K  N         + PS     K     P   +I   I L +      LGFSIVGG+D   +PF  +                I I  IV +G  A  N  LK GD ++ +N   + N +H DAV
Sbjct:  576 KGLGINIAGGKGSTPYKENDEGIFISRISENGPAGRDGILHVGDKILKVNGVDISNATHHQAVDVLKSTGKDITLYVVREKQEIEKRTVPKTAKDESVKEEPKKTGVRFAPE-PEMEDIETR--------------------PEKETITLKRGGDKGLGFSIAGGKGSTPYKDGDPGIFISKIAKDGTAERDGRLKVGDKVLSINSRDMKNAKHDDAVNMLTSGPSFVTLIVYRDRVINKKMTPLTRAGKQYNPSPSRAGKQYNPSPARAGKQYSPSPARAEINHEIILKK--GNNPLGFSIVGGSDHASHPFGMDEP-------------GIFISKIVPTGVAATTN--LKIGDRVLMVNGKDMRNATHQDAV 911          

HSP 2 Score: 62.003 bits (149), Expect = 7.761e-10
Identity = 65/239 (27.20%), Postives = 97/239 (40.59%), Query Frame = 3
Query: 1347 ESLGMSVAGGVNS---QRGDTPVYITNIAPNSLLKNTNGIDKGDILLAVNETELLGLSHERAVEALKLARDNCNKVTVRVLKVPNLLLMANTDNFIPSWMYWLKLPG--YCQIPRM-----------ITLSRDAATGSLGFSIVGGNDPIYPFNTNSSLTDLSHNKEAPYRP----IMIKSIVSGSPAHKNGRLKCGDILISINDFSLSNVSHSDAVNLFKSTQGPVHLKVVSWPGTII 2003
            + LG+++AGG  S   +  D  ++I+ I+ N        +  GD +L VN  ++   +H +AV+ LK    +     VR  +      +  T     S     K  G  +   P M           ITL R    G LGFSI GG                      PY+     I I  I     A ++GRLK GD ++SIN   + N  H DAVN+   T GP  + ++ +   +I
Sbjct:  576 KGLGINIAGGKGSTPYKENDEGIFISRISENGPAGRDGILHVGDKILKVNGVDISNATHHQAVDVLKSTGKDITLYVVREKQEIEKRTVPKTAKD-ESVKEEPKKTGVRFAPEPEMEDIETRPEKETITLKRGGDKG-LGFSIAGGKG------------------STPYKDGDPGIFISKIAKDGTAERDGRLKVGDKVLSINSRDMKNAKHDDAVNML--TSGPSFVTLIVYRDRVI 792          

HSP 3 Score: 52.373 bits (124), Expect = 7.225e-7
Identity = 83/398 (20.85%), Postives = 149/398 (37.44%), Query Frame = 3
Query:  531 YTPLNHLDNLEFNVEDFTITIINPERLEFGVSFVGG-FDTPLQ----CIVIQEIFRDGRIAMDGRLRPGDQITKINEYYLSQASHIECRDVLSRISQSGDTIYLTIHRD-IVDKRWLPV---------------------------------AKEEILTFVLEKPTDRKMGLKLAGKTNKS---------GLYIQEVLPDSQASLDGRLKKDDRILKINEHDLVFGTQNEALEIIKSVKDSVKFVISRIVRPQTPDIIRAAGTEPDSNMTPIATSSSYPGLK-NASTRGYEVGNSPFTFDSPISFKSTYREEVVEVDKKPGESLGMSVAGGVNSQRGDTPVYITNIAPNSLLKNTNGIDKGDILLAVNETELLGLSHERAVEALKLARDNCNKVTVRV 1577
            + P   ++++E   E  TIT+        G S  GG   TP +     I I +I +DG    DGRL+ GD++  IN   +  A H    D ++ ++     + L ++RD +++K+  P+                                 A+ EI   ++ K  +  +G  + G ++ +         G++I +++P   A+    LK  DR+L +N  D+   T  +A+  + +    +K ++                  P   +  +    S PG K   S RG   G+                         PG  L           + D  ++I+ ++  +       +  G  +L VN   LLG +H  AV AL   R   ++VT+ V
Sbjct:  684 FAPEPEMEDIETRPEKETITLKRGGDKGLGFSIAGGKGSTPYKDGDPGIFISKIAKDGTAERDGRLKVGDKVLSINSRDMKNAKH---DDAVNMLTSGPSFVTLIVYRDRVINKKMTPLTRAGKQYNPSPSRAGKQYNPSPARAGKQYSPSPARAEINHEIILKKGNNPLGFSIVGGSDHASHPFGMDEPGIFISKIVPTGVAATTN-LKIGDRVLMVNGKDMRNATHQDAVAALIANVSLIKLLVRH--------------DPPPKGLNDVNFHKS-PGEKLGISIRGGAKGH-------------------------PGNPL----------DKTDEGIFISKVSEGAAAHKDGRLMVGQRILEVNGVSLLGATHLEAVRAL---RSMGDRVTLLV 1024          
BLAST of Ligand of Numb protein X 2 vs. Ensembl Nematostella
Match: EDO45887 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRU6])

HSP 1 Score: 60.8474 bits (146), Expect = 1.477e-9
Identity = 112/496 (22.58%), Postives = 195/496 (39.31%), Query Frame = 3
Query:  666 IQEIFRDGRIAMDGRLRP--------GDQITKINEYYLSQASH-IECRDVLSRISQSGDTIYLTIHRDIVDKRWLPVAKEEILTFVLEKPTDRKMGLKLAGKTNKSGLYIQEVLPDSQASLDGRLKKDDRILKINEHDLVFGTQNEALEI---------------------------------------------IKSV-KDSVKFVISRIVRPQ---------TPDIIRAAGTEPDSNMTPIATSSSYPGLKNASTRGYEVGNSPFTFDSPISFKSTYREEVVEVDKKPGESLGMSVAGGVNSQRGDTPVYITNIAPNSLLKNTNGIDKGDILLAVNETELLGLSHERAVEALKLARDNCNKVTVRVLKVPNLLLMANTDNFIP---SWMYWLKLPGYCQIPRMITLSRDAATGSLGFSIVGGNDPIYPFNTNSSLTDLSHNKEAPY-RPIMIKSIVSGSPAHKNGRLKCGDILISINDFSLSNVSHSDAVNLFK 1949
            +QE  +  ++   GR +P         +Q+     Y+  Q  H  E  +  S    S D I + +H D           E+ L F + KP     G ++       GL ++E+     AS +G+L+  DRIL++N  +L+  + + A E+                                             IK+V KD  K  +S+   PQ         +P I R+ G  P S  +P       PG ++ S      G  P    S +  K      ++E++K  G+ LG S+    N   G TP+++ +I           +  GD ++ VN   + G +   AV  L+       +  V++L     L+ + T   I        +L+  G   +   I L+   A G LG S+ G             + D    +++P    I +KS+++G  A K+GRLK  D L+S+N+ S   +++++A++  +
Sbjct:   59 LQEEHQKDQLRSSGRYQPQATVSLPRKEQLNDFPSYHHQQYPHEREHTNSYSSDDSSDDVIMIELHPD----------NEDDLGFTV-KPYKTADGREI-------GLIVREIAAGKCASRNGKLQVADRILEVNGQNLMDLSNSRAQEVFDSAIRSPVIKLAVSASSSFVSGNTKKPTKHDKPPSASFQPEPVVIKAVYKDKEKASMSKPEIPQNFGLPRSPVSPGIPRSPGF-PKSPRSPDGIEPP-PGFRDNSQ-----GAPPPMLSSKVVSKRM----LLELNKG-GDGLGFSITTRDNPAGGHTPIFVKSILAKGAAIEDGRLRGGDQIIEVNGMPMTGKNQGEAVNILR-----STEGVVKLLIQREELVQSPTKPAIELNEDSTRYLREQGKQVLTFKIPLNMSGAAG-LGVSVKG------------KVADTDSGRDSPIDMGIFVKSVIAGGAAFKDGRLKAEDQLLSVNNVSFMRLTNTEAIDGLR 506          

HSP 2 Score: 49.2914 bits (116), Expect = 5.483e-6
Identity = 47/202 (23.27%), Postives = 88/202 (43.56%), Query Frame = 3
Query:  633 GGFDTPLQCIVIQEIFRDGRIAMDGRLRPGDQITKINEYYLSQASHIECRDVL-------------SRISQSGDTIYLTIHRDIVDKRWLPVAKEEILTFV--LEKPTDRKMGLKLAGKTNKS----------GLYIQEVLPDSQASLDGRLKKDDRILKINEHDLVFGTQNEALEIIKSVKDSVK----FVISRIVRPQTP 1151
             G  TP   I ++ I   G    DGRLR GDQI ++N   ++  +  E  ++L               + QS     + ++ D    R+L    +++LTF   L       +G+ + GK   +          G++++ V+    A  DGRLK +D++L +N    +  T  EA++ ++    + +    F+ + + R + P
Sbjct:  333 AGGHTP---IFVKSILAKGAAIEDGRLRGGDQIIEVNGMPMTGKNQGEAVNILRSTEGVVKLLIQREELVQSPTKPAIELNEDST--RYLREQGKQVLTFKIPLNMSGAAGLGVSVKGKVADTDSGRDSPIDMGIFVKSVIAGGAAFKDGRLKAEDQLLSVNNVSFMRLTNTEAIDGLRRAMQNTRLGQAFIETTVARERDP 529          
BLAST of Ligand of Numb protein X 2 vs. Ensembl Medaka
Match: lnx2a (ligand of numb-protein X 2 [Source:NCBI gene;Acc:101160604])

HSP 1 Score: 244.588 bits (623), Expect = 4.448e-70
Identity = 181/564 (32.09%), Postives = 281/564 (49.82%), Query Frame = 3
Query:  456 QDISNTNSGNNFPKPQDCFYQNNSFYTPLNHLDNLEFNVEDFTITIINPER----LEFGVSFVGGFDTPLQCIVIQEIFRDGRIAMDGRLRPGDQITKINEYYLSQASHIECRDVLSRISQSGDTIYLTIHRD----------------------IVDKRWLPVAKEEILTFVLEKPTDRKMGLKLAGKTNKSGLYIQEVLPDSQASLDGRLKKDDRILKINEHDLVFGTQNEALEIIKSVKDSVKFVISRIVRPQTP---------DIIRAAGTEPDSNMTPIATSSSYP-GLKNASTRGYEVGNSPFTFDSPISFKSTYREEVVEVDKKPGESLGMSVAGGVNSQRGDTPVYITNIAPNSLLKNTNGIDKGDILLAVNETELLGLSHERAVEALKLARDNCNKVTVRVLKV-------PNLLLMANTD-----NFIPSWMYWLKLPGYCQIPRMITLSRDAATGSLGFSIVGGNDPIYPFNTNSSLTDLSHNKEAPYRPIMIKSIVSGSPAHKNGRLKCGDILISINDFSLSNVSHSDAVNLFKSTQGPVHLKVVSWPGTII 2003
            + +S+T+SG + P+      +      P         ++ +  IT I   R    +E G+S VGG +TPL  +VIQE++RDG IA DGRL  GDQI ++N   +S   H   R  LSR      T+ LT+ R+                             P +  ++   + ++ +  ++G+KL  +T++SG+++ ++L    A+ DGRL+ +DR+L +N+ DL  GT  +A +II++  + V  +I R  +P  P         D+       P+ + TP    S  P  L   ST               +S   + +E+ + V K+P ESLGM+VAGG  S+ G+ P+++T++ P+  L     I +GD+LL++N  +L  LSH  AV  LK A      V +RVL+V        + LL    D     N+ PSW+ WL LP Y      I L R +  GS GFSIVGG +              SH  +    P  IK+IV G+PA+ +GRLKCGD+++++N  S + +SHS  V + K  +  V L VVSWPG+++
Sbjct:  238 RSVSSTSSGWDCPESPPLSAEEGCVKLP---------SLPEGEITTIEVHRANPYVELGISVVGGNETPLINVVIQEVYRDGVIARDGRLLAGDQILQVNNVDISNVPHSFARSTLSRPCT---TLQLTVLRERRCASRAPPSSSSSTPAVPHPPCSTPDGTPSSPTKLRITLHKRDSTEQLGIKLVRRTDESGVFVLDLLEGGLAAKDGRLRSNDRLLAVNDQDLRHGTPEQAAQIIQASGERVYLLIGRPSKPTPPPPPKSSSTRDLYCLEHFLPNHSSTP----SPVPIHLSRTSTH------------RDLSQCVSCKEKHITVKKEPHESLGMTVAGGRGSKSGELPIFVTSVQPHGCLSRDGRIKRGDVLLSINSQDLTYLSHSEAVGTLK-ASAASPSVQLRVLEVIMEEEHNHDELLPHTHDSDFDANWSPSWVMWLGLPSYLHSSHEIVLRR-SHPGSWGFSIVGGYEE-------------SHGNQ----PFFIKTIVLGTPAYYDGRLKCGDMIVAVNGLSTAGMSHSALVPMLKEQRSRVALTVVSWPGSLV 754          
BLAST of Ligand of Numb protein X 2 vs. Ensembl Medaka
Match: lnx1 (ligand of numb-protein X 1 [Source:NCBI gene;Acc:101156395])

HSP 1 Score: 231.876 bits (590), Expect = 2.672e-65
Identity = 172/547 (31.44%), Postives = 270/547 (49.36%), Query Frame = 3
Query:  516 QNNSFYTPLNHLDNLEFNVEDFTITIINPERLE----FGVSFVGGFDTPLQCIVIQEIFRDGRIAMDGRLRPGDQITKINEYYLSQASHIECRDVLSRISQSGDTIYLTIHRDIVDKR-----------------------WLPVAKEEILTFVLEK-PTDRKMGLKLAGKTNKSGLYIQEVLPDSQASLDGRLKKDDRILKINEHDLVFGTQNEALEIIKSVKDSVKFVISRIVRPQTPDIIRAA--GTEPDSNMTPIATSSSYPGLKNASTRGYEVGNSPFTFDSPISFKSTYREEVVEVDKKPGESLGMSVAGGVNSQRGDTPVYITNIAPNSLLKNTNGIDKGDILLAVNETELLGLSHERAVEALKLARDNCNKVTVRVLK------------VPNLLLMANT---------DNFIPSWMYWLKLPGYCQIPRMITLSRDAATGSLGFSIVGGNDPIYPFNTNSSLTDLSHNKEAPYRPIMIKSIVSGSPAHKNGRLKCGDILISINDFSLSNVSHSDAVNLFKSTQGPVHLKVVSWPGTII 2003
            +N+S    +  L  L   + D  +T I   R +      +S VGG +TPL  I+IQ+I+R+G IA DGRL PGD I K+N   +S  +H  C  V S + Q    + LT+ R+                              P  +++ +  VL K     ++G+KL  + ++ G++I  +L    A+ DG+L   DR+L IN HDL +G    A  +I++ +  V F++SR +   TPDI + A  G E     +P+    +                     DS    K    E+ V + K+P +SLGM+VAGG++S+  D P+Y+TN+ P+ ++     I KGDILL VN  +L G++   AV  LK   +  + V ++VL+            +P  L  + T         D++ P W+ WL+LP +    + I L R+  +GSLGFSIVGG + +   N N S                I+SIV G+PA+ +GR++CGDIL+ +N  S   ++H+  V L K  +G + L +VSWPG+++
Sbjct:  279 RNSSVPPEVLALPQLHHLIPDGELTTIKITRSDPSDPLAISIVGGNETPLVRILIQDIYREGVIARDGRLLPGDMILKVNGIDISNVAH--CFAV-SILKQPAQLLRLTVLREQRHHYRSHSQSHPHGHGHEVLSGHQSHGLPPPMRDDSIHVVLNKNAPQEQLGIKLVRRPDEHGVFIFHLLEGGLAARDGQLCIGDRVLAINGHDLRYGAPEHAALLIQASEQRVHFIVSRQICSPTPDIPQEAPWGMEGPPPYSPVDMELTL-------------------LDS--CQKPACYEKTVTLTKEPYDSLGMTVAGGMSSRGWDLPIYVTNVDPDGVVGQEGSIRKGDILLNVNGLDLTGVTRSEAVANLK---NTSSPVVLKVLEMRPPEESLQEFPLPPCLTPSPTDSIKSPVPNDDYSPLWVSWLQLPRHLYYCKDIVLRRN-TSGSLGFSIVGGQEEM---NCNQSF--------------FIRSIVEGTPAYNDGRIRCGDILLEVNGKSTWGLTHTALVRLLKELRGRITLTIVSWPGSLL 780          
BLAST of Ligand of Numb protein X 2 vs. Ensembl Medaka
Match: lnx2b (ligand of Numb protein X 2 [Source:NCBI gene;Acc:101170936])

HSP 1 Score: 207.223 bits (526), Expect = 4.143e-57
Identity = 157/510 (30.78%), Postives = 236/510 (46.27%), Query Frame = 3
Query:  600 PERLEFGVSFVGGFDTPLQCIVIQEIFRDGRIAMDGRLRPGDQITKINEYYLSQASHIECRDVLSRISQSGDTIYLTIHRDIVDKRW-----------LPVAKEEILTFVLEKPT----------DRKMGLKLAGKTNKSGLYIQEVLPDSQASLDGRLKKDDRILKINEHDLVFGTQNEALEIIKSVKDSVKFVISRIVRPQTPDIIRAAGTEPDSNMTPIATSSSYPGLKNASTRGYEVGNSPFTFDSPISFKSTYREEVVEVDKKPGESLGMSVAGGVNSQRGDTPVYITNIAPNSLLKNTNGIDKGDILLAVNETELLGLSHERAVEALKLA---------------------RDNCNKVTVRVLKVPNLLLMANTDNFIPSWMYWLKLPGYCQIPRMITLSRDAATGSLGFSIVGGNDPIYPFNTNSSLTDLSHNKEAPYRPIMIKSIVSGSPAHKNGRLKCGDILISINDFSLSNVSHSDAVNLFKSTQGPVHLKVVSWPGTII 2003
            PE+ + G+  VGG +TPL  IVIQEI RD   A DGRL PGD I ++N+  L+   H     VL   S    T+       + D +             P    +  T   + P              +G+KL  K+  SG+ I ++LP   A+ DG+L+ +D++L IN HDL  GT   A  II++ +  V FV+ R     T D +   G               +   + A    Y    S +  D P  F  +++E+ V + K+P  SLG+++AGG +  R   PVYIT++ P   L     I +GDILL++N  +L  L+++ AV  LK                        ++ NK  V   + P      +  N+ P W  WL LP +    R I L +     S GFSIVGG +              SH ++ P+    IK+IV G+PAH +GRLKCGD ++++N  +   + ++  + + K  +  V L VVSWPGT++
Sbjct:  222 PEQ-DLGLRIVGGKNTPLGNIVIQEIIRDSIAACDGRLAPGDHILEVNDVSLASVPHSRAIAVLRHPSLVRLTVMQEKGFKLRDSQRSDPHPSPSTASQPPRSPQCNTHFNQTPVLHVTLVKSHRSEPLGIKLIRKSEFSGVVILDLLPGGLAAKDGKLRNNDKVLAINGHDLRHGTPESAAHIIQTSEMRVNFVVMR-----TADTVEDGGN---------GREGQHARARRAPDPQYFRRQSTYIKDPPSGF--SFQEKNVSLKKEPRHSLGITIAGGRDC-RSRLPVYITSVQPVGCLHREGYIKRGDILLSINGVDLTQLTYKEAVSVLKAETAQSQVELCVIQTHSEDPEEDSESSNKDEVVYTEDPR----EDNRNWTPQWTRWLGLPSHMHWCRDIVLQK-TNNESWGFSIVGGYEE-------------SHGQQQPF---FIKTIVPGTPAHFDGRLKCGDEIVAVNGATTVGMKNNSLIPMLKLQKNRVTLTVVSWPGTLV 692          
BLAST of Ligand of Numb protein X 2 vs. Ensembl Medaka
Match: MPDZ (multiple PDZ domain crumbs cell polarity complex component [Source:NCBI gene;Acc:101165593])

HSP 1 Score: 172.555 bits (436), Expect = 3.964e-44
Identity = 143/470 (30.43%), Postives = 228/470 (48.51%), Query Frame = 3
Query:  615 FGVSFVGGFDTPLQCIVIQEIFRDGRIAMDGRLRPGDQITKINEYYLSQASHIECRDVLSRISQSGDTIYLTIHRDIVDKRWLPVAKEEIL----TFVLEKPTDRKMGLKLAGKTNKSGLYIQEVLPDSQASLDGRLKKDDRILKINEHDLVFGTQNEALEIIKSVKDSVKFVISRIVRPQTPDIIRAAGTEPDSNMTPIATSSSYP-----GLKNASTRGYEVGNSPFTFDSPISFKSTYRE-EVVEVDKKPGESLGMSVAGGVNSQRGDTPVYITNIAPNSLLKNTNGIDKGDILLAVNETELLGLSHERAVEALKLARDNCNKVTVRVLKVPNLLLMA-NTDNFIPSWMYW--LKLPGYCQIPRMITLSRDAATGSLGFSIVGGNDPIYPFNTNSSLTDLSHNKEAPYRPIMIKSIVSGSPAHKNGRLKCGDILISINDFSLSNVSHSDAVNLFKSTQGPVHLKVVS 1985
             G+S VGG DT L  I+I E++ +G  + DGRL  GDQI ++N   L  ASH +  +VL +  Q    + LT+ RD  + ++    KEE L       L K   + +GL + G+ N +G+++ +++       DGRL + D+IL +N  D+   TQ     ++K     +K  + R            AG  P  +   ++ SS  P      L   S  G      P + DS     + +++   VE+ K P +SLG+S+AGGV S  GD P++I  + P  L   T  +  GD ++++  T   G+SH +AV  LK   +    + ++V+   +  +   + +   PS ++   +  P Y    + ITL R      LGFSIVGG+         S   DL         PI +K++     A ++GRLK GD +I++N  +L  V+H +AV + K T+G V L V+S
Sbjct: 1274 LGLSIVGGCDTLLGAIIIHEVYEEGAASKDGRLWAGDQILEVNGIDLRAASHDDAINVLRQTPQR---VRLTVFRD--EGQY----KEEDLWDSFDVELHKKPGQGLGLSIVGRRNDTGVFVSDIVSGGLVDADGRLLQGDQILSVNGEDVRSATQEAVAALLKCCIGPIKLEVGRF----------KAG--PFHSERRLSQSSQVPCVEILTLLQISESGSSKVARPSSSDSGNLLSAEHQDVRTVELTKGPSDSLGISIAGGVGSPLGDIPIFIAMMNPVGLAAQTQ-LKVGDRIVSICGTSAEGMSHSQAVTLLK---NTPGTIQLQVVAGGDSTVTGPSQEQLTPSCIFQDDIGPPQY----KTITLER--GPDGLGFSIVGGH--------GSPHGDL---------PIYVKTVFGKGAAAEDGRLKRGDQIIAVNGQTLEGVTHEEAVGILKRTKGTVTLTVLS 1695          

HSP 2 Score: 90.1225 bits (222), Expect = 4.979e-18
Identity = 102/410 (24.88%), Postives = 168/410 (40.98%), Query Frame = 3
Query:  915 RKMGLKLAGKTNKSGLYIQEVLPDSQASLDGRLKKDDRILKINEHDLVFGTQNEALEIIKSVKDSVKFVISRIV-RPQTPDIIRAAGTEP--DSNMTPIATSSSYPGLKNASTRGYEVGNSPFTFDSPI-------SFKSTYRE----------EVVEVDKKPGESLGMSVAGGVNSQRGDTPVYITNIAPNSLLKNTNGIDKGDILLAVNETELLGLSHER-------AVEALKLARDNCNKVTVRVLKVPNLLLMANTDNFI--------PSW---MYWLKLPGYCQIPRMITLSRDAAT-----------------GSLGFSIVGGNDPIYPFNTNSSLTDLSHNKEAPYRPIMIKSIVSGSPAHKNGRLKCGDILISINDFSLSNVSHSDAVNLFKSTQGPVHLKV 1979
            R MG +L+      G++I+ +L DS A  +G L+  DRI++++  DL   +  EA+E I+   + V F++  IV RP+   + +    +P   S ++P  T  + P + +A     +                    F  T+ +           ++E++K     LG+S+AG  N  R    V++  I PN        I  GD LL +N   L G SH+        A+  +K+  + C K   ++L V  + ++  T + +        P+     +WL   G+ +     TL+ D AT                   LG SIVGG D +                      I+I  +     A K+GRL  GD ++ +N   L   SH DA+N+ + T   V L V
Sbjct:  963 RGMGSRLSNGEVMRGIFIKHILEDSPAGQNGTLRTGDRIVEVDGVDLRDASHEEAVEAIRRGGNPVTFLVQSIVQRPRVSQLKQ----QPFGLSEISPTGTLLALPVVPHAGESDTDALAEAPAEAGEEGEEEKVDEFGYTWSDRRYGSLPGVLHMIELEKGQ-TGLGLSLAG--NRDRSRMSVFVVGIDPNGAAGRDGRILVGDELLEINGQVLYGQSHQNASSIIKSALSKVKIIFEGCMKPGDKLLAVNGVSVLGYTVDKVLNDESLVDPTSSCPFFWL---GFSRSSTPSTLACDPATCPIIPGCETTIEICKGCTGLGLSIVGGCDTLLG-------------------AIIIHEVYEEGAASKDGRLWAGDQILEVNGIDLRAASHDDAINVLRQTPQRVRLTV 1343          

HSP 3 Score: 85.5001 bits (210), Expect = 1.123e-16
Identity = 121/510 (23.73%), Postives = 201/510 (39.41%), Query Frame = 3
Query:  582 TITIINPERLEFGVSFVGGFDTPLQCIVIQEIFRDGRIAMDGRLRPGDQITKINEYYLSQASHIECRDVLSRISQSGDTIYLTIHRDIVDKR-------WLPVA----------KEEILTF-VLEKPTDRKMGLKLAG-----KTNKSGLYIQEVLPDSQASLDGRLKKDDRILKINEHDLVFGTQNEALEIIKSVKDSVKFVISRIVRPQTPDIIRAAGTEPDSNMTPIATSSSYPGLKNASTRGYEVGNSPFTFDSPISFKSTYREEVVEVDKKPGESLGMSVAGGVNSQRGDTPVYITNIAPNSLLKNTNGIDKGDILLAVNETELLGLSHERAVEALK----LARDNC---------------NKVTVRVLKVPNLLLMAN-TDNFIPSWMYWLKLPGYCQIPRMITLSRDAATGSLGFSIVGGNDPIYPFNTNSSLTDLSHNKEAPYRPIMIKSIVSGSPAHKNGRLKCGDILISINDFSLSNVSHSDAVNLFKSTQ-GPVHLKV 1979
            TI ++N +    G   VGG  T    ++++ I   G    DGRLR GD I +I +  L      +   VL    Q G+ + L + R  V++         LP            +EE  +F V      + +G+ +AG      +  SG++++ +  DS    DGR+   D+I  ++  ++   T  +A+E+++    +V+  + R  R   P+ I  A +   S ++P   S++ P                              E +V   +K  ES G+ ++  + + RG    YI ++ P   +     +  GD L+ VN   L+G +H+  V  LK         C                +VT      P        T+  I S +   +L        +  +  +   G LGFSI+   DP+ P  T                 I+I+S+V    A  +GRL  GD L+ +ND +L N S  DAV   K  + G V + V
Sbjct:  247 TIELVN-DGTGLGFGIVGGKTT---GVIVKTILPGGIADQDGRLRSGDHILRIGDTDLHGMGSEQVAQVLR---QCGNRVKLVVTRAPVEETPSAVMSVVLPTVSEQQVPKQNKEEEAESFNVCLTKNAQGLGITIAGYVGDKNSEPSGIFVKSITKDSAVDQDGRIHVGDQITAVDGVNIQGHTNQQAVELLRHTGQTVRLKLIR--RGFRPEEIPPAVSPSASVLSP---SAAIPTTTTVMRELELERRQEEVIKKWQKILGPSNEVIVAQVEKFSESSGLGIS--LEASRGHH--YIRSVLPEGPVGRCGQLFSGDELVEVNGISLIGETHKEVVRILKELPIFVYMTCCRPPETQSERSDPRSEQVTEESAGNPEAATQDTVTEEGIGSSLAMWEL-------EIQNIELEKGEGGLGFSILDYQDPLDPAKT----------------VIVIRSLVPDGVAETDGRLLPGDRLMYVNDTNLENASLEDAVQALKGAKLGKVQIGV 717          

HSP 4 Score: 83.9593 bits (206), Expect = 4.227e-16
Identity = 92/380 (24.21%), Postives = 160/380 (42.11%), Query Frame = 3
Query:  897 LEKPTDRKMGLKLAGKTNKS----GLYIQEVLPDSQASLDGRLKKDDRILKINEHDL-VFGTQNEALEIIKSVKDSVKFVISRIVRPQTPDIIRAAGTEPDSNMTPIATSSSYPGLKNASTRGYEVGNSPFTFDSPISFKSTYRE-EVVEVDKKPGESLGMSVAGGVNSQRGDTPVYITNIAPNSLLKNTNGIDKGDILLAVNETELLGLSHERAVEALKLARDNCNKVTVRVLKVPNLLLMANTDNFIPSWMYWLKLPGYC--QIPRM----------ITLSRDAATGSLGFSIVGGNDPIYPFNTNSSLTDLSHNKEAPYRPIMIKSIVSGSPAHKNGRLKCGDILISINDFSLSNVSHSDAVNLFKSTQGPVHLKVV 1982
            L+KP    +G  L G  +++    G++IQE+ P S A  DG+LK+ D+IL IN   L    +  +A+ +++S  + V   ++R   PQ         T P  + TP A S+                         +S  S+++  E +E+    G  LG  + GG       T V +  I P  +      +  GD +L + +T+L G+  E+  + L   R   N+V + V + P            PS +  + LP     Q+P+           + L+++A    LG +I G     Y  + NS  +            I +KSI   S   ++GR+  GD + +++  ++   ++  AV L + T   V LK++
Sbjct:  133 LQKPASGGLGFSLVGLKSENRGELGIFIQEIQPGSVADCDGKLKEADQILAINGQPLDQTVSHQQAIGLLQSASERVHLTVARGPIPQL--------TSPIVSRTPSAAST-------------------------LSANSSWQHVETIELVND-GTGLGFGIVGGKT-----TGVIVKTILPGGIADQDGRLRSGDHILRIGDTDLHGMGSEQVAQVL---RQCGNRVKLVVTRAPV--------EETPSAVMSVVLPTVSEQQVPKQNKEEEAESFNVCLTKNAQ--GLGITIAG-----YVGDKNSEPSG-----------IFVKSITKDSAVDQDGRIHVGDQITAVDGVNIQGHTNQQAVELLRHTGQTVRLKLI 444          

HSP 5 Score: 70.0922 bits (170), Expect = 6.423e-12
Identity = 107/458 (23.36%), Postives = 186/458 (40.61%), Query Frame = 3
Query:  660 IVIQEIFRDGRIA-MDGRLRPGDQITKINEYYLSQ-ASHIECRDVLSRISQSGDTIYLTIHRDIVDKRWLPVAK---------------EEILTF-VLEKPTDRKMGLKLAGKTNKSGLYIQEVLPDSQASLDGRLKKDDRILKINEHDLVFGTQNEALEIIKSVKDSVKFVISRIVRPQTPDIIRAAGTEPDSNMTPIATSSSYPGLKNASTRGYEVGNSPFTFDSPISFKSTYREEVVEVDKKPGESLGMSVAGGVNSQRGD-TPVYITNIAPNSLLKNTNGIDKGDILLAVNETELLGLSHERAVEALKLARDNCNKVTVRVLKVPNLLLMANTDNFIPSWMYWLKLPGYCQIPRMITLSRDAATGSLGFSIVGGNDPIY-PFNTN--------SSLTDLSHNKEAPYRPIMIKSIVSGSPAHKNGRLKCGDILISINDFSLSNVSHSDAVNLFK 1949
            I IQEI + G +A  DG+L+  DQI  IN   L Q  SH +   +L   S+    ++LT+ R  + +   P+                 + + T  ++   T    G+ + GKT  +G+ ++ +LP   A  DGRL+  D IL+I + DL      +  ++++   + VK V++R    +TP  +        S + P  +    P  K       E  N   T                    K  + LG+++AG V  +  + + +++ +I  +S +     I  GD + AV+   + G ++++AVE L+          +R    P  +  A +    PS      L     IP   T+ R+         ++     I  P N          S  + L  + EA      I+S++   P  + G+L  GD L+ +N  SL   +H + V + K
Sbjct:  158 IFIQEI-QPGSVADCDGKLKEADQILAINGQPLDQTVSHQQAIGLLQSASER---VHLTVARGPIPQLTSPIVSRTPSAASTLSANSSWQHVETIELVNDGTGLGFGI-VGGKT--TGVIVKTILPGGIADQDGRLRSGDHILRIGDTDLHGMGSEQVAQVLRQCGNRVKLVVTRAPVEETPSAVM-------SVVLPTVSEQQVP--KQNKEEEAESFNVCLT--------------------KNAQGLGITIAGYVGDKNSEPSGIFVKSITKDSAVDQDGRIHVGDQITAVDGVNIQGHTNQQAVELLRHTGQTVRLKLIRRGFRPEEIPPAVS----PSASV---LSPSAAIPTTTTVMRELELERRQEEVIKKWQKILGPSNEVIVAQVEKFSESSGLGISLEASRGHHYIRSVLPEGPVGRCGQLFSGDELVEVNGISLIGETHKEVVRILK 572          

HSP 6 Score: 62.3882 bits (150), Expect = 1.509e-9
Identity = 98/393 (24.94%), Postives = 154/393 (39.19%), Query Frame = 3
Query:  951 KSGLYIQEVLPDSQASLDGRLKKDDRILKINEHDLVFGTQNEALEIIKSVK-------------DSVKFVISRIVRPQTPDIIRA-------AGTEPDS---NMTPIATSSSYPGLKNASTRGYEVGNSPFTFDSPISFKSTYREEVVEVDKKPGESLGMSVAGGVNSQRGDTPVYITNIAPNSLLKNTNGIDKGDILLAVNETELLGLSHERAVEALKL----------ARDN-CNKVTVRVLKVP-NLLLMANTDNFIPSWMYWLKLP-------------GYCQIPRMITLSRDAATGSLGFSIVGGNDPIYPFNTNSSLTDLSHNKEAPYRPIMIKSIVSGSPAHKNGRLKCGDILISINDFSLSNVSHSDAVNLFKSTQGPVHLKVVS 1985
            K+ + I+ ++PD  A  DGRL   DR++ +N+ +L   +  +A++ +K  K              S+   I   + P   D+          +G E D+   +M  +  S+    L    +   +VG   F F    SF   YR++    D+  G  +       V++ +    + I +I     +     +  GD++LA+N      LS+ +A   L+            R N C  V   +  VP   L         PS      LP             G    PR + L R+    SLG SIVGG          S L+    N E   R I IK I+  SPA +NG L+ GD ++ ++   L + SH +AV   +    PV   V S
Sbjct:  659 KTVIVIRSLVPDGVAETDGRLLPGDRLMYVNDTNLENASLEDAVQALKGAKLGKVQIGVAKPLPVSLSVSIPTFIDPCEGDLSDERMLDHTYSGVEEDTFQVSMIALHGSACSTDLDYLQSSTPKVGTC-FGFGG--SFFDVYRQKYE--DQFNGCIMSYPKGMTVSAMKDGLGMLIRSIIHGGSISRDGRLGVGDLILAINGEPTTNLSNAQARAMLRRHSLIGPDLGQRRSNFCVFVGFSITYVPAEYLEEYKLQCLPPSSRMISTLPEREDGEGEESASYGNWNQPRKVELFREHGK-SLGISIVGGR------GMGSRLS----NGEV-MRGIFIKHILEDSPAGQNGTLRTGDRIVEVDGVDLRDASHEEAVEAIRRGGNPVTFLVQS 1034          

HSP 7 Score: 60.8474 bits (146), Expect = 4.562e-9
Identity = 57/224 (25.45%), Postives = 92/224 (41.07%), Query Frame = 3
Query: 1323 VEVDKKPGESLGMSVAGGVNSQRGDTPVYITNIAPNSLLKNTNGIDKGDILLAVNETEL-LGLSHERAVEALKLARDNCNKVTVRVLKVPNLLLMANTDNFIPSWMYWLKLPGYCQIPRMITLSRDAATGSLGFSIVGGNDPIYPFNTNSSLTDLSHNKEAPYRPIMIKSIVSGSPAHKNGRLKCGDILISINDFSLSNVSHSDAVNLFKSTQGPVHLKVVSWP 1991
            VE+ K     LG S+ G  +  RG+  ++I  I P S+      + + D +LA+N   L   +SH++A+  L+ A +   +V + V + P   L +   +  PS    L      Q    I L  D     LGF IVGG                          +++K+I+ G  A ++GRL+ GD ++ I D  L  +       + +     V L V   P
Sbjct:  131 VELQKPASGGLGFSLVGLKSENRGELGIFIQEIQPGSVADCDGKLKEADQILAINGQPLDQTVSHQQAIGLLQSASE---RVHLTVARGPIPQLTSPIVSRTPSAASTLSANSSWQHVETIELVNDGT--GLGFGIVGGK----------------------TTGVIVKTILPGGIADQDGRLRSGDHILRIGDTDLHGMGSEQVAQVLRQCGNRVKLVVTRAP 327          

HSP 8 Score: 55.0694 bits (131), Expect = 2.570e-7
Identity = 88/406 (21.67%), Postives = 167/406 (41.13%), Query Frame = 3
Query:  555 NLEFNVEDFTITII-NPERLEFGVS-FVGGFDTPLQCIVIQEIFRDGRIAMDGRLRPGDQITKINEYYLSQASHIECRDVLSRISQSGDTIYLTIHR-----------------------------------------DIVDKRWLPVA--KEEILTFVLEKPTDRKMGLKLAGKTNKSGLYIQEVLPDSQASLDGRLKKDDRILKINEHDLVFGTQNEALEIIKSVKDSVKFVISRIVRPQTPDIIRAAGTEPDSNMTPIATSSSYPGLKNASTRGYEVGNSPFTFDSPISFKSTYREEVVEVDKKPGESLGMSVAGGVNSQR----GDTPVYITNIAPNSLLKNTNGIDKGDILLAVNETELLGLSHERAVEALKLARDNCNKVTVRVLKVPNLLLMANTDNFI 1625
            N E   E F + +  N + L   ++ +VG  ++    I ++ I +D  +  DGR+  GDQIT ++   +   ++ +  ++L     +G T+ L + R                                         + V K+W  +     E++   +EK ++   GL ++ + ++   YI+ VLP+      G+L   D ++++N   L+  T  E + I+K +     FV     RP      R   ++P S      ++ +       +     +G+S   ++  I        + +E++K  G  LG S+   ++ Q       T + I ++ P+ + +    +  GD L+ VN+T L   S E AV+ALK A+    KV + V K   + L  +   FI
Sbjct:  352 NKEEEAESFNVCLTKNAQGLGITIAGYVGDKNSEPSGIFVKSITKDSAVDQDGRIHVGDQITAVDGVNIQGHTNQQAVELLR---HTGQTVRLKLIRRGFRPEEIPPAVSPSASVLSPSAAIPTTTTVMRELELERRQEEVIKKWQKILGPSNEVIVAQVEKFSESS-GLGISLEASRGHHYIRSVLPEGPVGRCGQLFSGDELVEVNGISLIGETHKEVVRILKELP---IFVYMTCCRPPETQSER---SDPRSEQVTEESAGNPEAATQDTVTEEGIGSSLAMWELEI--------QNIELEKGEG-GLGFSI---LDYQDPLDPAKTVIVIRSLVPDGVAETDGRLLPGDRLMYVNDTNLENASLEDAVQALKGAK--LGKVQIGVAKPLPVSLSVSIPTFI 733          
BLAST of Ligand of Numb protein X 2 vs. Ensembl Medaka
Match: MPDZ (multiple PDZ domain protein-like [Source:NCBI gene;Acc:101166191])

HSP 1 Score: 167.162 bits (422), Expect = 2.258e-42
Identity = 141/478 (29.50%), Postives = 224/478 (46.86%), Query Frame = 3
Query:  615 FGVSFVGGFDTPLQCIVIQEIFRDGRIAMDGRLRPGDQITKINEYYLSQASHIECRDVLSRISQSGDTIYLTIHRDIVDKR----WLPVAKEEILTFVLEKPTDRKMGLKLAGKTNKSGLYIQEVLPDSQASLDGRLKKDDRILKINEHDLVFGTQNEALEIIKSVKDSVKFVISRI-----VRPQTPDIIRAAGTEPD----SNMTPIATSSSYPGLKNASTRGYEVGNSPFTFDSPISFKSTYREEV--VEVDKKPGESLGMSVAGGVNSQRGDTPVYITNIAPNSLLKNTNGIDKGDILLAVNETELLGLSHERAVEALKLARDNCNKVTVRVL------KVPNLLLMANTDNFIPSWMYWLKLPGYCQIPRMITLSRDAATGSLGFSIVGGNDPIYPFNTNSSLTDLSHNKEAPYRPIMIKSIVSGSPAHKNGRLKCGDILISINDFSLSNVSHSDAVNLFKSTQGPVHLKVVS 1985
             G+S VGG DT L  ++I E+   G    DGRL+ GDQI ++N   L QA+H E   VL   +Q    + L I R     R    W      ++ +  L       +G    GK+N +G+++ +V+    A  DGRL   D+IL IN  D+   +Q+ A ++++S   +V   ++R         Q+ D  +    + +    S +TP + S       + S+RG          +S     S+   EV  V V K P +SLG+S+AGGV S  G+ P++I  +  N L   T  +  GD +L +N+    G++H+   EA  L ++    VT++V          +   +    +  P  + W       +  + ITL R   +  LGFSIVGG          S   DL         PI +K+I +   A ++GRLK GD +I++N   L  V+H++AV++ K T+G V L ++S
Sbjct: 1481 LGLSIVGGCDTLLGAVIIHEVNDGGAAQRDGRLQAGDQILEVNSIDLRQATHDEAIAVLRLTTQQ---VRLCIFRHQEAYREEDLW------DVFSLKLSPRPGEGLGFTTVGKSNDTGIFVSDVIRGGAADSDGRLLPGDQILSINGVDVRAASQDHAQKLLQSSSGAVLLEVARFKARVQYSRQSQDYAKFCFIQHEDSDCSTLTPTSGS-------DTSSRGA---------NSKAKCSSSQDREVRKVTVQKGPRDSLGISIAGGVGSPHGNVPLFIATMDTNGLAAKTEKLQTGDQILCINDVSTEGMTHD---EAGALLKNAAGSVTLQVTADSGGGSRQDHSAVHAASSSQPGSLTWFHNNLCPRKYKTITLER--GSSGLGFSIVGG--------FGSPHGDL---------PIYVKTIFNKGAAVEDGRLKRGDQIIAVNGHCLEGVTHAEAVDILKRTKGTVVLTLLS 1911          

HSP 2 Score: 65.855 bits (159), Expect = 1.315e-10
Identity = 88/391 (22.51%), Postives = 149/391 (38.11%), Query Frame = 3
Query:  915 RKMGLKLAGKTNKSGLYIQEVLPDSQASLDGRLKKDDRILKINEHDLVFGTQNEALEIIKSVKDSVKFVI-SRIVRPQTPDIIRAAGTEPDSNMTPIATSSSYPGLKNASTRGYEVGNSPFTFDSPISFKSTYREEV--------------------------------VEVDKKPG-ESLGMSVAGGVNSQRGDTPVYITNIAPNSLLKNTNGIDKGDILLAVNETELLGLSHERAVEALKLARDNCNKVTVRVLKVPNLLLMANTDNFIPSWM-YWLKLPGYCQIPRMITLSRDAATGSLGFSIVGGNDPIYPFNTNSSLTDLSHNKEAPYRPIMIKSIVSGSPAHKNGRLKCGDILISINDFSLSNVSHSDAVNLFKSTQGPVHLKVV 1982
            R MG +L+      G++I+ + PDS A+ +G L+  DRIL+++  DL   +  EA+E I+   DSV  ++ S   R Q+P       T P SN        +   L  + +       +PF   SP S +   R  V                                +E++K P    LG+++AG  +  R    V + ++ P         I  GD LL +N   L G S++ A   +  A      V +R      +         +  W          C   + I L++D A   LG  +V   DP                    +  +++ S++    A K+GR+K GD ++ +    ++ +S     +L    Q  V L ++
Sbjct: 1035 RGMGRRLSSGEMMRGVFIKHISPDSPAAHNGTLRAGDRILEVSGVDLRDASHEEAVEAIRRAGDSVVLLVRSGQDRCQSPAPTCRTPT-PQSNSHSSKEEEALSSLFLSVSHRNPFTPTPFKAPSPTSDRMDGRIPVNATAAAAAEDGDDACRKKMLQRYGSLSGKLHMIELEKDPAVPGLGITLAGSKDGSRARLSVCVASVDPQGPTGLDGRIQVGDELLEINGKILYGRSYQNASTIISNAPSKVKIVLIRNKAGKAVKENRTEGEVVIDWHPDAADEEESCSDLKRIVLTQDHA--GLGIRLV--EDP-------------------SWEGVVVGSLIQDGSASKDGRIKVGDRILEVGGEPVAGLSVEKVSSLISKQQVAVKLSII 1401          

HSP 3 Score: 61.6178 bits (148), Expect = 2.911e-9
Identity = 107/491 (21.79%), Postives = 188/491 (38.29%), Query Frame = 3
Query:  615 FGVSFVGGFDTPLQ--CIVIQEIFRDGRIAMDGRLRPGDQITKINEYYLSQASHIECRDVLSRISQSGDTIYLTIHRDIVDKR-------------WLPVAKEEI-----LTFVLEKPTDRKMGLKLAGKTNKSGLYIQEVLPDSQASLDGRLKKDDRILKINEHDLVFGTQNEALEIIKSVKDSVKFVISRIVRPQTPDIIRAAGTEPDSNMTPIATSSSYPGLKNASTRGYEVGN-----SPFTFDSPISFKSTY-REEVVEVDKKPGESLGMSVAGGVNSQRGDTPVYITNIAPNSLLKNTNGIDKGDILLAVNETELLGLSHERAVEALKLARDNCNKVTVRVLKVPNLLLMANTDNFIPS--W-MYWLKLPGYCQIPRMITLSRDAATGSLGFSIVGGNDPIYPFNTNSSLTDLSHNKEAPYRPIMIKSIVSGSPAHKNGRLKCGDILISINDFSLSNVSHSDAVNLFKSTQGPVHLKVVSWPGTI 2000
             G++  G  D       + +  +   G   +DGR++ GD++ +IN   L   S+     +   IS +   + + + R+   K              W P A +E      L  ++       +G++L    +  G+ +  ++ D  AS DGR+K  DRIL++    +   +  +   +I   + +VK  I R   P +  +       P  +  P+ +  S   L    T   E  N     SP + D P+S      RE  +E+ K     LG+S+ GG ++  G   V I  +      +    +  GD +L VN  +L   +H+ A+  L+L                 L +  + + +     W ++ LKL      PR            LGF+ VG ++                        I +  ++ G  A  +GRL  GD ++SIN   +   S   A  L +S+ G V L+V  +   +
Sbjct: 1214 LGITLAGSKDGSRARLSVCVASVDPQGPTGLDGRIQVGDELLEINGKILYGRSYQNASTI---ISNAPSKVKIVLIRNKAGKAVKENRTEGEVVIDWHPDAADEEESCSDLKRIVLTQDHAGLGIRLVEDPSWEGVVVGSLIQDGSASKDGRIKVGDRILEVGGEPVAGLSVEKVSSLISKQQVAVKLSIIRSKSPLSSPLFPPPSPLPHPSCIPLPSPPSPLTLSTPPTPPSEHSNLLTCSSPSSCD-PVSCPVVAGRETTIEIHKG-NVGLGLSIVGGCDTLLG--AVIIHEVNDGGAAQRDGRLQAGDQILEVNSIDLRQATHDEAIAVLRLTTQQV-----------RLCIFRHQEAYREEDLWDVFSLKLS-----PR--------PGEGLGFTTVGKSNDTG---------------------IFVSDVIRGGAADSDGRLLPGDQILSINGVDVRAASQDHAQKLLQSSSGAVLLEVARFKARV 1652          

HSP 4 Score: 55.4546 bits (132), Expect = 2.007e-7
Identity = 60/224 (26.79%), Postives = 103/224 (45.98%), Query Frame = 3
Query: 1317 EVVEVDKKPGESLGMSVAGGVNSQRGDTPVYITNIAPNSLLKNTNGIDKGDILLAVNETELLGLSHERAVEALKLARDNCNKVTVRVLKVPNLLLMANT--DNFIPSWMYWLKLPGYCQIPRMITLSRDAATGSLGFSIVGGNDPIYPFNTNSSLTDLSHNKEAPYRPIMIKSIVSGSPAHKNGRLKCGDILISINDFSLSNVSHSDAVNLFKSTQGPVHLKVV 1982
            E++E+    G+ LG  + GG  S      + +  I P         +  GD +L + +T+L G++ E+A + L   R+  +KV         LL+  N   DN + S +    L       ++I L+ D    SL F+    N     F  +S + DL+    A    +M+KSI  GS   ++GR+  GDI++S++  SL   S   A+ + + T   V L+++
Sbjct:  165 EIIELTND-GKGLGFGIIGGRASG-----IMVKTILPGGAAGRDTRLRSGDQILRIGDTDLAGMNSEQAAQVL---RNAGSKV--------KLLIARNVTKDNHLSSPV----LSQDSSDDKIIDLNDDYEF-SLQFT---KNSRGLGFTVSSYVGDLNSVYSAG---VMVKSIAKGSTVDQDGRMHIGDIILSVDGVSLQGCSEQRAMEVLRRTGPLVRLRLL 360          

HSP 5 Score: 52.373 bits (124), Expect = 1.859e-6
Identity = 65/242 (26.86%), Postives = 106/242 (43.80%), Query Frame = 3
Query:  852 KRWLPVA--KEEILTFVLEKPTDRKMGLKLAGKTNKSGLYIQEVLPDSQASLDGRLKKDDRILKINEHDLVFGTQNEALEIIKSVKDSVKFVISRIVRPQTPDIIRAAGTEPDSNMTPIATSSSYPGLKNASTRGYEVGNSPFTFD------SPISFKSTYRE---EVVEVDKKPGE-SLGMSVAGGVNSQRG-DTPVYITNIAPNSLLKNTNGIDKGDILLAVNETELLGLSHERAVEALK 1538
            KRW      + E+    L++ ++   GL ++ +      Y+  +LP+      G++   DRIL++N   LV  T  E + I+K +  SV  V SR+V P  P+       E D N   ++         +   +G  +   P   D       P+S      E   +VVE++K  GE  LG S+    + +    T + I ++ P  +      +  GD L+ VNET+L G S + AV  LK
Sbjct:  442 KRWQHAVGPRYEVTVCQLQRFSETS-GLGISLEARAGHHYLCSILPEGPVGQSGKILIGDRILEVNGIPLVGETHKEVVNILKELPRSVHLVCSRVVPPSIPE-----SEEDDDNDVQLSLKELLAEFNDKLDQGCVI-PCPTAEDITKRGVPPMSPPLAMWEKDAQVVELEK--GELGLGFSILDYQDPEDATKTVLIIRSLVPGGVADRDGRLLPGDRLMFVNETDLEGSSLDYAVHVLK 674          
BLAST of Ligand of Numb protein X 2 vs. Planmine SMEST
Match: SMESG000067101.1 (SMESG000067101.1)

HSP 1 Score: 1269.6 bits (3284), Expect = 0.000e+0
Identity = 628/628 (100.00%), Postives = 628/628 (100.00%), Query Frame = 3
Query:  120 MSIDPKIKSKFSSFKNDDRLMSVTVTSSPCQEFIPKSEIDPNLIKQCQGLFVSCCYSTAGCTFKAVGREVAAHEWQCPYGQKSPEXXXXXXXXXXXXXVFQTDAAGVSINGSQDISNTNSGNNFPKPQDCFYQNNSFYTPLNHLDNLEFNVEDFTITIINPERLEFGVSFVGGFDTPLQCIVIQEIFRDGRIAMDGRLRPGDQITKINEYYLSQASHIECRDVLSRISQSGDTIYLTIHRDIVDKRWLPVAKEEILTFVLEKPTDRKMGLKLAGKTNKSGLYIQEVLPDSQASLDGRLKKDDRILKINEHDLVFGTQNEALEIIKSVKDSVKFVISRIVRPQTPDIIRAAGTEPDSNMTPIATSSSYPGLKNASTRGYEVGNSPFTFDSPISFKSTYREEVVEVDKKPGESLGMSVAGGVNSQRGDTPVYITNIAPNSLLKNTNGIDKGDILLAVNETELLGLSHERAVEALKLARDNCNKVTVRVLKVPNLLLMANTDNFIPSWMYWLKLPGYCQIPRMITLSRDAATGSLGFSIVGGNDPIYPFNTNSSLTDLSHNKEAPYRPIMIKSIVSGSPAHKNGRLKCGDILISINDFSLSNVSHSDAVNLFKSTQGPVHLKVVSWPGTII 2003
            MSIDPKIKSKFSSFKNDDRLMSVTVTSSPCQEFIPKSEIDPNLIKQCQGLFVSCCYSTAGCTFKAVGREVAAHEWQCPYGQKSPESSLTSITLSSTSSVFQTDAAGVSINGSQDISNTNSGNNFPKPQDCFYQNNSFYTPLNHLDNLEFNVEDFTITIINPERLEFGVSFVGGFDTPLQCIVIQEIFRDGRIAMDGRLRPGDQITKINEYYLSQASHIECRDVLSRISQSGDTIYLTIHRDIVDKRWLPVAKEEILTFVLEKPTDRKMGLKLAGKTNKSGLYIQEVLPDSQASLDGRLKKDDRILKINEHDLVFGTQNEALEIIKSVKDSVKFVISRIVRPQTPDIIRAAGTEPDSNMTPIATSSSYPGLKNASTRGYEVGNSPFTFDSPISFKSTYREEVVEVDKKPGESLGMSVAGGVNSQRGDTPVYITNIAPNSLLKNTNGIDKGDILLAVNETELLGLSHERAVEALKLARDNCNKVTVRVLKVPNLLLMANTDNFIPSWMYWLKLPGYCQIPRMITLSRDAATGSLGFSIVGGNDPIYPFNTNSSLTDLSHNKEAPYRPIMIKSIVSGSPAHKNGRLKCGDILISINDFSLSNVSHSDAVNLFKSTQGPVHLKVVSWPGTII
Sbjct:    1 MSIDPKIKSKFSSFKNDDRLMSVTVTSSPCQEFIPKSEIDPNLIKQCQGLFVSCCYSTAGCTFKAVGREVAAHEWQCPYGQKSPESSLTSITLSSTSSVFQTDAAGVSINGSQDISNTNSGNNFPKPQDCFYQNNSFYTPLNHLDNLEFNVEDFTITIINPERLEFGVSFVGGFDTPLQCIVIQEIFRDGRIAMDGRLRPGDQITKINEYYLSQASHIECRDVLSRISQSGDTIYLTIHRDIVDKRWLPVAKEEILTFVLEKPTDRKMGLKLAGKTNKSGLYIQEVLPDSQASLDGRLKKDDRILKINEHDLVFGTQNEALEIIKSVKDSVKFVISRIVRPQTPDIIRAAGTEPDSNMTPIATSSSYPGLKNASTRGYEVGNSPFTFDSPISFKSTYREEVVEVDKKPGESLGMSVAGGVNSQRGDTPVYITNIAPNSLLKNTNGIDKGDILLAVNETELLGLSHERAVEALKLARDNCNKVTVRVLKVPNLLLMANTDNFIPSWMYWLKLPGYCQIPRMITLSRDAATGSLGFSIVGGNDPIYPFNTNSSLTDLSHNKEAPYRPIMIKSIVSGSPAHKNGRLKCGDILISINDFSLSNVSHSDAVNLFKSTQGPVHLKVVSWPGTII 628          
BLAST of Ligand of Numb protein X 2 vs. Planmine SMEST
Match: SMESG000010833.1 (SMESG000010833.1)

HSP 1 Score: 452.981 bits (1164), Expect = 4.497e-147
Identity = 282/637 (44.27%), Postives = 394/637 (61.85%), Query Frame = 3
Query:  171 DRLMSVTVTSSPCQEFIPKSEIDPNLIKQCQGLFVSCCYSTAGCTFKAVGREVAAHEWQCPYGQKSPEXXXXXXXXXXXXXVFQTDAAGVS---------INGS---QDIS-NTNSGNNFPKPQDCFYQNNSFYTPL------NHLDNLEFNVEDFTITIINPERL---EFGVSFVGGFDTPLQCIVIQEIFRDGRIAMDGRLRPGDQITKINEYYLSQASHIECRDVLSRISQSGDTIYLTIHRDIVDKRWLPVAKEEILTFVLEKPTDRKMGLKLAGKTNKSGLYIQEVLPDSQASLDGRLKKDDRILKINEHDLVFGTQNEALEIIKSVKDSVKFVISRIVRPQTPDIIRAAGTEPDSNMTPIATSSSYPGLKNASTRGYEVGNSPFTFDSPISFKSTYREEVVEVDKKPGESLGMSVAGGVNSQRGDTPVYITNIAPNSLLKNTNGIDKGDILLAVNETELLGLSHERAVEALKLARDNCNKVTVRVLKVPNLLLMANTDNFIPSWMYWLKLPGYCQIPRMITLSRDAATGSLGFSIVGGNDPIYP----FNTNSSLTDLSHNKEAPYRPIMIKSIVSGSPAHKNGRLKCGDILISINDFSLSNVSHSDAVNLFKSTQGPVHLKVVSWPGTII 2003
            D+L+     +  C E + +SE++ +L+  C+ +  S     AG  F          +W C + +KSP ++ T++T+SST+S    D +G S         I+ S   Q+++  TN+        +  ++N   +  +      N+  + E N+ +  + II  +R    + G+SFVGG DTPLQCIVIQEI+ DG +A DGRLRPGDQI  IN+  L+QA+H++ R    +  Q      L ++R+  D+      KEEIL F L K TD+K+G+KL G+ NK GLY+ +++  S+A LDGRL K+DRIL IN  DL   TQ+ A  +I S ++ V  ++SRI+RPQTPD+IR  G E   + T     +++    NA+ +              +S      E+VV V+KK GESLGMSVAGGVNSQRGDTPVY+TN+A + +L  T  + KGDILLAVN+TELLGLSHE+AVEALK A   C  V+VR+L+ P         NF+PSW+YWL+LP YC+IPR ITL RD+ATGSLGFSIVGG D +      +  N+++T  S N    ++ I++KSIV+GS AH+NGRLKCGDIL+ +N+ SL NVSH DAV++FK+ Q  V L+VVSWPGTI+
Sbjct:  309 DKLLINCPNNDGCDEVMARSELEAHLLYWCRAIPQSNNNLNAGPMFLVSKSSSGNMKWDCGF-EKSPNTTSTNVTISSTNSGPINDPSGSSTAVNTCEEPISASSSPQEVNVKTNANRILSNINNNHHKNTVRFDAVPHSRKKNYSASEEHNICNDCLQIIVIDRSTNSDMGISFVGGSDTPLQCIVIQEIYLDGAVAKDGRLRPGDQIISINDVDLNQATHLQARQAFLQAQQQPGVNRLMVYRERADESTF-TEKEEILQFGLSKRTDKKLGIKLVGQKNKPGLYVLDLVKGSEADLDGRLHKNDRILNINGVDLRMETQDTAARVINSAEEEVIIIVSRIIRPQTPDLIRNTGPEFAESFTSTCIVNNFSQPPNANKK--------------LSCTGRLFEKVVTVEKKYGESLGMSVAGGVNSQRGDTPVYVTNLAVDGVLAKTQLLAKGDILLAVNDTELLGLSHEKAVEALKSAGQKCKNVSVRLLQGPETYKNGG-HNFLPSWVYWLQLPKYCEIPRAITLKRDSATGSLGFSIVGGVDTVQTSPSRYLLNNNVTGRS-NANTFHQSIVVKSIVTGSVAHRNGRLKCGDILLKVNNTSLINVSHDDAVSIFKNVQDEVVLQVVSWPGTIV 927          
BLAST of Ligand of Numb protein X 2 vs. Planmine SMEST
Match: SMESG000010833.1 (SMESG000010833.1)

HSP 1 Score: 452.595 bits (1163), Expect = 6.323e-147
Identity = 282/637 (44.27%), Postives = 394/637 (61.85%), Query Frame = 3
Query:  171 DRLMSVTVTSSPCQEFIPKSEIDPNLIKQCQGLFVSCCYSTAGCTFKAVGREVAAHEWQCPYGQKSPEXXXXXXXXXXXXXVFQTDAAGVS---------INGS---QDIS-NTNSGNNFPKPQDCFYQNNSFYTPL------NHLDNLEFNVEDFTITIINPERL---EFGVSFVGGFDTPLQCIVIQEIFRDGRIAMDGRLRPGDQITKINEYYLSQASHIECRDVLSRISQSGDTIYLTIHRDIVDKRWLPVAKEEILTFVLEKPTDRKMGLKLAGKTNKSGLYIQEVLPDSQASLDGRLKKDDRILKINEHDLVFGTQNEALEIIKSVKDSVKFVISRIVRPQTPDIIRAAGTEPDSNMTPIATSSSYPGLKNASTRGYEVGNSPFTFDSPISFKSTYREEVVEVDKKPGESLGMSVAGGVNSQRGDTPVYITNIAPNSLLKNTNGIDKGDILLAVNETELLGLSHERAVEALKLARDNCNKVTVRVLKVPNLLLMANTDNFIPSWMYWLKLPGYCQIPRMITLSRDAATGSLGFSIVGGNDPIYP----FNTNSSLTDLSHNKEAPYRPIMIKSIVSGSPAHKNGRLKCGDILISINDFSLSNVSHSDAVNLFKSTQGPVHLKVVSWPGTII 2003
            D+L+     +  C E + +SE++ +L+  C+ +  S     AG  F          +W C + +KSP ++ T++T+SST+S    D +G S         I+ S   Q+++  TN+        +  ++N   +  +      N+  + E N+ +  + II  +R    + G+SFVGG DTPLQCIVIQEI+ DG +A DGRLRPGDQI  IN+  L+QA+H++ R    +  Q      L ++R+  D+      KEEIL F L K TD+K+G+KL G+ NK GLY+ +++  S+A LDGRL K+DRIL IN  DL   TQ+ A  +I S ++ V  ++SRI+RPQTPD+IR  G E   + T     +++    NA+ +              +S      E+VV V+KK GESLGMSVAGGVNSQRGDTPVY+TN+A + +L  T  + KGDILLAVN+TELLGLSHE+AVEALK A   C  V+VR+L+ P         NF+PSW+YWL+LP YC+IPR ITL RD+ATGSLGFSIVGG D +      +  N+++T  S N    ++ I++KSIV+GS AH+NGRLKCGDIL+ +N+ SL NVSH DAV++FK+ Q  V L+VVSWPGTI+
Sbjct:  322 DKLLINCPNNDGCDEVMARSELEAHLLYWCRAIPQSNNNLNAGPMFLVSKSSSGNMKWDCGF-EKSPNTTSTNVTISSTNSGPINDPSGSSTAVNTCEEPISASSSPQEVNVKTNANRILSNINNNHHKNTVRFDAVPHSRKKNYSASEEHNICNDCLQIIVIDRSTNSDMGISFVGGSDTPLQCIVIQEIYLDGAVAKDGRLRPGDQIISINDVDLNQATHLQARQAFLQAQQQPGVNRLMVYRERADESTF-TEKEEILQFGLSKRTDKKLGIKLVGQKNKPGLYVLDLVKGSEADLDGRLHKNDRILNINGVDLRMETQDTAARVINSAEEEVIIIVSRIIRPQTPDLIRNTGPEFAESFTSTCIVNNFSQPPNANKK--------------LSCTGRLFEKVVTVEKKYGESLGMSVAGGVNSQRGDTPVYVTNLAVDGVLAKTQLLAKGDILLAVNDTELLGLSHEKAVEALKSAGQKCKNVSVRLLQGPETYKNGG-HNFLPSWVYWLQLPKYCEIPRAITLKRDSATGSLGFSIVGGVDTVQTSPSRYLLNNNVTGRS-NANTFHQSIVVKSIVTGSVAHRNGRLKCGDILLKVNNTSLINVSHDDAVSIFKNVQDEVVLQVVSWPGTIV 940          
BLAST of Ligand of Numb protein X 2 vs. Planmine SMEST
Match: SMESG000061485.1 (SMESG000061485.1)

HSP 1 Score: 350.517 bits (898), Expect = 3.502e-109
Identity = 223/659 (33.84%), Postives = 334/659 (50.68%), Query Frame = 3
Query:  171 DRLMSVTVTSSPCQEFIPKSEIDPNLIKQCQGLFVSCCYSTAGCTFKAVGREVAAHEWQCPYGQKSPEXXXXXXXXXXXXXVFQTDAAGVSINGSQDISNTNSGNNFPKPQDCFYQNNSFYTPLNHLDNLEFNVEDFTITIINPERLEFGVSFVGGFDTPLQCIVIQEIFRDGRIAMDGRLRPGDQITKINEYYLSQASHIECRDVLSRISQSGDTIYLTIHRDIVDKRWLPVA-KEEILTFVLEKPTDRKMGLKLAGKTNKSGLYIQEVLPDSQASLDGRLKKDDRILKINEHDLVFGTQNEALEIIKSVKDSVKFVISRIVRPQTPDII---------------------------RAAGTEPDSNM-----------TPIATSSSYPGLKNASTRGYEVGNSPFTFDSPISFKSTY---------REEVVEVDKKPGESLGMSVAGGVNSQRGDTPVYITNIAPNSLLKNTNGIDKGDILLAVNETELLGLSHERAVEALKLARDNCNKVTVRVLKVPNLLLMANTDNFIPSWMYWLKLPGYCQIPRMITLSRDAATGSLGFSIVGGNDPIYPFNTNSSLTDLSHNKEAPYRPIMIKSIVSGSPAHKNGRLKCGDILISINDFSLSNVSHSDAVNLFKSTQGPVHLKVVSWPGTII 2003
            D+L  V      C+E + ++++  +L  +C+G  + C  ++ GCTF+      + H+W+C Y                     +     ++ +     SN   G    +  DC  +  +       +D      E   I II   + + G SF+GG D+PL CIVIQEI+ DG I+ D RLRPGDQI ++N + L+ A+H+E +  LS +S           R ++ +   PV+ K EI T  L K  D ++G+ L  K N  G+YI+ ++P S+A ++G L K DRIL IN  ++  G+Q  A +IIK   ++V  V+ R  R   PDI+                           R +   P S M           + I +  + P + N+  +   V       D+ + + ++Y         +++ + V KKP ESL ++V GG+NS RGD P+YITNI P   L     + KG ILL +N   LL L+H+ AV+ALK    N + V + +L+ P     +   NF+PSW YWL+LP +C  P++I L +D    SLGFSIVGG D     NTN +L+            IMIK+I+ GS A  NG+LKCGDIL+ +N+ SLS++SH+DAV   K   G VHLK++SWPGTI+
Sbjct:  207 DKLKVVCPNVDYCEEILYRNDLYHHLKYKCRGAVMPCINASIGCTFQGSRNTFSTHQWECKYKD------------------VENGRDPIANDVYNFKSNLEDGTENNEDIDCNSRKETVIDKAQIIDG-----EPCEIEIIRVNQCDLGFSFIGGIDSPLGCIVIQEIYLDGIISQDCRLRPGDQILEVNNFDLTNATHVEAKRALSMLSSKC--------RFVIFRECAPVSNKLEIFTVTLVKRHDSQLGIVLDKKRNHEGIYIRNIIPGSEAYMNGDLAKGDRILSINNIEIGNGSQEYAAKIIKEALENVILVVQR--RLSVPDIVKTTDDRGSLGSWSTSSTGGGGGGGGMSRDSKAPPQSEMISRRQTISSNKSSIWSDHNSPRINNSLNQPRWVPIDQAPVDNWMHYDNSYQHLFVSCTLKQDTINVHKKPNESLSITVTGGINSHRGDIPIYITNIYPTGALSAHRKVKKGSILLRINNINLLHLTHKHAVDALKQECYNSSLVQLHILEGPE--SSSGAGNFMPSWKYWLQLPFFCAFPKLIELYKDNTNISLGFSIVGGIDS--ANNTNHALSFWD-------TCIMIKTILPGSIAFINGKLKCGDILLEVNNVSLSHISHADAVLCLKKVTGRVHLKIISWPGTIV 821          
BLAST of Ligand of Numb protein X 2 vs. Planmine SMEST
Match: SMESG000061485.1 (SMESG000061485.1)

HSP 1 Score: 350.132 bits (897), Expect = 4.341e-109
Identity = 223/659 (33.84%), Postives = 334/659 (50.68%), Query Frame = 3
Query:  171 DRLMSVTVTSSPCQEFIPKSEIDPNLIKQCQGLFVSCCYSTAGCTFKAVGREVAAHEWQCPYGQKSPEXXXXXXXXXXXXXVFQTDAAGVSINGSQDISNTNSGNNFPKPQDCFYQNNSFYTPLNHLDNLEFNVEDFTITIINPERLEFGVSFVGGFDTPLQCIVIQEIFRDGRIAMDGRLRPGDQITKINEYYLSQASHIECRDVLSRISQSGDTIYLTIHRDIVDKRWLPVA-KEEILTFVLEKPTDRKMGLKLAGKTNKSGLYIQEVLPDSQASLDGRLKKDDRILKINEHDLVFGTQNEALEIIKSVKDSVKFVISRIVRPQTPDII---------------------------RAAGTEPDSNM-----------TPIATSSSYPGLKNASTRGYEVGNSPFTFDSPISFKSTY---------REEVVEVDKKPGESLGMSVAGGVNSQRGDTPVYITNIAPNSLLKNTNGIDKGDILLAVNETELLGLSHERAVEALKLARDNCNKVTVRVLKVPNLLLMANTDNFIPSWMYWLKLPGYCQIPRMITLSRDAATGSLGFSIVGGNDPIYPFNTNSSLTDLSHNKEAPYRPIMIKSIVSGSPAHKNGRLKCGDILISINDFSLSNVSHSDAVNLFKSTQGPVHLKVVSWPGTII 2003
            D+L  V      C+E + ++++  +L  +C+G  + C  ++ GCTF+      + H+W+C Y                     +     ++ +     SN   G    +  DC  +  +       +D      E   I II   + + G SF+GG D+PL CIVIQEI+ DG I+ D RLRPGDQI ++N + L+ A+H+E +  LS +S           R ++ +   PV+ K EI T  L K  D ++G+ L  K N  G+YI+ ++P S+A ++G L K DRIL IN  ++  G+Q  A +IIK   ++V  V+ R  R   PDI+                           R +   P S M           + I +  + P + N+  +   V       D+ + + ++Y         +++ + V KKP ESL ++V GG+NS RGD P+YITNI P   L     + KG ILL +N   LL L+H+ AV+ALK    N + V + +L+ P     +   NF+PSW YWL+LP +C  P++I L +D    SLGFSIVGG D     NTN +L+            IMIK+I+ GS A  NG+LKCGDIL+ +N+ SLS++SH+DAV   K   G VHLK++SWPGTI+
Sbjct:  204 DKLKVVCPNVDYCEEILYRNDLYHHLKYKCRGAVMPCINASIGCTFQGSRNTFSTHQWECKYKD------------------VENGRDPIANDVYNFKSNLEDGTENNEDIDCNSRKETVIDKAQIIDG-----EPCEIEIIRVNQCDLGFSFIGGIDSPLGCIVIQEIYLDGIISQDCRLRPGDQILEVNNFDLTNATHVEAKRALSMLSSKC--------RFVIFRECAPVSNKLEIFTVTLVKRHDSQLGIVLDKKRNHEGIYIRNIIPGSEAYMNGDLAKGDRILSINNIEIGNGSQEYAAKIIKEALENVILVVQR--RLSVPDIVKTTDDRGSLGSWSTSSTGGGGGGGGMSRDSKAPPQSEMISRRQTISSNKSSIWSDHNSPRINNSLNQPRWVPIDQAPVDNWMHYDNSYQHLFVSCTLKQDTINVHKKPNESLSITVTGGINSHRGDIPIYITNIYPTGALSAHRKVKKGSILLRINNINLLHLTHKHAVDALKQECYNSSLVQLHILEGPE--SSSGAGNFMPSWKYWLQLPFFCAFPKLIELYKDNTNISLGFSIVGGIDS--ANNTNHALSFWD-------TCIMIKTILPGSIAFINGKLKCGDILLEVNNVSLSHISHADAVLCLKKVTGRVHLKIISWPGTIV 818          
The following BLAST results are available for this feature:
BLAST of Ligand of Numb protein X 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LNX22.353e-7835.63ligand of numb-protein X 2 [Source:HGNC Symbol;Acc... [more]
LNX22.353e-7835.63ligand of numb-protein X 2 [Source:HGNC Symbol;Acc... [more]
LNX16.572e-7433.27ligand of numb-protein X 1 [Source:HGNC Symbol;Acc... [more]
LNX12.958e-7333.27ligand of numb-protein X 1 [Source:HGNC Symbol;Acc... [more]
PATJ9.793e-5031.06PATJ crumbs cell polarity complex component [Sourc... [more]
back to top
BLAST of Ligand of Numb protein X 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mpz-16.157e-2429.18Multiple PDZ domain protein [Source:UniProtKB/TrE... [more]
mpz-14.964e-2328.40Multiple PDZ domain protein [Source:UniProtKB/TrE... [more]
mpz-15.242e-2329.18Multiple PDZ domain protein [Source:UniProtKB/TrE... [more]
mpz-15.391e-2329.18Multiple PDZ domain protein [Source:UniProtKB/TrE... [more]
mpz-15.484e-2329.18Multiple PDZ domain protein [Source:UniProtKB/TrE... [more]
back to top
BLAST of Ligand of Numb protein X 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
scrib1.522e-1328.04gene:FBgn0263289 transcript:FBtr0308623[more]
scrib1.661e-1328.04gene:FBgn0263289 transcript:FBtr0308632[more]
scrib2.331e-1328.04gene:FBgn0263289 transcript:FBtr0308630[more]
scrib2.369e-1328.04gene:FBgn0263289 transcript:FBtr0308622[more]
scrib2.493e-1328.04gene:FBgn0263289 transcript:FBtr0308625[more]
back to top
BLAST of Ligand of Numb protein X 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lnx2a9.068e-7535.51ligand of numb-protein X 2a [Source:ZFIN;Acc:ZDB-G... [more]
lnx2a1.621e-7435.51ligand of numb-protein X 2a [Source:ZFIN;Acc:ZDB-G... [more]
lnx2a1.621e-7435.51ligand of numb-protein X 2a [Source:ZFIN;Acc:ZDB-G... [more]
lnx12.687e-7031.89ligand of numb-protein X 1 [Source:ZFIN;Acc:ZDB-GE... [more]
lnx14.444e-7031.89ligand of numb-protein X 1 [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Ligand of Numb protein X 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddx541.284e-7134.00DEAD-box helicase 54 [Source:Xenbase;Acc:XB-GENE-1... [more]
LNX11.105e-6734.46ligand of numb-protein X 1 [Source:NCBI gene;Acc:1... [more]
LNX12.930e-6733.73ligand of numb-protein X 1 [Source:NCBI gene;Acc:1... [more]
c1qb1.155e-5431.68complement C1q B chain [Source:Xenbase;Acc:XB-GENE... [more]
nphp36.221e-5029.69nephronophthisis 3 (adolescent) [Source:Xenbase;Ac... [more]
back to top
BLAST of Ligand of Numb protein X 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lnx23.756e-7735.24ligand of numb-protein X 2 [Source:MGI Symbol;Acc:... [more]
Lnx18.841e-7133.40ligand of numb-protein X 1 [Source:MGI Symbol;Acc:... [more]
Lnx14.381e-7033.40ligand of numb-protein X 1 [Source:MGI Symbol;Acc:... [more]
Lnx14.381e-7033.40ligand of numb-protein X 1 [Source:MGI Symbol;Acc:... [more]
Lnx17.143e-7033.40ligand of numb-protein X 1 [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of Ligand of Numb protein X 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8N448|LNX2_HUMAN1.130e-7735.63Ligand of Numb protein X 2 OS=Homo sapiens OX=9606... [more]
sp|Q91XL2|LNX2_MOUSE2.627e-7635.24Ligand of Numb protein X 2 OS=Mus musculus OX=1009... [more]
sp|Q8TBB1|LNX1_HUMAN1.421e-7233.27E3 ubiquitin-protein ligase LNX OS=Homo sapiens OX... [more]
sp|O70263|LNX1_MOUSE2.394e-6833.40E3 ubiquitin-protein ligase LNX OS=Mus musculus OX... [more]
sp|Q8VBX6|MPDZ_MOUSE1.731e-4529.34Multiple PDZ domain protein OS=Mus musculus OX=100... [more]
back to top
BLAST of Ligand of Numb protein X 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A504YN761.858e-14941.91Ligand of Numb protein X 2 OS=Fasciola gigantica O... [more]
A0A0X3PH351.769e-14841.48Uncharacterized protein OS=Schistocephalus solidus... [more]
A0A4E0RU308.849e-14841.87Ligand of Numb protein X 2 OS=Fasciola hepatica OX... [more]
A0A0X3P7T55.427e-14641.48Ligand of Numb protein X 2 (Fragment) OS=Schistoce... [more]
A0A564XXP69.664e-14539.68Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
back to top
BLAST of Ligand of Numb protein X 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lnx2a1.931e-7334.27ligand of numb-protein X 2a [Source:ZFIN;Acc:ZDB-G... [more]
lnx16.976e-7132.23ligand of numb-protein X 1 [Source:NCBI gene;Acc:1... [more]
lnx11.409e-7031.87ligand of numb-protein X 1 [Source:NCBI gene;Acc:1... [more]
lnx11.409e-7031.87ligand of numb-protein X 1 [Source:NCBI gene;Acc:1... [more]
lnx2a9.054e-6933.87ligand of numb-protein X 2a [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of Ligand of Numb protein X 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LNX25.933e-4031.71ligand of numb-protein X 2 [Source:HGNC Symbol;Acc... [more]
ENSPMAT00000004677.12.235e-2029.44pep scaffold:Pmarinus_7.0:GL479538:28591:32639:-1 ... [more]
LIN7B4.430e-940.51lin-7 homolog B, crumbs cell polarity complex comp... [more]
lin7a1.344e-838.82lin-7 homolog A (C. elegans) [Source:ZFIN;Acc:ZDB-... [more]
ENSPMAT00000002205.15.853e-827.10pep scaffold:Pmarinus_7.0:GL477144:51012:68257:1 g... [more]
back to top
BLAST of Ligand of Numb protein X 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ligand of Numb protein X 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO337065.630e-1923.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO456241.604e-1623.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO460592.368e-1429.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO334328.589e-1324.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458871.477e-922.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ligand of Numb protein X 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lnx2a4.448e-7032.09ligand of numb-protein X 2 [Source:NCBI gene;Acc:1... [more]
lnx12.672e-6531.44ligand of numb-protein X 1 [Source:NCBI gene;Acc:1... [more]
lnx2b4.143e-5730.78ligand of Numb protein X 2 [Source:NCBI gene;Acc:1... [more]
MPDZ3.964e-4430.43multiple PDZ domain crumbs cell polarity complex c... [more]
MPDZ2.258e-4229.50multiple PDZ domain protein-like [Source:NCBI gene... [more]
back to top
BLAST of Ligand of Numb protein X 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000067101.10.000e+0100.00SMESG000067101.1[more]
SMESG000010833.14.497e-14744.27SMESG000010833.1[more]
SMESG000010833.16.323e-14744.27SMESG000010833.1[more]
SMESG000061485.13.502e-10933.84SMESG000061485.1[more]
SMESG000061485.14.341e-10933.84SMESG000061485.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024655 ID=SMED30024655|Name=Ligand of Numb protein X 2|organism=Schmidtea mediterranea sexual|type=transcript|length=2153bp
GATCTATCACATCTATTTTTGAGCCACGTGATTGTTGTTGAAATAGTATC
AAATTGTGATTGGCTGGAAATATTATCGATTTAAATTCATTCCGTCTAAG
CAACTGGACTATTCGTTTCATGAGTATTGACCCGAAAATAAAATCTAAAT
TTTCCAGTTTCAAAAATGATGATCGTTTGATGTCAGTAACTGTAACAAGT
AGTCCTTGTCAAGAGTTTATTCCTAAAAGCGAAATTGATCCGAATCTCAT
TAAACAATGCCAGGGATTATTTGTTTCTTGCTGCTATTCCACCGCTGGTT
GTACTTTTAAAGCGGTTGGTCGTGAAGTTGCCGCCCACGAATGGCAATGT
CCTTATGGACAAAAATCGCCGGAATCTTCTCTAACGTCAATAACACTAAG
TTCTACTAGTTCTGTCTTTCAAACTGACGCTGCTGGAGTTTCAATAAACG
GTAGCCAAGACATTTCTAATACTAATTCCGGCAACAATTTCCCGAAACCA
CAAGATTGCTTTTATCAAAATAATTCTTTTTATACTCCTTTGAATCATTT
GGACAATTTAGAGTTCAATGTCGAAGATTTTACAATCACAATAATAAATC
CGGAACGCCTTGAATTTGGAGTGAGTTTTGTTGGCGGATTTGATACTCCT
CTGCAATGCATCGTCATTCAAGAAATATTCCGGGATGGCCGCATTGCCAT
GGATGGGAGATTACGTCCTGGGGATCAAATCACAAAGATAAATGAATATT
ATCTTTCTCAAGCTTCTCATATTGAATGTCGAGACGTCTTGAGTCGTATT
TCTCAATCGGGTGACACGATCTATTTGACTATTCATCGTGATATTGTCGA
TAAACGGTGGCTTCCTGTGGCCAAAGAAGAGATATTGACTTTTGTTTTGG
AAAAACCAACCGACAGAAAAATGGGTCTGAAATTAGCTGGGAAAACAAAC
AAGTCTGGATTGTACATTCAAGAAGTGCTGCCGGACAGTCAGGCCAGTCT
CGATGGCCGATTGAAAAAGGACGACAGAATTTTAAAAATCAACGAACATG
ATTTGGTTTTCGGTACTCAAAATGAAGCTTTGGAAATCATTAAGTCAGTG
AAAGACTCAGTAAAGTTCGTGATATCAAGAATAGTTCGTCCGCAAACTCC
TGATATCATTCGGGCCGCTGGCACAGAACCAGATAGTAACATGACACCAA
TTGCTACCTCATCCTCGTATCCTGGGTTGAAGAATGCCTCGACTCGTGGA
TATGAAGTTGGAAATTCTCCGTTTACATTCGACAGCCCTATTTCGTTCAA
GTCAACTTATCGAGAAGAAGTTGTAGAAGTTGACAAGAAGCCCGGTGAAT
CACTGGGAATGTCTGTGGCAGGAGGCGTGAATTCACAGCGCGGAGACACG
CCAGTCTACATAACAAATATTGCTCCCAATAGCCTCCTGAAGAACACCAA
TGGAATAGACAAAGGTGACATTCTACTGGCAGTCAACGAAACTGAGCTGC
TTGGATTAAGCCATGAGAGAGCAGTCGAAGCATTGAAATTGGCTCGGGAT
AATTGCAATAAAGTGACGGTCCGAGTGCTCAAAGTTCCTAATCTTTTGTT
GATGGCCAACACTGATAATTTTATTCCATCATGGATGTACTGGCTGAAAT
TGCCCGGTTACTGTCAGATCCCAAGGATGATTACTTTATCTCGTGATGCG
GCTACCGGGTCACTGGGATTCAGCATTGTTGGAGGCAACGACCCTATTTA
TCCATTTAATACTAACTCCTCATTAACTGATCTCAGCCACAACAAAGAAG
CTCCTTACAGACCAATTATGATTAAATCTATTGTTTCCGGTTCACCCGCT
CACAAAAATGGCCGCTTAAAATGCGGTGATATTCTCATCTCAATCAACGA
CTTTTCATTGTCCAACGTTTCACACTCAGACGCCGTCAACCTATTCAAGT
CGACTCAAGGTCCAGTTCATTTGAAAGTCGTCTCATGGCCTGGCACAATT
ATTTAAACGGCTAATCAAATCCAAATGCCCATGTGACAAAATGAAGTCTG
AAATTCATATTTTCCCGTATTTTCTGTGTATAGATGACGTATTTAAGAAT
AAAATATATAGAATTTATTCTATTTCTCTTAATATATTGACGATAATTTC
GGA
back to top

protein sequence of SMED30024655-orf-1

>SMED30024655-orf-1 ID=SMED30024655-orf-1|Name=SMED30024655-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=629bp
MSIDPKIKSKFSSFKNDDRLMSVTVTSSPCQEFIPKSEIDPNLIKQCQGL
FVSCCYSTAGCTFKAVGREVAAHEWQCPYGQKSPESSLTSITLSSTSSVF
QTDAAGVSINGSQDISNTNSGNNFPKPQDCFYQNNSFYTPLNHLDNLEFN
VEDFTITIINPERLEFGVSFVGGFDTPLQCIVIQEIFRDGRIAMDGRLRP
GDQITKINEYYLSQASHIECRDVLSRISQSGDTIYLTIHRDIVDKRWLPV
AKEEILTFVLEKPTDRKMGLKLAGKTNKSGLYIQEVLPDSQASLDGRLKK
DDRILKINEHDLVFGTQNEALEIIKSVKDSVKFVISRIVRPQTPDIIRAA
GTEPDSNMTPIATSSSYPGLKNASTRGYEVGNSPFTFDSPISFKSTYREE
VVEVDKKPGESLGMSVAGGVNSQRGDTPVYITNIAPNSLLKNTNGIDKGD
ILLAVNETELLGLSHERAVEALKLARDNCNKVTVRVLKVPNLLLMANTDN
FIPSWMYWLKLPGYCQIPRMITLSRDAATGSLGFSIVGGNDPIYPFNTNS
SLTDLSHNKEAPYRPIMIKSIVSGSPAHKNGRLKCGDILISINDFSLSNV
SHSDAVNLFKSTQGPVHLKVVSWPGTII*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0002111X2 cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036034PDZ_sf
IPR001478PDZ
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0004842ubiquitin-protein transferase activity
GO:0008270zinc ion binding
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0016567protein ubiquitination
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001478PDZ domainSMARTSM00228pdz_newcoord: 530..624
e-value: 1.3E-19
score: 81.1
coord: 164..242
e-value: 1.3E-11
score: 54.5
coord: 266..339
e-value: 1.5E-13
score: 61.0
coord: 410..490
e-value: 7.9E-13
score: 58.6
IPR001478PDZ domainPFAMPF00595PDZcoord: 259..335
e-value: 1.8E-11
score: 44.2
coord: 159..238
e-value: 2.4E-6
score: 27.8
coord: 404..486
e-value: 4.8E-13
score: 49.3
coord: 521..620
e-value: 1.3E-15
score: 57.5
IPR001478PDZ domainPROSITEPS50106PDZcoord: 520..624
score: 18.777
IPR001478PDZ domainPROSITEPS50106PDZcoord: 257..339
score: 16.667
IPR001478PDZ domainPROSITEPS50106PDZcoord: 155..242
score: 13.23
IPR001478PDZ domainPROSITEPS50106PDZcoord: 401..473
score: 16.627
IPR036034PDZ superfamilyGENE3DG3DSA:2.30.42.10coord: 392..491
e-value: 2.7E-21
score: 77.6
IPR036034PDZ superfamilyGENE3DG3DSA:2.30.42.10coord: 249..341
e-value: 1.4E-18
score: 69.0
IPR036034PDZ superfamilyGENE3DG3DSA:2.30.42.10coord: 142..247
e-value: 1.1E-18
score: 68.9
IPR036034PDZ superfamilyGENE3DG3DSA:2.30.42.10coord: 514..624
e-value: 3.2E-25
score: 90.4
IPR036034PDZ superfamilySUPERFAMILYSSF50156PDZ domain-likecoord: 386..488
IPR036034PDZ superfamilySUPERFAMILYSSF50156PDZ domain-likecoord: 500..624
IPR036034PDZ superfamilySUPERFAMILYSSF50156PDZ domain-likecoord: 147..241
IPR036034PDZ superfamilySUPERFAMILYSSF50156PDZ domain-likecoord: 251..339
NoneNo IPR availablePANTHERPTHR19964:SF14E3 UBIQUITIN-PROTEIN LIGASE LNXcoord: 144..627
NoneNo IPR availablePANTHERPTHR19964MULTIPLE PDZ DOMAIN PROTEINcoord: 144..627
NoneNo IPR availableCDDcd00992PDZ_signalingcoord: 518..621
e-value: 1.33682E-19
score: 81.459
NoneNo IPR availableCDDcd00992PDZ_signalingcoord: 154..238
e-value: 2.33619E-12
score: 60.6582
NoneNo IPR availableCDDcd00992PDZ_signalingcoord: 401..487
e-value: 6.45736E-15
score: 67.977
NoneNo IPR availableCDDcd00992PDZ_signalingcoord: 255..335
e-value: 6.14131E-14
score: 65.2806