Large proline-rich protein bag6

Overview
NameLarge proline-rich protein bag6
Smed IDSMED30024653
Length (bp)3485
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Large proline-rich protein bag6 (SMED30024653) t-SNE clustered cells

Violin plots show distribution of expression levels for Large proline-rich protein bag6 (SMED30024653) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Large proline-rich protein bag6 (SMED30024653) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Large proline-rich protein bag6 (SMED30024653) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024653

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30024653h1SMcG0009587 dd_Smed_v4_1102_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30024653h1SMcG0009587 dd_Smed_v4_1102_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Large proline-rich protein bag6 vs. Ensembl Human
Match: BAG6 (BCL2 associated athanogene 6 [Source:HGNC Symbol;Acc:HGNC:13919])

HSP 1 Score: 80.1073 bits (196), Expect = 1.215e-16
Identity = 38/75 (50.67%), Postives = 49/75 (65.33%), Query Frame = 3
Query:   93 TINVIVKTLDGRNHDFSVPDNINVLQFKAIIHHKMDIAVERQRLLFQGRVLQDDNLLSSYNVAGNVMHLVTRPPP 317
            ++ V+VKTLD +   F V   +NV +FK  I   + I  E+QRL++QGRVLQDD  L  YNV G V+HLV R PP
Sbjct:   16 SLEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGKVIHLVERAPP 90          
BLAST of Large proline-rich protein bag6 vs. Ensembl Human
Match: BAG6 (BCL2 associated athanogene 6 [Source:HGNC Symbol;Acc:HGNC:13919])

HSP 1 Score: 80.1073 bits (196), Expect = 1.215e-16
Identity = 38/75 (50.67%), Postives = 49/75 (65.33%), Query Frame = 3
Query:   93 TINVIVKTLDGRNHDFSVPDNINVLQFKAIIHHKMDIAVERQRLLFQGRVLQDDNLLSSYNVAGNVMHLVTRPPP 317
            ++ V+VKTLD +   F V   +NV +FK  I   + I  E+QRL++QGRVLQDD  L  YNV G V+HLV R PP
Sbjct:   16 SLEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGKVIHLVERAPP 90          
BLAST of Large proline-rich protein bag6 vs. Ensembl Human
Match: BAG6 (BCL2 associated athanogene 6 [Source:HGNC Symbol;Acc:HGNC:13919])

HSP 1 Score: 80.1073 bits (196), Expect = 1.215e-16
Identity = 38/75 (50.67%), Postives = 49/75 (65.33%), Query Frame = 3
Query:   93 TINVIVKTLDGRNHDFSVPDNINVLQFKAIIHHKMDIAVERQRLLFQGRVLQDDNLLSSYNVAGNVMHLVTRPPP 317
            ++ V+VKTLD +   F V   +NV +FK  I   + I  E+QRL++QGRVLQDD  L  YNV G V+HLV R PP
Sbjct:   16 SLEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGKVIHLVERAPP 90          
BLAST of Large proline-rich protein bag6 vs. Ensembl Human
Match: BAG6 (BCL2 associated athanogene 6 [Source:HGNC Symbol;Acc:HGNC:13919])

HSP 1 Score: 80.1073 bits (196), Expect = 1.215e-16
Identity = 38/75 (50.67%), Postives = 49/75 (65.33%), Query Frame = 3
Query:   93 TINVIVKTLDGRNHDFSVPDNINVLQFKAIIHHKMDIAVERQRLLFQGRVLQDDNLLSSYNVAGNVMHLVTRPPP 317
            ++ V+VKTLD +   F V   +NV +FK  I   + I  E+QRL++QGRVLQDD  L  YNV G V+HLV R PP
Sbjct:   16 SLEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGKVIHLVERAPP 90          
BLAST of Large proline-rich protein bag6 vs. Ensembl Human
Match: BAG6 (BCL2 associated athanogene 6 [Source:HGNC Symbol;Acc:HGNC:13919])

HSP 1 Score: 80.1073 bits (196), Expect = 1.215e-16
Identity = 38/75 (50.67%), Postives = 49/75 (65.33%), Query Frame = 3
Query:   93 TINVIVKTLDGRNHDFSVPDNINVLQFKAIIHHKMDIAVERQRLLFQGRVLQDDNLLSSYNVAGNVMHLVTRPPP 317
            ++ V+VKTLD +   F V   +NV +FK  I   + I  E+QRL++QGRVLQDD  L  YNV G V+HLV R PP
Sbjct:   16 SLEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGKVIHLVERAPP 90          
BLAST of Large proline-rich protein bag6 vs. Ensembl Celegans
Match: ubq-2 (Ubiquitin-60S ribosomal protein L40 Ubiquitin 60S ribosomal protein L40 [Source:UniProtKB/Swiss-Prot;Acc:P49632])

HSP 1 Score: 46.595 bits (109), Expect = 8.628e-6
Identity = 26/72 (36.11%), Postives = 39/72 (54.17%), Query Frame = 3
Query:   96 INVIVKTLDGRNHDFSVPDNINVLQFKAIIHHKMDIAVERQRLLFQGRVLQDDNLLSSYNVAG-NVMHLVTR 308
            + + VKTL G+     V  +  +   KA I  K  I  ++QRL+F G+ L+D   LS YN+   + +HLV R
Sbjct:    1 MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR 72          
BLAST of Large proline-rich protein bag6 vs. Ensembl Fly
Match: CG7546 (gene:FBgn0035793 transcript:FBtr0332141)

HSP 1 Score: 81.6481 bits (200), Expect = 3.702e-15
Identity = 38/76 (50.00%), Postives = 52/76 (68.42%), Query Frame = 3
Query:   96 INVIVKTLDGRNHDFSVPDNINVLQFKAIIHHKMDIAVERQRLLFQGRVLQDDNLLSSYNVAGNVMHLVTRPPPSQ 323
            IN+ VKTLD R H+FS+ + + + QFK  I  K +IA E QR+++QGRVL DD  +  Y+V G V+H+  RPP SQ
Sbjct:    3 INLKVKTLDARIHEFSIDNELTIRQFKDQIAEKTNIAAENQRIIYQGRVLVDDKQVKEYDVDGKVLHVAERPPFSQ 78          

HSP 2 Score: 62.3882 bits (150), Expect = 2.478e-9
Identity = 43/141 (30.50%), Postives = 68/141 (48.23%), Query Frame = 3
Query: 2985 WQSVLPPDWIDIVSRDSNVPVDQQT-IGIPYSDAYVSGMPPKRRKIILNQRHRSVQQVPELMHDCIDHAIQSAGVVTNE---------SLDTQQFPLGLTNSFQELVSDHVRNRLVEES---FNFPNDRFPSVEQNFNRKK 3368
            W    P DW+ +++RD     +Q      P+SDAY+SGM  KRRKII  Q  +    V  L+ + +  AIQS G+  +          S+DT    +   ++ Q   +D VRN L E +    +F   ++P + + F  +K
Sbjct: 1030 WHMSFPNDWLPVITRDLQTQAEQSNRPQPPFSDAYISGMSAKRRKII--QSEKPTASVECLIANGVQRAIQSVGLGGSNGGSALNASISMDTVIGSIAHDSTIQAAYTDAVRNSLKERTERDVDFKTSKYPQIAK-FTEQK 1167          
BLAST of Large proline-rich protein bag6 vs. Ensembl Fly
Match: CG7546 (gene:FBgn0035793 transcript:FBtr0076792)

HSP 1 Score: 81.6481 bits (200), Expect = 3.764e-15
Identity = 38/76 (50.00%), Postives = 52/76 (68.42%), Query Frame = 3
Query:   96 INVIVKTLDGRNHDFSVPDNINVLQFKAIIHHKMDIAVERQRLLFQGRVLQDDNLLSSYNVAGNVMHLVTRPPPSQ 323
            IN+ VKTLD R H+FS+ + + + QFK  I  K +IA E QR+++QGRVL DD  +  Y+V G V+H+  RPP SQ
Sbjct:    3 INLKVKTLDARIHEFSIDNELTIRQFKDQIAEKTNIAAENQRIIYQGRVLVDDKQVKEYDVDGKVLHVAERPPFSQ 78          

HSP 2 Score: 62.3882 bits (150), Expect = 2.395e-9
Identity = 43/141 (30.50%), Postives = 68/141 (48.23%), Query Frame = 3
Query: 2985 WQSVLPPDWIDIVSRDSNVPVDQQT-IGIPYSDAYVSGMPPKRRKIILNQRHRSVQQVPELMHDCIDHAIQSAGVVTNE---------SLDTQQFPLGLTNSFQELVSDHVRNRLVEES---FNFPNDRFPSVEQNFNRKK 3368
            W    P DW+ +++RD     +Q      P+SDAY+SGM  KRRKII  Q  +    V  L+ + +  AIQS G+  +          S+DT    +   ++ Q   +D VRN L E +    +F   ++P + + F  +K
Sbjct: 1029 WHMSFPNDWLPVITRDLQTQAEQSNRPQPPFSDAYISGMSAKRRKII--QSEKPTASVECLIANGVQRAIQSVGLGGSNGGSALNASISMDTVIGSIAHDSTIQAAYTDAVRNSLKERTERDVDFKTSKYPQIAK-FTEQK 1166          
BLAST of Large proline-rich protein bag6 vs. Ensembl Fly
Match: CG7546 (gene:FBgn0035793 transcript:FBtr0305073)

HSP 1 Score: 81.2629 bits (199), Expect = 4.094e-15
Identity = 38/76 (50.00%), Postives = 52/76 (68.42%), Query Frame = 3
Query:   96 INVIVKTLDGRNHDFSVPDNINVLQFKAIIHHKMDIAVERQRLLFQGRVLQDDNLLSSYNVAGNVMHLVTRPPPSQ 323
            IN+ VKTLD R H+FS+ + + + QFK  I  K +IA E QR+++QGRVL DD  +  Y+V G V+H+  RPP SQ
Sbjct:    3 INLKVKTLDARIHEFSIDNELTIRQFKDQIAEKTNIAAENQRIIYQGRVLVDDKQVKEYDVDGKVLHVAERPPFSQ 78          

HSP 2 Score: 62.7734 bits (151), Expect = 2.321e-9
Identity = 43/141 (30.50%), Postives = 68/141 (48.23%), Query Frame = 3
Query: 2985 WQSVLPPDWIDIVSRDSNVPVDQQT-IGIPYSDAYVSGMPPKRRKIILNQRHRSVQQVPELMHDCIDHAIQSAGVVTNE---------SLDTQQFPLGLTNSFQELVSDHVRNRLVEES---FNFPNDRFPSVEQNFNRKK 3368
            W    P DW+ +++RD     +Q      P+SDAY+SGM  KRRKII  Q  +    V  L+ + +  AIQS G+  +          S+DT    +   ++ Q   +D VRN L E +    +F   ++P + + F  +K
Sbjct: 1161 WHMSFPNDWLPVITRDLQTQAEQSNRPQPPFSDAYISGMSAKRRKII--QSEKPTASVECLIANGVQRAIQSVGLGGSNGGSALNASISMDTVIGSIAHDSTIQAAYTDAVRNSLKERTERDVDFKTSKYPQIAK-FTEQK 1298          
BLAST of Large proline-rich protein bag6 vs. Ensembl Fly
Match: CG7546 (gene:FBgn0035793 transcript:FBtr0290025)

HSP 1 Score: 81.2629 bits (199), Expect = 4.180e-15
Identity = 38/76 (50.00%), Postives = 52/76 (68.42%), Query Frame = 3
Query:   96 INVIVKTLDGRNHDFSVPDNINVLQFKAIIHHKMDIAVERQRLLFQGRVLQDDNLLSSYNVAGNVMHLVTRPPPSQ 323
            IN+ VKTLD R H+FS+ + + + QFK  I  K +IA E QR+++QGRVL DD  +  Y+V G V+H+  RPP SQ
Sbjct:    3 INLKVKTLDARIHEFSIDNELTIRQFKDQIAEKTNIAAENQRIIYQGRVLVDDKQVKEYDVDGKVLHVAERPPFSQ 78          

HSP 2 Score: 62.003 bits (149), Expect = 3.415e-9
Identity = 43/141 (30.50%), Postives = 68/141 (48.23%), Query Frame = 3
Query: 2985 WQSVLPPDWIDIVSRDSNVPVDQQT-IGIPYSDAYVSGMPPKRRKIILNQRHRSVQQVPELMHDCIDHAIQSAGVVTNE---------SLDTQQFPLGLTNSFQELVSDHVRNRLVEES---FNFPNDRFPSVEQNFNRKK 3368
            W    P DW+ +++RD     +Q      P+SDAY+SGM  KRRKII  Q  +    V  L+ + +  AIQS G+  +          S+DT    +   ++ Q   +D VRN L E +    +F   ++P + + F  +K
Sbjct: 1062 WHMSFPNDWLPVITRDLQTQAEQSNRPQPPFSDAYISGMSAKRRKII--QSEKPTASVECLIANGVQRAIQSVGLGGSNGGSALNASISMDTVIGSIAHDSTIQAAYTDAVRNSLKERTERDVDFKTSKYPQIAK-FTEQK 1199          
BLAST of Large proline-rich protein bag6 vs. Ensembl Fly
Match: CG7546 (gene:FBgn0035793 transcript:FBtr0332142)

HSP 1 Score: 81.2629 bits (199), Expect = 4.481e-15
Identity = 38/76 (50.00%), Postives = 52/76 (68.42%), Query Frame = 3
Query:   96 INVIVKTLDGRNHDFSVPDNINVLQFKAIIHHKMDIAVERQRLLFQGRVLQDDNLLSSYNVAGNVMHLVTRPPPSQ 323
            IN+ VKTLD R H+FS+ + + + QFK  I  K +IA E QR+++QGRVL DD  +  Y+V G V+H+  RPP SQ
Sbjct:    3 INLKVKTLDARIHEFSIDNELTIRQFKDQIAEKTNIAAENQRIIYQGRVLVDDKQVKEYDVDGKVLHVAERPPFSQ 78          

HSP 2 Score: 64.3142 bits (155), Expect = 6.352e-10
Identity = 42/140 (30.00%), Postives = 67/140 (47.86%), Query Frame = 3
Query: 2985 WQSVLPPDWIDIVSRDSNVPVDQQTIGIPYSDAYVSGMPPKRRKIILNQRHRSVQQVPELMHDCIDHAIQSAGVVTNE---------SLDTQQFPLGLTNSFQELVSDHVRNRLVEES---FNFPNDRFPSVEQNFNRKK 3368
            W    P DW+ +++RD     +      P+SDAY+SGM  KRRKII  Q  +    V  L+ + +  AIQS G+  +          S+DT    +   ++ Q   +D VRN L E +    +F   ++P + + F  +K
Sbjct: 1043 WHMSFPNDWLPVITRDLQTQAESNRPQPPFSDAYISGMSAKRRKII--QSEKPTASVECLIANGVQRAIQSVGLGGSNGGSALNASISMDTVIGSIAHDSTIQAAYTDAVRNSLKERTERDVDFKTSKYPQIAK-FTEQK 1179          
BLAST of Large proline-rich protein bag6 vs. Ensembl Zebrafish
Match: bag6l (BCL2 associated athanogene 6, like [Source:NCBI gene;Acc:751663])

HSP 1 Score: 72.7886 bits (177), Expect = 2.035e-14
Identity = 35/73 (47.95%), Postives = 49/73 (67.12%), Query Frame = 3
Query:   90 STINVIVKTLDGRNHDFSVPDNINVLQFKAIIHHKMDIAVERQRLLFQGRVLQDDNLLSSYNVAGNVMHLVTR 308
              I V VKTLD ++  F+V     V QFK  I   ++I+V++QRL++QG+VLQD+  L+ YNV G V+HLV R
Sbjct:    5 GVIEVTVKTLDSQSRTFTVRGEWTVKQFKEHIAASVEISVDKQRLIYQGKVLQDERTLTEYNVDGKVIHLVER 77          
BLAST of Large proline-rich protein bag6 vs. Ensembl Zebrafish
Match: bag6 (BCL2 associated athanogene 6 [Source:ZFIN;Acc:ZDB-GENE-010501-5])

HSP 1 Score: 78.9518 bits (193), Expect = 3.169e-14
Identity = 37/75 (49.33%), Postives = 50/75 (66.67%), Query Frame = 3
Query:   93 TINVIVKTLDGRNHDFSVPDNINVLQFKAIIHHKMDIAVERQRLLFQGRVLQDDNLLSSYNVAGNVMHLVTRPPP 317
            TI V VKTLD ++  ++V   + V  FK  I   + I V++QRL++QGRVLQD+  L+ YNV G V+HLV R PP
Sbjct:    8 TIEVTVKTLDSQSRSYTVEAQMTVKDFKEHISPSVGIPVDKQRLIYQGRVLQDEKTLTEYNVDGKVIHLVERAPP 82          

HSP 2 Score: 54.6842 bits (130), Expect = 8.805e-7
Identity = 38/130 (29.23%), Postives = 67/130 (51.54%), Query Frame = 3
Query: 2982 SWQSVLPPDWIDIVSRDSNVPVDQQTIGI--PYSDAYVSGMPPKRRKIILNQRHRSVQQVPELMHDCIDHAIQSAGVVTNESLDTQQFPL---GLTNSFQELVSDHVRNRLVEESFNFPNDRFPSVEQNF 3356
            +W + LPP+W+ I+ +D    V Q+ +    P SDAY+ GMP KRRK++ +   R        + + +  A +SAGV    S +  +  L    L  ++ E + + ++ R V++  ++   RFP+  Q F
Sbjct: 1086 AWAAALPPEWVPIIRQDQ---VSQRKMKAQPPLSDAYLLGMPAKRRKMVKSDGLRLS------LSEAVSQAARSAGVTPITSPNALEGDLENPELQEAYNEQLKNDIQKR-VKDDPDYNPRRFPNTHQVF 1205          
BLAST of Large proline-rich protein bag6 vs. Ensembl Zebrafish
Match: bag6 (BCL2 associated athanogene 6 [Source:ZFIN;Acc:ZDB-GENE-010501-5])

HSP 1 Score: 78.5666 bits (192), Expect = 3.500e-14
Identity = 37/75 (49.33%), Postives = 50/75 (66.67%), Query Frame = 3
Query:   93 TINVIVKTLDGRNHDFSVPDNINVLQFKAIIHHKMDIAVERQRLLFQGRVLQDDNLLSSYNVAGNVMHLVTRPPP 317
            TI V VKTLD ++  ++V   + V  FK  I   + I V++QRL++QGRVLQD+  L+ YNV G V+HLV R PP
Sbjct:    8 TIEVTVKTLDSQSRSYTVEAQMTVKDFKEHISPSVGIPVDKQRLIYQGRVLQDEKTLTEYNVDGKVIHLVERAPP 82          

HSP 2 Score: 54.6842 bits (130), Expect = 8.792e-7
Identity = 38/130 (29.23%), Postives = 67/130 (51.54%), Query Frame = 3
Query: 2982 SWQSVLPPDWIDIVSRDSNVPVDQQTIGI--PYSDAYVSGMPPKRRKIILNQRHRSVQQVPELMHDCIDHAIQSAGVVTNESLDTQQFPL---GLTNSFQELVSDHVRNRLVEESFNFPNDRFPSVEQNF 3356
            +W + LPP+W+ I+ +D    V Q+ +    P SDAY+ GMP KRRK++ +   R        + + +  A +SAGV    S +  +  L    L  ++ E + + ++ R V++  ++   RFP+  Q F
Sbjct: 1078 AWAAALPPEWVPIIRQDQ---VSQRKMKAQPPLSDAYLLGMPAKRRKMVKSDGLRLS------LSEAVSQAARSAGVTPITSPNALEGDLENPELQEAYNEQLKNDIQKR-VKDDPDYNPRRFPNTHQVF 1197          
BLAST of Large proline-rich protein bag6 vs. Ensembl Zebrafish
Match: bag6l (BCL2 associated athanogene 6, like [Source:NCBI gene;Acc:751663])

HSP 1 Score: 75.485 bits (184), Expect = 3.595e-13
Identity = 35/71 (49.30%), Postives = 49/71 (69.01%), Query Frame = 3
Query:   96 INVIVKTLDGRNHDFSVPDNINVLQFKAIIHHKMDIAVERQRLLFQGRVLQDDNLLSSYNVAGNVMHLVTR 308
            I V VKTLD ++  F+V     V QFK  I   ++I+V++QRL++QG+VLQD+  L+ YNV G V+HLV R
Sbjct:    7 IEVTVKTLDSQSRTFTVRGEWTVKQFKEHIAASVEISVDKQRLIYQGKVLQDERTLTEYNVDGKVIHLVER 77          

HSP 2 Score: 53.9138 bits (128), Expect = 1.232e-6
Identity = 37/131 (28.24%), Postives = 67/131 (51.15%), Query Frame = 3
Query: 2985 WQSVLPPDWIDIVSRDSNVPVDQQTIGI--PYSDAYVSGMPPKRRKIILNQRHRSVQQVPEL-MHDCIDHAIQSAGVVTNESLDTQQFPL---GLTNSFQELVSDHVRNRLVEESFNFPNDRFPSVEQNFN 3359
            W + +PP+W+ I+ RD    + Q+ +    P SDAY+ GMP KRRK    +        P L + + +  A ++AGV    + D+ Q  L    L  ++ + V   ++ RL ++  ++ + RFP+  + F+
Sbjct: 1070 WAATVPPEWVPIIRRDM---LTQRKMKAQPPLSDAYMHGMPAKRRKTAQGEG-------PHLSLTEAVSRAARTAGVRPVTAPDSLQGELETPELQEAYAQQVKSDIKKRLSDDP-DYNHQRFPNTHRVFS 1189          
BLAST of Large proline-rich protein bag6 vs. Ensembl Zebrafish
Match: bag6l (BCL2 associated athanogene 6, like [Source:NCBI gene;Acc:751663])

HSP 1 Score: 75.0998 bits (183), Expect = 3.974e-13
Identity = 35/71 (49.30%), Postives = 49/71 (69.01%), Query Frame = 3
Query:   96 INVIVKTLDGRNHDFSVPDNINVLQFKAIIHHKMDIAVERQRLLFQGRVLQDDNLLSSYNVAGNVMHLVTR 308
            I V VKTLD ++  F+V     V QFK  I   ++I+V++QRL++QG+VLQD+  L+ YNV G V+HLV R
Sbjct:    7 IEVTVKTLDSQSRTFTVRGEWTVKQFKEHIAASVEISVDKQRLIYQGKVLQDERTLTEYNVDGKVIHLVER 77          

HSP 2 Score: 54.299 bits (129), Expect = 1.069e-6
Identity = 37/131 (28.24%), Postives = 67/131 (51.15%), Query Frame = 3
Query: 2985 WQSVLPPDWIDIVSRDSNVPVDQQTIGI--PYSDAYVSGMPPKRRKIILNQRHRSVQQVPEL-MHDCIDHAIQSAGVVTNESLDTQQFPL---GLTNSFQELVSDHVRNRLVEESFNFPNDRFPSVEQNFN 3359
            W + +PP+W+ I+ RD    + Q+ +    P SDAY+ GMP KRRK    +        P L + + +  A ++AGV    + D+ Q  L    L  ++ + V   ++ RL ++  ++ + RFP+  + F+
Sbjct: 1038 WAATVPPEWVPIIRRDM---LTQRKMKAQPPLSDAYMHGMPAKRRKTAQGEG-------PHLSLTEAVSRAARTAGVRPVTAPDSLQGELETPELQEAYAQQVKSDIKKRLSDDP-DYNHQRFPNTHRVFS 1157          
BLAST of Large proline-rich protein bag6 vs. Ensembl Xenopus
Match: bag6 (BCL2 associated athanogene 6 [Source:NCBI gene;Acc:100038304])

HSP 1 Score: 78.9518 bits (193), Expect = 4.714e-14
Identity = 58/186 (31.18%), Postives = 84/186 (45.16%), Query Frame = 3
Query:   96 INVIVKTLDGRNHDFSVPDNINVLQFKAIIHHKMDIAVERQRLLFQGRVLQDDNLLSSYNVAGNVMHLVTRPPPSQNRL-------------------APDTTTTEREENSDINRDQIRNILSDVFGNIAELSNPMGVSV--NNEGNRVDITVNMPSSNRL-SLARLRQNYIHRLMSQARELLDNL 587
            + V VKTLD +   F+V   I V +FK  I   + I+ E+QRL++QGRVLQ+D  L  YNV G V+HLV R PP                         P     ER  NS +        L  V   + E S    VS    N+G+ +D+ +N+     + S  R+R     +++   + +LD L
Sbjct:    7 MEVTVKTLDSQTRTFTVDAEITVKEFKTHISSDVGISPEKQRLIYQGRVLQEDKKLKEYNVDGKVIHLVERAPPQTQPPTGGPSTSSSTSPSSSNAANVPGAGAPERNGNSYVMVGTFN--LPHVMSGLGEASRGPRVSTVSGNDGSTLDVHINLDQQLPVQSEPRVRLVLAQQILQDIQRILDRL 190          
BLAST of Large proline-rich protein bag6 vs. Ensembl Xenopus
Match: bag6 (BCL2 associated athanogene 6 [Source:NCBI gene;Acc:100038304])

HSP 1 Score: 78.5666 bits (192), Expect = 5.856e-14
Identity = 58/186 (31.18%), Postives = 84/186 (45.16%), Query Frame = 3
Query:   96 INVIVKTLDGRNHDFSVPDNINVLQFKAIIHHKMDIAVERQRLLFQGRVLQDDNLLSSYNVAGNVMHLVTRPPPSQNRL-------------------APDTTTTEREENSDINRDQIRNILSDVFGNIAELSNPMGVSV--NNEGNRVDITVNMPSSNRL-SLARLRQNYIHRLMSQARELLDNL 587
            + V VKTLD +   F+V   I V +FK  I   + I+ E+QRL++QGRVLQ+D  L  YNV G V+HLV R PP                         P     ER  NS +        L  V   + E S    VS    N+G+ +D+ +N+     + S  R+R     +++   + +LD L
Sbjct:    1 MEVTVKTLDSQTRTFTVDAEITVKEFKTHISSDVGISPEKQRLIYQGRVLQEDKKLKEYNVDGKVIHLVERAPPQTQPPTGGPSTSSSTSPSSSNAANVPGAGAPERNGNSYVMVGTFN--LPHVMSGLGEASRGPRVSTVSGNDGSTLDVHINLDQQLPVQSEPRVRLVLAQQILQDIQRILDRL 184          
BLAST of Large proline-rich protein bag6 vs. Ensembl Xenopus
Match: bag6 (BCL2 associated athanogene 6 [Source:NCBI gene;Acc:100038304])

HSP 1 Score: 78.1814 bits (191), Expect = 6.096e-14
Identity = 58/187 (31.02%), Postives = 84/187 (44.92%), Query Frame = 3
Query:   96 INVIVKTLDGRNHDFSVPDNINVLQFKAIIHHKMDIAVERQRLLFQGRVLQDDNLLSSYNVAGNVMHLVTRPPPSQNRL-------------------APDTTTTEREENSDINRDQIRNILSDVFGNIAELSNPMGVSV--NNEGNRVDITVNMPSSNRL-SLARLRQNYIHRLMSQARELLDNLR 590
            + V VKTLD +   F+V   I V +FK  I   + I+ E+QRL++QGRVLQ+D  L  YNV G V+HLV R PP                         P     ER  NS +        L  V   + E S    VS    N+G+ +D+ +N+     + S  R+R     +++   + +LD L 
Sbjct:    7 MEVTVKTLDSQTRTFTVDAEITVKEFKTHISSDVGISPEKQRLIYQGRVLQEDKKLKEYNVDGKVIHLVERAPPQTQPPTGGPSTSSSTSPSSSNAANVPGAGAPERNGNSYVMVGTFN--LPHVMSGLGEASRGPRVSTVSGNDGSTLDVHINLDQQLPVQSEPRVRLVLAQQILQDIQRILDRLE 191          
BLAST of Large proline-rich protein bag6 vs. Ensembl Xenopus
Match: bag6 (BCL2 associated athanogene 6 [Source:NCBI gene;Acc:100038304])

HSP 1 Score: 78.1814 bits (191), Expect = 6.963e-14
Identity = 58/186 (31.18%), Postives = 84/186 (45.16%), Query Frame = 3
Query:   96 INVIVKTLDGRNHDFSVPDNINVLQFKAIIHHKMDIAVERQRLLFQGRVLQDDNLLSSYNVAGNVMHLVTRPPPSQNRL-------------------APDTTTTEREENSDINRDQIRNILSDVFGNIAELSNPMGVSV--NNEGNRVDITVNMPSSNRL-SLARLRQNYIHRLMSQARELLDNL 587
            + V VKTLD +   F+V   I V +FK  I   + I+ E+QRL++QGRVLQ+D  L  YNV G V+HLV R PP                         P     ER  NS +        L  V   + E S    VS    N+G+ +D+ +N+     + S  R+R     +++   + +LD L
Sbjct:    7 MEVTVKTLDSQTRTFTVDAEITVKEFKTHISSDVGISPEKQRLIYQGRVLQEDKKLKEYNVDGKVIHLVERAPPQTQPPTGGPSTSSSTSPSSSNAANVPGAGAPERNGNSYVMVGTFN--LPHVMSGLGEASRGPRVSTVSGNDGSTLDVHINLDQQLPVQSEPRVRLVLAQQILQDIQRILDRL 190          
BLAST of Large proline-rich protein bag6 vs. Ensembl Xenopus
Match: bag6 (BCL2 associated athanogene 6 [Source:NCBI gene;Acc:100038304])

HSP 1 Score: 77.7962 bits (190), Expect = 8.629e-14
Identity = 37/74 (50.00%), Postives = 48/74 (64.86%), Query Frame = 3
Query:   96 INVIVKTLDGRNHDFSVPDNINVLQFKAIIHHKMDIAVERQRLLFQGRVLQDDNLLSSYNVAGNVMHLVTRPPP 317
            + V VKTLD +   F+V   I V +FK  I   + I+ E+QRL++QGRVLQ+D  L  YNV G V+HLV R PP
Sbjct:    7 MEVTVKTLDSQTRTFTVDAEITVKEFKTHISSDVGISPEKQRLIYQGRVLQEDKKLKEYNVDGKVIHLVERAPP 80          
BLAST of Large proline-rich protein bag6 vs. Ensembl Mouse
Match: Bag6 (BCL2-associated athanogene 6 [Source:MGI Symbol;Acc:MGI:1919439])

HSP 1 Score: 81.6481 bits (200), Expect = 7.771e-18
Identity = 38/75 (50.67%), Postives = 49/75 (65.33%), Query Frame = 3
Query:   93 TINVIVKTLDGRNHDFSVPDNINVLQFKAIIHHKMDIAVERQRLLFQGRVLQDDNLLSSYNVAGNVMHLVTRPPP 317
            ++ V+VKTLD +   F V   +NV +FK  I   + I  E+QRL++QGRVLQDD  L  YNV G V+HLV R PP
Sbjct:   16 SLEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGKVIHLVERAPP 90          
BLAST of Large proline-rich protein bag6 vs. Ensembl Mouse
Match: Bag6 (BCL2-associated athanogene 6 [Source:MGI Symbol;Acc:MGI:1919439])

HSP 1 Score: 81.6481 bits (200), Expect = 8.055e-17
Identity = 38/75 (50.67%), Postives = 49/75 (65.33%), Query Frame = 3
Query:   93 TINVIVKTLDGRNHDFSVPDNINVLQFKAIIHHKMDIAVERQRLLFQGRVLQDDNLLSSYNVAGNVMHLVTRPPP 317
            ++ V+VKTLD +   F V   +NV +FK  I   + I  E+QRL++QGRVLQDD  L  YNV G V+HLV R PP
Sbjct:   16 SLEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGKVIHLVERAPP 90          
BLAST of Large proline-rich protein bag6 vs. Ensembl Mouse
Match: Bag6 (BCL2-associated athanogene 6 [Source:MGI Symbol;Acc:MGI:1919439])

HSP 1 Score: 82.0333 bits (201), Expect = 1.542e-16
Identity = 38/75 (50.67%), Postives = 49/75 (65.33%), Query Frame = 3
Query:   93 TINVIVKTLDGRNHDFSVPDNINVLQFKAIIHHKMDIAVERQRLLFQGRVLQDDNLLSSYNVAGNVMHLVTRPPP 317
            ++ V+VKTLD +   F V   +NV +FK  I   + I  E+QRL++QGRVLQDD  L  YNV G V+HLV R PP
Sbjct:   57 SLEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGKVIHLVERAPP 131          
BLAST of Large proline-rich protein bag6 vs. Ensembl Mouse
Match: Bag6 (BCL2-associated athanogene 6 [Source:MGI Symbol;Acc:MGI:1919439])

HSP 1 Score: 81.2629 bits (199), Expect = 4.049e-15
Identity = 38/75 (50.67%), Postives = 49/75 (65.33%), Query Frame = 3
Query:   93 TINVIVKTLDGRNHDFSVPDNINVLQFKAIIHHKMDIAVERQRLLFQGRVLQDDNLLSSYNVAGNVMHLVTRPPP 317
            ++ V+VKTLD +   F V   +NV +FK  I   + I  E+QRL++QGRVLQDD  L  YNV G V+HLV R PP
Sbjct:   57 SLEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGKVIHLVERAPP 131          
BLAST of Large proline-rich protein bag6 vs. Ensembl Mouse
Match: Bag6 (BCL2-associated athanogene 6 [Source:MGI Symbol;Acc:MGI:1919439])

HSP 1 Score: 80.8777 bits (198), Expect = 7.607e-15
Identity = 38/75 (50.67%), Postives = 49/75 (65.33%), Query Frame = 3
Query:   93 TINVIVKTLDGRNHDFSVPDNINVLQFKAIIHHKMDIAVERQRLLFQGRVLQDDNLLSSYNVAGNVMHLVTRPPP 317
            ++ V+VKTLD +   F V   +NV +FK  I   + I  E+QRL++QGRVLQDD  L  YNV G V+HLV R PP
Sbjct:   16 SLEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGKVIHLVERAPP 90          

HSP 2 Score: 58.9214 bits (141), Expect = 4.573e-8
Identity = 41/142 (28.87%), Postives = 71/142 (50.00%), Query Frame = 3
Query: 2946 QQDSVSHAPNGNSWQSVLPPDWIDIVSRD--SNVPVDQQTIGIPYSDAYVSGMPPKRRKIILNQRHRSVQQVPELMHDCIDHAIQSAG---VVTNESLDTQQFPLGLTNSFQELVSDHVRNRLVEESFNFPNDRFPSVEQNF 3356
            +QD  S   +   W + +PP+W+ I+ +D  S   V  Q    P SDAY+SGMP KRRK +  +  +       L+ + +  A ++AG   + + ESL        +  S+++ +   ++ RL +E  N+   RFP+  + F
Sbjct: 1021 EQDGASA--DAEPWAAAVPPEWVPIIQQDIQSQRKVKPQP---PLSDAYLSGMPAKRRKTMQGEGPQL------LLSEAVSRAAKAAGARPLTSPESLSRDLEAPEVQESYRQQLRSDIQKRL-QEDPNYSPQRFPNAHRAF 1150          
BLAST of Large proline-rich protein bag6 vs. UniProt/SwissProt
Match: sp|Q9Z1R2|BAG6_MOUSE (Large proline-rich protein BAG6 OS=Mus musculus OX=10090 GN=Bag6 PE=1 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 5.321e-14
Identity = 38/75 (50.67%), Postives = 49/75 (65.33%), Query Frame = 3
Query:   93 TINVIVKTLDGRNHDFSVPDNINVLQFKAIIHHKMDIAVERQRLLFQGRVLQDDNLLSSYNVAGNVMHLVTRPPP 317
            ++ V+VKTLD +   F V   +NV +FK  I   + I  E+QRL++QGRVLQDD  L  YNV G V+HLV R PP
Sbjct:   16 SLEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGKVIHLVERAPP 90          

HSP 2 Score: 58.9214 bits (141), Expect = 3.199e-7
Identity = 41/142 (28.87%), Postives = 71/142 (50.00%), Query Frame = 3
Query: 2946 QQDSVSHAPNGNSWQSVLPPDWIDIVSRD--SNVPVDQQTIGIPYSDAYVSGMPPKRRKIILNQRHRSVQQVPELMHDCIDHAIQSAG---VVTNESLDTQQFPLGLTNSFQELVSDHVRNRLVEESFNFPNDRFPSVEQNF 3356
            +QD  S   +   W + +PP+W+ I+ +D  S   V  Q    P SDAY+SGMP KRRK +  +  +       L+ + +  A ++AG   + + ESL        +  S+++ +   ++ RL +E  N+   RFP+  + F
Sbjct: 1021 EQDGASA--DAEPWAAAVPPEWVPIIQQDIQSQRKVKPQP---PLSDAYLSGMPAKRRKTMQGEGPQL------LLSEAVSRAAKAAGARPLTSPESLSRDLEAPEVQESYRQQLRSDIQKRL-QEDPNYSPQRFPNAHRAF 1150          
BLAST of Large proline-rich protein bag6 vs. UniProt/SwissProt
Match: sp|P46379|BAG6_HUMAN (Large proline-rich protein BAG6 OS=Homo sapiens OX=9606 GN=BAG6 PE=1 SV=2)

HSP 1 Score: 80.8777 bits (198), Expect = 5.460e-14
Identity = 38/75 (50.67%), Postives = 49/75 (65.33%), Query Frame = 3
Query:   93 TINVIVKTLDGRNHDFSVPDNINVLQFKAIIHHKMDIAVERQRLLFQGRVLQDDNLLSSYNVAGNVMHLVTRPPP 317
            ++ V+VKTLD +   F V   +NV +FK  I   + I  E+QRL++QGRVLQDD  L  YNV G V+HLV R PP
Sbjct:   16 SLEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGKVIHLVERAPP 90          

HSP 2 Score: 58.5362 bits (140), Expect = 3.584e-7
Identity = 38/129 (29.46%), Postives = 67/129 (51.94%), Query Frame = 3
Query: 2985 WQSVLPPDWIDIVSRD--SNVPVDQQTIGIPYSDAYVSGMPPKRRKIILNQRHRSVQQVPELMHDCIDHAIQSAG---VVTNESLDTQQFPLGLTNSFQELVSDHVRNRLVEESFNFPNDRFPSVEQNF 3356
            W + +PP+W+ I+ +D  S   V  Q    P SDAY+SGMP KRRK +  +  +       L+ + +  A ++AG   + + ESL        +  S+++ +   ++ RL +E  N+   RFP+ ++ F
Sbjct: 1010 WAAAVPPEWVPIIQQDIQSQRKVKPQP---PLSDAYLSGMPAKRRKTMQGEGPQL------LLSEAVSRAAKAAGARPLTSPESLSRDLEAPEVQESYRQQLRSDIQKRL-QEDPNYSPQRFPNAQRAF 1128          
BLAST of Large proline-rich protein bag6 vs. UniProt/SwissProt
Match: sp|A5D9M6|BAG6_PIG (Large proline-rich protein BAG6 OS=Sus scrofa OX=9823 GN=BAG6 PE=1 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 6.245e-14
Identity = 38/75 (50.67%), Postives = 49/75 (65.33%), Query Frame = 3
Query:   93 TINVIVKTLDGRNHDFSVPDNINVLQFKAIIHHKMDIAVERQRLLFQGRVLQDDNLLSSYNVAGNVMHLVTRPPP 317
            ++ V+VKTLD +   F V   +NV +FK  I   + I  E+QRL++QGRVLQDD  L  YNV G V+HLV R PP
Sbjct:   16 SLEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGKVIHLVERAPP 90          

HSP 2 Score: 57.3806 bits (137), Expect = 8.864e-7
Identity = 38/129 (29.46%), Postives = 66/129 (51.16%), Query Frame = 3
Query: 2985 WQSVLPPDWIDIVSRD--SNVPVDQQTIGIPYSDAYVSGMPPKRRKIILNQRHRSVQQVPELMHDCIDHAIQSAG---VVTNESLDTQQFPLGLTNSFQELVSDHVRNRLVEESFNFPNDRFPSVEQNF 3356
            W + +PP+W+ I+ +D  S   V  Q    P SDAY+SGMP KRRK +  +  +       L+ + +  A ++AG   + + ESL        +  S+++ +   ++ RL +E  N+   RFP+  + F
Sbjct: 1006 WAAAVPPEWVPIIQQDIQSQRKVKPQP---PLSDAYLSGMPAKRRKTMQGEGPQL------LLSEAVSRAAKAAGARPLTSPESLSRDLEAPEVQESYRQQLRADIQKRL-QEDPNYSPQRFPNAHRAF 1124          
BLAST of Large proline-rich protein bag6 vs. UniProt/SwissProt
Match: sp|Q9YHD3|BAG6A_XENLA (Large proline-rich protein bag6-A OS=Xenopus laevis OX=8355 GN=Bag6-a PE=2 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 8.009e-14
Identity = 59/183 (32.24%), Postives = 85/183 (46.45%), Query Frame = 3
Query:   96 INVIVKTLDGRNHDFSVPDNINVLQFKAIIHHKMDIAVERQRLLFQGRVLQDDNLLSSYNVAGNVMHLVTRPPPSQNRL-----------------APDTTTTEREENSDINRDQIRNILSDVFGNIAELSNPMGVSVN-NEGNRVDITVNMPSSNRL-SLARLRQNYIHRLMSQARELLDNL 587
            + V VKTLD +   F+V   I+V  FKA I   + I+ E+QRL++QGRVLQ+D  L  YNV G V+HLV R PP                      AP     ER  NS +        L  V   +     P   +VN N+G+ +D+ +N+     + S  R+R      ++   + +LD L
Sbjct:    7 MEVTVKTLDSQTRTFTVETEISVKDFKAHISSDVGISPEKQRLIYQGRVLQEDKKLKEYNVDGKVIHLVERAPPQTQPSTGGPSTSSSTSPTSSNAAPVPGAPERNGNSYVMVGTFN--LPHVMSGLVRQQRPSVSTVNGNDGSTLDVHINLDQQLPVQSEPRVRLVLAQHILQDIQRILDRL 187          
BLAST of Large proline-rich protein bag6 vs. UniProt/SwissProt
Match: sp|Q6MG49|BAG6_RAT (Large proline-rich protein BAG6 OS=Rattus norvegicus OX=10116 GN=Bag6 PE=1 SV=2)

HSP 1 Score: 80.1073 bits (196), Expect = 1.011e-13
Identity = 38/75 (50.67%), Postives = 49/75 (65.33%), Query Frame = 3
Query:   93 TINVIVKTLDGRNHDFSVPDNINVLQFKAIIHHKMDIAVERQRLLFQGRVLQDDNLLSSYNVAGNVMHLVTRPPP 317
            ++ V+VKTLD +   F V   +NV +FK  I   + I  E+QRL++QGRVLQDD  L  YNV G V+HLV R PP
Sbjct:   16 SLEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQDYNVGGKVIHLVERAPP 90          

HSP 2 Score: 58.9214 bits (141), Expect = 3.446e-7
Identity = 41/142 (28.87%), Postives = 71/142 (50.00%), Query Frame = 3
Query: 2946 QQDSVSHAPNGNSWQSVLPPDWIDIVSRD--SNVPVDQQTIGIPYSDAYVSGMPPKRRKIILNQRHRSVQQVPELMHDCIDHAIQSAG---VVTNESLDTQQFPLGLTNSFQELVSDHVRNRLVEESFNFPNDRFPSVEQNF 3356
            +QD  S   +   W + +PP+W+ I+ +D  S   V  Q    P SDAY+SGMP KRRK +  +  +       L+ + +  A ++AG   + + ESL        +  S+++ +   ++ RL +E  N+   RFP+  + F
Sbjct: 1013 EQDGASA--DAEPWAAAVPPEWVPIIQQDIQSQRKVKPQP---PLSDAYLSGMPAKRRKTMQGEGPQL------LLSEAVSRAAKAAGARPLTSPESLSRDLEAPEVQESYRQQLRSDIQKRL-QEDPNYSPQRFPNAHRAF 1142          
BLAST of Large proline-rich protein bag6 vs. TrEMBL
Match: A0A5K3F316 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 117.087 bits (292), Expect = 1.348e-22
Identity = 96/330 (29.09%), Postives = 150/330 (45.45%), Query Frame = 3
Query:   96 INVIVKTLDGRNHDFSVPD-NINVLQFKAIIHHKMDIAVERQRLLFQGRVLQDDNLLSSYNVAGNVMHLVTRPPPS-QNRLAPDTTTTEREENSDIN-----------RDQIRNILSDVFGNIAELSNP--MGVSVNNEGNRVDITVNMPSSNRLSLARLRQNYIHRLMSQARELLDNL-----RDPNL-PAPR----PDRERLHQANAYDLGANEERITAVSAQP--LPIHNLADMVHSVRDMWRDADPQLELWENVLRRQNLPDNIANNDREM-------------------------------QRMHDSASRYIHLFSHMLHIMSDY 911
              V VKTLDG +  F + D ++ V  FK +I  +MDI +E QRL+FQG+VL D+  L   +V    +HLV RPPP  Q    P T++T  +  S              R  ++N+   +  ++ +L  P  M +  +NEGN +DI +++P         LR+N+  RL  QA  LL++L      +P+  P P+    P    ++  N+    A+     A  AQ   +    LADM+   R +W    P L+ WE +LR ++      ++ RE+                               QR  +  S  +H  SHMLH++SD+
Sbjct:    2 FEVNVKTLDGNSKTFQIDDEDLTVAAFKQLIATEMDIPIENQRLIFQGKVLVDERKLKDCDVESKTIHLVPRPPPQLQTDTDPSTSSTPGDLPSQPFALPNMLRFQGLRQAVQNVTQGLLSSLQDLGQPSDMAMRTDNEGN-IDIRLDIP------FLGLRENHFRRLHRQATSLLNSLDGIARTEPSENPQPQSTSSPASTGVNDQNSATEAASNATAPATPAQSSTVTFARLADMMAEQRRLWERLQPHLDQWEAMLRSEHEAQARISSSREVNATGSDLPLTPTPMEQEPMDVSESAPHVEWSQRFFNQVSFLLHQNSHMLHLLSDF 324          
BLAST of Large proline-rich protein bag6 vs. TrEMBL
Match: A0A0R3U3F4 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS1093 PE=4 SV=1)

HSP 1 Score: 117.087 bits (292), Expect = 1.617e-22
Identity = 96/330 (29.09%), Postives = 150/330 (45.45%), Query Frame = 3
Query:   96 INVIVKTLDGRNHDFSVPD-NINVLQFKAIIHHKMDIAVERQRLLFQGRVLQDDNLLSSYNVAGNVMHLVTRPPPS-QNRLAPDTTTTEREENSDIN-----------RDQIRNILSDVFGNIAELSNP--MGVSVNNEGNRVDITVNMPSSNRLSLARLRQNYIHRLMSQARELLDNL-----RDPNL-PAPR----PDRERLHQANAYDLGANEERITAVSAQP--LPIHNLADMVHSVRDMWRDADPQLELWENVLRRQNLPDNIANNDREM-------------------------------QRMHDSASRYIHLFSHMLHIMSDY 911
              V VKTLDG +  F + D ++ V  FK +I  +MDI +E QRL+FQG+VL D+  L   +V    +HLV RPPP  Q    P T++T  +  S              R  ++N+   +  ++ +L  P  M +  +NEGN +DI +++P         LR+N+  RL  QA  LL++L      +P+  P P+    P    ++  N+    A+     A  AQ   +    LADM+   R +W    P L+ WE +LR ++      ++ RE+                               QR  +  S  +H  SHMLH++SD+
Sbjct:    2 FEVNVKTLDGNSKTFQIDDEDLTVAAFKQLIATEMDIPIENQRLIFQGKVLVDERKLKDCDVESKTIHLVPRPPPQLQTDTDPSTSSTPGDLPSQPFALPNMLRFQGLRQAVQNVTQGLLSSLQDLGQPSDMAMRTDNEGN-IDIRLDIP------FLGLRENHFRRLHRQATSLLNSLDGIARTEPSENPQPQSTSSPASTGVNDQNSATEAASNATAPATPAQSSTVTFARLADMMAEQRRLWERLQPHLDQWEAMLRSEHEAQARISSSREVNATGSDLPLTPTPMEQEPMDVSESAPHVEWSQRFFNQVSFLLHQNSHMLHLLSDF 324          
BLAST of Large proline-rich protein bag6 vs. TrEMBL
Match: A0A267DGM0 (Ubiquitin-like domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig017864g2 PE=4 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 8.690e-22
Identity = 98/311 (31.51%), Postives = 139/311 (44.69%), Query Frame = 3
Query:   93 TINVIVKTLDGRNHDFSVPDNINVLQFKAIIHHKMDIAVERQRLLFQGRVLQDDNLLSSYNVAGNVMHLVTR---PPPSQNRLAPDTTTTEREENSDINR--DQIRNILSDVFGNIAELSNPMGVSVNNE-GNRVDITVNM-PSSNRLSLARLRQNYIHRLMSQAREL---LDNLRDPNLPAPRPDRERLHQANAYDLGAN----------EERITAVSAQPLPIHNLADMVHSVRDMWRDADPQLELWENVLRRQNLPDNI------ANNDREMQRM--HDSASRYIHLFSHMLHIMSDYLVEFQYNANT 941
             I + VKTLDG N D+ V     V QFKAI+   M I  E QRL+FQGRVLQ+D  L     AG V+HLV R   P   Q++            + D++   +QI  I+  V G + E      V+   +    VD+ VN+ P     SLARLR  Y++ ++ Q   L   LD +R      P    E  H ++A  L  N          ++R+    + P  +  L   +  VR      D  L  W  V+  ++L D        A N R  +R+  ++ ASR  HL +H LH +SD + E      T
Sbjct:    1 AITITVKTLDGANCDYEVAVETTVGQFKAILAEAMRIPSEEQRLIFQGRVLQNDAKLIDQGCAGKVVHLVRRMPQPQQQQSQQQQSQQHHHHHHHPDLHALPNQIAQIMEQVLGGVGEAGRGASVTTRQQPDGGVDVVVNLAPGGQHQSLARLRLGYLNTVLRQMSSLLTQLDRVRSGLADGP---GEVPHDSDAVRLSGNPSADRITLPEQDRVGEDPSAPASVAELPAAIDRVRRALSSLDAGLATWSAVV-SEDLADQPGAEGAEALNSRRRRRLAQYELASRAAHLGAHALHNLSDLIAELDRQGET 307          
BLAST of Large proline-rich protein bag6 vs. TrEMBL
Match: A0A267FJD2 (Ubiquitin-like domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig006387g1 PE=4 SV=1)

HSP 1 Score: 113.62 bits (283), Expect = 1.241e-21
Identity = 96/316 (30.38%), Postives = 134/316 (42.41%), Query Frame = 3
Query:   93 TINVIVKTLDGRNHDFSVPDNINVLQFKAIIHHKMDIAVERQRLLFQGRVLQDDNLLSSYNVAGNVMHLVTR------PPPSQNRLAPDTTTTEREENSDINR--DQIRNILSDVFGNIAELSNPMGVSVNNE-GNRVDITVNM-PSSNRLSLARLRQNYIHRLMSQAREL---LDNLRDPNLPAPRPDRERLHQANAYDLGAN----------EERITAVSAQPLPIHNLADMVHSVRDMWRDADPQLELWENVLRR--QNLPDNIANNDRE--------MQRMHDSASRYIHLFSHMLHIMSDYLVEFQYNANT 941
            TI + VKTLDG N D+ V D   V QFKAI+   M I  E QRL+FQGRVLQ+D  L     AG V+HLV R          Q++            + D++   +QI  I+  V G + E      V+   +    VD+ VN+ P     SLARLR  Y++ ++ Q   L   LD +R      P    E  H ++A  L  N          ++R+    + P  +  L   +  VR      D  L  W  V+     + P      D E            ++ ASR  HL +H LH +SD + E      T
Sbjct:    1 TITITVKTLDGANCDYEVADETTVGQFKAILAEAMRIPSEEQRLIFQGRVLQNDAKLIDQGCAGKVVHLVRRMPQPQQQQQQQSQQQQSQQHHHHHHHPDLHALPNQIAQIMEQVLGGVGEAGRGASVTTRQQPDGGVDVVVNLAPGGQHQSLARLRLGYLNTVLRQMSSLLAQLDRVRSGLADGP---GEVPHDSDAVRLSGNPSADRITLPEQDRVGEDPSAPASVAELPAAIDRVRRALSSLDAGLATWSAVVSEDLADQPGAEGGADAESLNSRRRRRLAQYELASRAAHLGAHALHNLSDLIAELDRQGET 313          
BLAST of Large proline-rich protein bag6 vs. TrEMBL
Match: A0A0L8IHN2 (Ubiquitin-like domain-containing protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22021852mg PE=4 SV=1)

HSP 1 Score: 112.464 bits (280), Expect = 4.110e-21
Identity = 96/364 (26.37%), Postives = 167/364 (45.88%), Query Frame = 3
Query:   96 INVIVKTLDGRNHDFSVPDNINVLQFKAIIHHKMDIAVERQRLLFQGRVLQDDNLLSSYNVAGNVMHLVTRPPPSQNRLAP------------DTTTTEREENSDI-----------NRDQIRNILSDVFGNIAELSNPMGVS--VNNEGNRVDITVNMPS--SNRLSLARLRQNYIHRLMSQARELLDNLRDP---------------NLPAPRPDRERLHQANAYDLGANEERITAVSAQ---PLPIHNLADMVHSVRDMWRDADPQLELWENVLRR-QNLPDNIANNDREMQRMHDSASRYIHLFSHMLHIMSDYLVEFQYNANTRVMPVHRNANETSTPTNEAATSTSIDENITPLTGAF 1049
            I+V VKTLDG+    SV D+  V QFK  I   + I  + QRL+FQGRVLQD+ LL  +NV G V+H+V RPPP  N  +P                  R+ NS +           + +Q++NI+     NI EL     VS   + +G+ VD+ +N+      +++ ++ R N+I +L+      L  L +P               N P P        Q+      ++++  TA ++Q   P P+  +A+++  ++++ R   P L  +  + +   +         +E +R+ +  S  +H  SH+ H +SD  V+F     ++  P H +A+ T+ P       +++     P+ G +
Sbjct:    2 IDVSVKTLDGQTKSHSVADDTTVRQFKETIASSISIPADTQRLIFQGRVLQDEKLLKDFNVHGKVIHVVQRPPPRPNSTSPIDNGGVNSTTASAPPPPPRDVNSFVVSSFTLPSDILDPNQVQNIVQQAVHNIGELGRNARVSTRASADGSAVDVHINLGQIPVQQMNESQQRINHIRKLLHLVNMALSRLENPSANSNQQSTNNQRNSNEPVPGAPS----QSGTAQPSSDDQPSTASNSQGPSPPPVTVVAELMTELQEVQRRLQPFLTQYTTLAQNDASYTSEQTEARQESERIFNGVSECLHYMSHIYHSVSDLTVDF-----SQSPPRHLHAH-TAMPALAGLIPSTLSTGSIPVNGQY 355          

HSP 2 Score: 91.6633 bits (226), Expect = 9.757e-15
Identity = 123/504 (24.40%), Postives = 217/504 (43.06%), Query Frame = 3
Query: 1941 QNDLTRLLQSFTSTGTLNLDMPLGQLFPEIFNNQDSDTENNITNQIIQLVVNRLTMIDITQIIHGVYHPLNVLRMPLQDLLLAHQIQCNGS-REQMLDHVVLDLQSFNRVYMSIFERLRTE-DQVDGLSEDARRNFNENIDIHKTINNLNRHHARVVVDMILRSPTDIGFGQLLMNSMFSHHNETLALLDIICNDNDELRQYMVRAFIDSLMASTDDSNDYLSQFI---------------NQSRNTFGLDWL----FENGNSRLFRRPE--QLSELRETVLSAYVVFLDLEADGSALKAPGNNNLIADNTDQIMANVDSLEDMVDSLAGSIIKSNSITDVTNPLDGVVAEFMDVCSYQQDSVSHAPNGNSWQSVLPPDWIDIVSRDSNVPVDQQTIGIPYSDAYVSGMPPKRRKIILNQRHRSVQQVPELMHDCIDHAIQSAGVVTNESLDTQQFPLG----LTNSFQELVSDHVRNRLVEESFNFPNDRFPSVEQNFNRKKR 3371
            Q  +  L+Q+  +TG  N+   +   F  I    D +    +TN I Q +   LT+ D+  ++ G   PLN LR PL++L L HQI  +    E  + + VL L             +R E   +  +SE        NID   T++N  +H    ++ + + S  +  FGQ L N   +  +E + L      +     Q +V    D L   T+  N  + Q +                +S     + W       N  S     PE    + + E   S     ++++++ SA     NNN   D T +   N +S   +V+ +      + + T  T PL       + V      + +   NG+ W SV+P +W+ I+ +D      +Q    P+SDAY+SGMP KRRK+    +  ++ +V E + D +  A+ SAGV    SL+           L ++F++ + ++V  R+  +S ++  + FP++E+ F ++++
Sbjct:  866 QGIINNLMQA--ATGQQNVGT-IWDFFSTIGEEMDIEHFEGLTNDIFQCISRHLTISDLMTVLLGNSEPLNRLRTPLKELFL-HQILNDAEPTEANIQNAVLQL----------LTEMRAEIKAIVSISE-----VQPNIDAEATLDNFLKHQYTKIIKLTIESEDNNEFGQSLYNWFKTFLSELIVLGRFCLVEGHPAFQRVVH---DRLQHLTNGINVMMQQSLITMATLQLNGFHPQQTESDIQHYIAWKDSASAANKESAKPNPPEVTAAAAVPEVAESEAASPMEVDSETSATSQVTNNNSKPDTTTK---NKESKPKLVNGVNSEETSATTTTAATVPLT------LAVEQTNAAAPTTTSNGDDWCSVVPAEWVPIIRQDIQH-QRRQNPQTPFSDAYLSGMPAKRRKMNPG-KATNLSEVSEFVPDSLKKAVASAGVEPLSSLENLSNEAARDSILHSAFEDQMCNNVLQRIHLDS-DYNPEMFPNIEEYFKKQRK 1335          
BLAST of Large proline-rich protein bag6 vs. Ensembl Cavefish
Match: bag6 (large proline-rich protein BAG6-like [Source:NCBI gene;Acc:103025751])

HSP 1 Score: 79.337 bits (194), Expect = 1.948e-14
Identity = 38/80 (47.50%), Postives = 53/80 (66.25%), Query Frame = 3
Query:   90 STINVIVKTLDGRNHDFSVPDNINVLQFKAIIHHKMDIAVERQRLLFQGRVLQDDNLLSSYNVAGNVMHLVTRPPPSQNR 329
            S I V VKTLD ++  ++V   + V +FK  I   + I V++QRL++QGRVLQD+  L+ YNV G V+HLV R PP  N+
Sbjct:    7 SDIEVTVKTLDSQSRSYTVRAQMTVKEFKEHISTSVGIPVDKQRLIYQGRVLQDEKTLTEYNVNGKVIHLVERAPPQTNQ 86          

HSP 2 Score: 60.8474 bits (146), Expect = 8.238e-9
Identity = 48/155 (30.97%), Postives = 71/155 (45.81%), Query Frame = 3
Query: 2910 GVVAEFMDVCSYQQDSVSHAPNGNSWQSVLPPDWIDIVSRDSNVPVDQQTIGI--PYSDAYVSGMPPKRRKIILNQRHRSVQQVPELMHDCIDHAIQSAGVVTNESLDTQQFPLGLTNSFQELVSDHVRN---RLVEESFNFPNDRFPSVEQNFN 3359
            G +AE     +  ++ V  A    +W + LPPDW+ I+ +D    + Q+ I    P SDAY+ GMP KRRK       R        + + +  A +SAGV    S    Q  L      QE  S  V+N   + V+E  +F   RFP+  + F+
Sbjct: 1097 GGLAEETVGATGGEEPVGEA---EAWAAALPPDWVPIIRQDM---LTQRKIKAQPPLSDAYLQGMPAKRRKTAQGDGPRLT------LSEAVSQAARSAGVTPVTSSSALQGDLERPE-LQEAYSQQVKNDIKKRVKEDPDFNPRRFPNTHKAFS 1238          
BLAST of Large proline-rich protein bag6 vs. Ensembl Cavefish
Match: bag6l (BCL2 associated athanogene 6, like [Source:NCBI gene;Acc:751663])

HSP 1 Score: 78.9518 bits (193), Expect = 2.632e-14
Identity = 37/76 (48.68%), Postives = 51/76 (67.11%), Query Frame = 3
Query:   90 STINVIVKTLDGRNHDFSVPDNINVLQFKAIIHHKMDIAVERQRLLFQGRVLQDDNLLSSYNVAGNVMHLVTRPPP 317
             TI V VKTLD ++  ++V     V +FK  I   ++I V++QRL++QGRVLQD+  L+ YNV G V+HLV R PP
Sbjct:   14 GTIEVTVKTLDSQSRSYTVRGEWTVKEFKEHIASSVEIPVDKQRLIYQGRVLQDERTLTEYNVDGKVIHLVERAPP 89          

HSP 2 Score: 67.0106 bits (162), Expect = 1.256e-10
Identity = 100/452 (22.12%), Postives = 177/452 (39.16%), Query Frame = 3
Query: 2076 IIQLVVNRLTMIDITQIIHGVYHPLNVLRMPLQDLLLAHQIQCNGSREQMLDHVVLDLQSFNRVYMSIFERLRTEDQVDGLSEDARRNFN-----ENIDIHKTINNLNRHHARVVVDMILRSPTDIGFGQLLMNSMFSHHNETLALLDIICNDNDELRQYMVRAFIDSLMASTDDSNDYLSQFINQSRNTFGLDWLFENGNSRLFRRPEQLSELRETVLSAYVVFLDLEADGSALKAPGNNNLIADNTDQIM--------ANVDSLEDMVDSLAGSIIKSNSITDVTNPLDGVVAEF-----MDVCSYQQDSVSHAPNGNSWQSVLPPDWIDIVSRDSNVPVDQQTIGI--PYSDAYVSGMPPKRRKIILNQRHRSVQQVPEL-MHDCIDHAIQSAGV--VTN-ESLDTQQFPLGLTNSFQELVSDHVRNRLVEESFNFPNDRFPSVEQNFN 3359
            ++ LV    +M+D+  ++HG   PL+ ++  L      H +Q    RE    ++                    ED ++GL E    +F+     E +DI +T  +  R     +   I R  TD  FG  L+        E LAL             Y +R    +L A  +     +S  +N S     ++WL    + RL    +  + + E  +  YV++   +   SA++   +   +     Q +        A   + E+ + S   S        D+  P      E      M     ++      P    W + +PP+W+ I+  D    + Q+ I    P SDAY+ GMP KRRK    +        P L + + +  A ++ GV  VTN +SL  +     L  ++ + V D ++ R+ E+  ++ + RFP+  + F+
Sbjct:  773 LLSLVCQSFSMVDMVLLLHGNPQPLSRIQPELTAFFTEHYLQ---GREPTDANIATA----------------AEDLINGLEEYIAESFSTVTVREGVDIIQTNMSFLRQQFTQMATHIFRC-TDHTFGSRLLFLCTQGLFECLAL-----------NLYCLRGEQRALTAVINHRIRRMSAEVNPSL----VNWLTSMMSMRLHVILDH-NPVTENQIQHYVIYTQPD---SAVRVESDTQAVQQTESQSVEMEEGLSPAPATTAEEAMASSGESADSREPAADLAPPCRPSSGEARGTAGMAAAGREESGAEAEP----WAASVPPEWVPIIRHDM---MSQRKIKAQPPLSDAYLQGMPAKRRKTAQGEG-------PHLSLSEAVSRAARTVGVRPVTNPDSLQGELETPELQEAYTQQVKDDLKKRVTEDP-DYNSQRFPNTHKAFS 1170          
BLAST of Large proline-rich protein bag6 vs. Ensembl Cavefish
Match: bag6l (BCL2 associated athanogene 6, like [Source:NCBI gene;Acc:751663])

HSP 1 Score: 78.9518 bits (193), Expect = 2.695e-14
Identity = 37/76 (48.68%), Postives = 51/76 (67.11%), Query Frame = 3
Query:   90 STINVIVKTLDGRNHDFSVPDNINVLQFKAIIHHKMDIAVERQRLLFQGRVLQDDNLLSSYNVAGNVMHLVTRPPP 317
             TI V VKTLD ++  ++V     V +FK  I   ++I V++QRL++QGRVLQD+  L+ YNV G V+HLV R PP
Sbjct:   14 GTIEVTVKTLDSQSRSYTVRGEWTVKEFKEHIASSVEIPVDKQRLIYQGRVLQDERTLTEYNVDGKVIHLVERAPP 89          

HSP 2 Score: 66.6254 bits (161), Expect = 1.386e-10
Identity = 100/452 (22.12%), Postives = 177/452 (39.16%), Query Frame = 3
Query: 2076 IIQLVVNRLTMIDITQIIHGVYHPLNVLRMPLQDLLLAHQIQCNGSREQMLDHVVLDLQSFNRVYMSIFERLRTEDQVDGLSEDARRNFN-----ENIDIHKTINNLNRHHARVVVDMILRSPTDIGFGQLLMNSMFSHHNETLALLDIICNDNDELRQYMVRAFIDSLMASTDDSNDYLSQFINQSRNTFGLDWLFENGNSRLFRRPEQLSELRETVLSAYVVFLDLEADGSALKAPGNNNLIADNTDQIM--------ANVDSLEDMVDSLAGSIIKSNSITDVTNPLDGVVAEF-----MDVCSYQQDSVSHAPNGNSWQSVLPPDWIDIVSRDSNVPVDQQTIGI--PYSDAYVSGMPPKRRKIILNQRHRSVQQVPEL-MHDCIDHAIQSAGV--VTN-ESLDTQQFPLGLTNSFQELVSDHVRNRLVEESFNFPNDRFPSVEQNFN 3359
            ++ LV    +M+D+  ++HG   PL+ ++  L      H +Q    RE    ++                    ED ++GL E    +F+     E +DI +T  +  R     +   I R  TD  FG  L+        E LAL             Y +R    +L A  +     +S  +N S     ++WL    + RL    +  + + E  +  YV++   +   SA++   +   +     Q +        A   + E+ + S   S        D+  P      E      M     ++      P    W + +PP+W+ I+  D    + Q+ I    P SDAY+ GMP KRRK    +        P L + + +  A ++ GV  VTN +SL  +     L  ++ + V D ++ R+ E+  ++ + RFP+  + F+
Sbjct:  793 LLSLVCQSFSMVDMVLLLHGNPQPLSRIQPELTAFFTEHYLQ---GREPTDANIATA----------------AEDLINGLEEYIAESFSTVTVREGVDIIQTNMSFLRQQFTQMATHIFRC-TDHTFGSRLLFLCTQGLFECLAL-----------NLYCLRGEQRALTAVINHRIRRMSAEVNPSL----VNWLTSMMSMRLHVILDH-NPVTENQIQHYVIYTQPD---SAVRVESDTQAVQQTESQSVEMEEGLSPAPATTAEEAMASSGESADSREPAADLAPPCRPSSGEARGTAGMAAAGREESGAEAEP----WAASVPPEWVPIIRHDM---MSQRKIKAQPPLSDAYLQGMPAKRRKTAQGEG-------PHLSLSEAVSRAARTVGVRPVTNPDSLQGELETPELQEAYTQQVKDDLKKRVTEDP-DYNSQRFPNTHKAFS 1190          
BLAST of Large proline-rich protein bag6 vs. Ensembl Cavefish
Match: bag6l (BCL2 associated athanogene 6, like [Source:NCBI gene;Acc:751663])

HSP 1 Score: 78.9518 bits (193), Expect = 2.743e-14
Identity = 37/76 (48.68%), Postives = 51/76 (67.11%), Query Frame = 3
Query:   90 STINVIVKTLDGRNHDFSVPDNINVLQFKAIIHHKMDIAVERQRLLFQGRVLQDDNLLSSYNVAGNVMHLVTRPPP 317
             TI V VKTLD ++  ++V     V +FK  I   ++I V++QRL++QGRVLQD+  L+ YNV G V+HLV R PP
Sbjct:   14 GTIEVTVKTLDSQSRSYTVRGEWTVKEFKEHIASSVEIPVDKQRLIYQGRVLQDERTLTEYNVDGKVIHLVERAPP 89          

HSP 2 Score: 70.0922 bits (170), Expect = 1.262e-11
Identity = 102/439 (23.23%), Postives = 175/439 (39.86%), Query Frame = 3
Query: 2076 IIQLVVNRLTMIDITQIIHGVYHPLNVLRMPLQDLLLAHQIQCNGSREQMLDHVVLDLQSFNRVYMSIFERLRTEDQVDGLSEDARRNFN-----ENIDIHKTINNLNRHHARVVVDMILRSPTDIGFGQLLMNSMFSHHNETLALLDIICNDNDELRQYMVRAFIDSLMASTDDSNDYLSQFINQSRNTFGLDWLFENGNSRLFRRPEQLSELRETVLSAYVVFLDLEADGSALKAPGNNNLIADNTDQIMANVDSLEDMVDSLAGSIIKSNSITDVTNPLDGVVAEFMDVCSYQQDSVSHAPNGNSWQSVLPPDWIDIVSRDSNVPVDQQTIGI--PYSDAYVSGMPPKRRKIILNQRHRSVQQVPEL-MHDCIDHAIQSAGV--VTN-ESLDTQQFPLGLTNSFQELVSDHVRNRLVEESFNFPNDRFPSVEQNFN 3359
            ++ LV    +M+D+  ++HG   PL+ ++  L      H +Q    RE    ++                    ED ++GL E    +F+     E +DI +T  +  R     +   I R  TD  FG  L+        E LAL             Y +R    +L A  +     +S  +N S     ++WL    + RL    +  + + E  +  YV++  +E   S   A      +A + +    + DS E   D LA     S+     T          M     ++      P    W + +PP+W+ I+  D    + Q+ I    P SDAY+ GMP KRRK    +        P L + + +  A ++ GV  VTN +SL  +     L  ++ + V D ++ R+ E+  ++ + RFP+  + F+
Sbjct:  793 LLSLVCQSFSMVDMVLLLHGNPQPLSRIQPELTAFFTEHYLQ---GREPTDANIATA----------------AEDLINGLEEYIAESFSTVTVREGVDIIQTNMSFLRQQFTQMATHIFRC-TDHTFGSRLLFLCTQGLFECLAL-----------NLYCLRGEQRALTAVINHRIRRMSAEVNPSL----VNWLTSMMSMRLHVILDH-NPVTENQIQHYVIYTQMEEGLSPAPATTAEEAMASSGE----SADSREPAAD-LAPPCRPSSGEARGT--------AGMAAAGREESGAEAEP----WAASVPPEWVPIIRHDM---MSQRKIKAQPPLSDAYLQGMPAKRRKTAQGEG-------PHLSLSEAVSRAARTVGVRPVTNPDSLQGELETPELQEAYTQQVKDDLKKRVTEDP-DYNSQRFPNTHKAFS 1167          
BLAST of Large proline-rich protein bag6 vs. Ensembl Yeast
Match: RPL40B (Ubiquitin-ribosomal 60S subunit protein L40B fusion protein; cleaved to yield ubiquitin and ribosomal protein L40B; ubiquitin may facilitate assembly of the ribosomal protein into ribosomes; homologous to mammalian ribosomal protein L40, no bacterial homolog; RPL40B has a paralog, RPL40A, that arose from the whole genome duplication [Source:SGD;Acc:S000001802])

HSP 1 Score: 45.4394 bits (106), Expect = 4.027e-6
Identity = 25/72 (34.72%), Postives = 39/72 (54.17%), Query Frame = 3
Query:   96 INVIVKTLDGRNHDFSVPDNINVLQFKAIIHHKMDIAVERQRLLFQGRVLQDDNLLSSYNVAG-NVMHLVTR 308
            + + VKTL G+     V  +  +   K+ I  K  I  ++QRL+F G+ L+D   LS YN+   + +HLV R
Sbjct:    1 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR 72          
BLAST of Large proline-rich protein bag6 vs. Ensembl Yeast
Match: RPL40A (Ubiquitin-ribosomal 60S subunit protein L40A fusion protein; cleaved to yield ubiquitin and ribosomal protein L40A; ubiquitin may facilitate assembly of the ribosomal protein into ribosomes; homologous to mammalian ribosomal protein L40, no bacterial homolog; RPL40A has a paralog, RPL40B, that arose from the whole genome duplication; relative distribution to the nucleus increases upon DNA replication stress [Source:SGD;Acc:S000001410])

HSP 1 Score: 45.4394 bits (106), Expect = 4.027e-6
Identity = 25/72 (34.72%), Postives = 39/72 (54.17%), Query Frame = 3
Query:   96 INVIVKTLDGRNHDFSVPDNINVLQFKAIIHHKMDIAVERQRLLFQGRVLQDDNLLSSYNVAG-NVMHLVTR 308
            + + VKTL G+     V  +  +   K+ I  K  I  ++QRL+F G+ L+D   LS YN+   + +HLV R
Sbjct:    1 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR 72          
BLAST of Large proline-rich protein bag6 vs. Ensembl Nematostella
Match: EDO43370 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYS4])

HSP 1 Score: 74.7146 bits (182), Expect = 1.972e-13
Identity = 37/82 (45.12%), Postives = 49/82 (59.76%), Query Frame = 3
Query:   96 INVIVKTLDGRNHDFSVPDNINVLQFKAIIHHKMDIAVERQRLLFQGRVLQDDNLLSSYNVAGNVMHLVTRPPPSQNRLAPD 341
            + V VKTLD     F+V + + V +FK  I   + I  ERQRL+F+G+VLQD+  L  + V G V+HLV R PP   R  PD
Sbjct:    1 MQVTVKTLDSETRTFTVSEELTVEEFKKEIADTVGIPAERQRLIFKGKVLQDEKKLKEFEVDGCVVHLVERKPP---RTQPD 79          

HSP 2 Score: 54.299 bits (129), Expect = 3.474e-7
Identity = 38/126 (30.16%), Postives = 62/126 (49.21%), Query Frame = 3
Query: 2985 WQSVLPPDWIDIVSRD----SNVPVDQQTIGIPYSDAYVSGMPPKRRKIILNQRHRSVQQVPELMHDCIDHAIQSAGVVTNESLDTQQFPLGLTNSFQELVSDHVRNRLVEESFNFPNDRFPSVEQ 3350
            W++V+P +W+ I+++D      +P  Q     P+SDAY+SG+PPKRRK +L               + ID   +SA   TN  L           +++E V + V+ R  +   +F ++RFP   Q
Sbjct: 1048 WKAVVPEEWVPILAQDVMRQRRIPPQQ-----PFSDAYLSGLPPKRRKAMLAT---------GAPRNSIDAVTESA--RTNSKLH---------QAYREEVKETVKKR-TDTDTDFSSERFPVTSQ 1147          
BLAST of Large proline-rich protein bag6 vs. Ensembl Nematostella
Match: EDO46866 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNI9])

HSP 1 Score: 56.9954 bits (136), Expect = 1.686e-9
Identity = 26/77 (33.77%), Postives = 46/77 (59.74%), Query Frame = 3
Query:   96 INVIVKTLDGRNHDFSVPDNINVLQFKAIIHHKMDIAVERQRLLFQGRVLQDDNLLSSYNVA-GNVMHLVTRPPPSQ 323
            + VIVK L+G+  +  V +   +L  K ++  ++D+ VERQRL+++G+ L DD  L  Y +  G+ ++L  +   SQ
Sbjct:    1 MKVIVKILNGKEAELEVSETEPILAVKTLVAQELDVQVERQRLVYKGKTLADDCSLDEYLIGDGSKLYLSIKKLSSQ 77          
BLAST of Large proline-rich protein bag6 vs. Ensembl Medaka
Match: bag6 (BCL2 associated athanogene 6 [Source:NCBI gene;Acc:101160263])

HSP 1 Score: 77.0258 bits (188), Expect = 9.012e-14
Identity = 37/73 (50.68%), Postives = 50/73 (68.49%), Query Frame = 3
Query:   90 STINVIVKTLDGRNHDFSVPDNINVLQFKAIIHHKMDIAVERQRLLFQGRVLQDDNLLSSYNVAGNVMHLVTR 308
            S I V VKTLD ++  +SV   + V +FK  I   + I V++QRL++QGRVLQD+  L+ YNVAG V+HLV R
Sbjct:    6 SDIEVTVKTLDSQSRTYSVGAQLTVKEFKEHISPSVGIPVDKQRLIYQGRVLQDERTLADYNVAGKVIHLVER 78          

HSP 2 Score: 53.5286 bits (127), Expect = 1.372e-6
Identity = 44/161 (27.33%), Postives = 78/161 (48.45%), Query Frame = 3
Query: 2904 LDGVVAEFMDVCSYQQDSVSHAPNGNSWQSVLPPDWIDIVSRDSNVPVDQQTIGI--PYSDAYVSGMPPKRRKIILNQRHRSVQQVPELMHDCIDHAIQSAGV--VTNES-----LDTQQFPLGLTNSFQELVSDHVRNRLVEESFNFPNDRFPSVEQNFN 3359
            L G      D+   +  S   +    +W + +PP+W+ I+  D    + Q+ +    P SDAY++GMP KRRK    Q   S+      + D ++ A ++AGV  +T+       LD+Q+    +  ++ E V   ++ R V E  +F   +FP+V + F+
Sbjct: 1046 LGGAAPLGGDMAGAEGGSEEASGESETWAASVPPEWVPIIRCDM---MTQRKMKAQPPLSDAYLNGMPAKRRKT--GQGSGSLLS----LSDAVNQAARTAGVRPITSAEQLQGDLDSQE----VKEAYSEQVKSDIKKR-VREDPDFNPQQFPNVHRAFS 1192          
BLAST of Large proline-rich protein bag6 vs. Ensembl Medaka
Match: ENSORLT00000015052.2 (pep primary_assembly:ASM223467v1:12:2267197:2268484:1 gene:ENSORLG00000012019.2 transcript:ENSORLT00000015052.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.5286 bits (127), Expect = 4.809e-8
Identity = 34/103 (33.01%), Postives = 52/103 (50.49%), Query Frame = 3
Query:   96 INVIVKTLDGRNHDFSVPDNINVLQFKAIIHHKMDIAVERQRLLFQGRVLQDDNLLSSYNVAG-NVMHLVTRPPPSQN---RLAPDTTTTEREENSDINRDQI 392
            + + VKTL G+     V  +  +   KA I  K  I  ++QRL+F G+ L+D   LS YN+   + +HLV + P S +   R   +  T E EE+  I  +Q 
Sbjct:    1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLQTPGSTDANGRSPAEKQTCEAEESGQIYANQC 103          
BLAST of Large proline-rich protein bag6 vs. Planmine SMEST
Match: SMESG000051496.1 (SMESG000051496.1)

HSP 1 Score: 2075.44 bits (5376), Expect = 0.000e+0
Identity = 1095/1103 (99.27%), Postives = 1099/1103 (99.64%), Query Frame = 3
Query:   87 MSTINVIVKTLDGRNHDFSVPDNINVLQFKAIIHHKMDIAVERQRLLFQGRVLQDDNLLSSYNVAGNVMHLVTRPPPSQNRLAPDTTTTEREENSDINRDQIRNILSDVFGNIAELSNPMGVSVNNEGNRVDITVNMPSSNRLSLARLRQNYIHRLMSQARELLDNLRDPNLPAPRPDRERLHQANAYDLGANEERITAVSAQPLPIHNLADMVHSVRDMWRDADPQLELWENVLRRQNLPDNIANNDREMQRMHDSASRYIHLFSHMLHIMSDYLVEFQYNANTRVMPVHRNANETSTPTNEAATSTSIDENITPLTGAFGESALPQSEGSTDGXXXXXXXXXXXXXXXXXXXXYLYVFSEMPAQLFQVRLDVDSTIQMPATSGQTHVFATRTTERASQPGSDPVTTSTAPSQXXXXXXXXXXXXRARRQGVPPQFPGPATMENLFRSTLHDSFVHSTATNSMSGQASGASRINGANPRTTIRNGSPLIENVDPYVRCQSRHFQNPSNLRTGAVISTFGGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDAREGDPVRTFIGGLINSIFSSSGDTMQAAPSTTNDNASSSQPAATNPPIITPSFPQNDLTRLLQSFTSTGTLNLDMPLGQLFPEIFNNQDSDTENNITNQIIQLVVNRLTMIDITQIIHGVYHPLNVLRMPLQDLLLAHQIQCNGSREQMLDHVVLDLQSFNRVYMSIFERLRTEDQVDGLSEDARRNFNENIDIHKTINNLNRHHARVVVDMILRSPTDIGFGQLLMNSMFSHHNETLALLDIICNDNDELRQYMVRAFIDSLMASTDDSNDYLSQFINQSRNTFGLDWLFENGNSRLFRRPEQLSELRETVLSAYVVFLDLEADGSALKAPGNNNLIADNTDQIMANVDSLEDMVDSLAGSIIKSNSITDVTNPLDGVVAEFMDVCSYQQDSVSHAPNGNSWQSVLPPDWIDIVSRDSNVPVDQQTIGIPYSDAYVSGMPPKRRKIILNQRHRSVQQVPELMHDCIDHAIQSAGVVTNESLDTQQFPLGLTNSFQELVSDHVRNRLVEESFNFPNDRFPSVEQNFNRKKRPDDDKNSN 3395
            MSTINVIVKTLDGRNHDFSVPDNINVLQFKAIIHHKMDIAVERQRLLFQGRVLQDDNLLSSYNVAGNVMHLVTRPPPSQNR APDTTTTEREENSDINRDQIRNILSDVFGNIAELSNPMGVSVNNEGNRVDITVNMPSSNRLSLARLRQNYIHRLMSQARELLDNLRDPNLPAPRPDRERL+QANAYDLGANEERIT VSAQPLPIHNLADMVHSVRDMWRDA+PQLELWENVLRRQNLPDNIANNDREMQRMHDSASRYIHLFSHMLHIMSDYLVEFQYNANTRVMPVHRNANETSTPTNEAATSTSIDENITPLTGAFGESALPQSEGSTDGNASTATNTSDTNLDSNDRSRYLYVFSEMPAQLFQVRLDVDSTIQMP TSGQTHVFATRTTERASQPGSDPVTTSTAPSQPNPTTETPTGTTRARRQGVPPQFPGPATMENLFRSTLHDSFVHSTATNSMSGQASGASRINGANPRTTIRNGSPLIENVDPYVRCQSRHFQNPSNLRTGAVISTFGGIRFRDSSRSRPRPTESPVATTTTTTTTTVPSTTANTTTNVTDAREGDPVRTFIGGLINSIFSSSGDTMQAAPSTTNDNASSSQPAATNPPIITPSFPQNDLTRLLQSFTSTGTLNLDMPLGQLFPEIFNNQDSDTENNITNQIIQLVVNRLTMIDITQIIHGVYHPLNVLRMPLQDLLLAHQIQCNGSREQMLDHVVLDL+SFNRVYMSIFERLRTEDQVDGLSEDARRNFNENIDIHKTINNLNRHHARVVVDMILRSPTDIGFGQLLMNSMFSHHNETLALLDIICNDNDELRQYMVRAFIDSLMASTDDSNDYLSQFINQSRNTFGLDWLFENGNSRLFRRPEQLSELRETVLSAYVVFLDLEADGSALKAPGNNNLIADNTDQIMANVDSLEDMVDSLAGSIIKSNS+TDVTNPLDGVVAEFMDVCSYQQDSVSHA NGNSWQSVLPPDWIDIVSRDSNVPVDQQTIGIPYSDAYVSGMPPKRRKIILNQRHRSVQQVPELMHDCIDHAIQSAGVVTNESLDTQQFPLGLTNSFQELVSDHVRNRLVEESFNFPNDRFPSVEQNFNRKKRPDDDKNSN
Sbjct:    1 MSTINVIVKTLDGRNHDFSVPDNINVLQFKAIIHHKMDIAVERQRLLFQGRVLQDDNLLSSYNVAGNVMHLVTRPPPSQNRPAPDTTTTEREENSDINRDQIRNILSDVFGNIAELSNPMGVSVNNEGNRVDITVNMPSSNRLSLARLRQNYIHRLMSQARELLDNLRDPNLPAPRPDRERLYQANAYDLGANEERITEVSAQPLPIHNLADMVHSVRDMWRDAEPQLELWENVLRRQNLPDNIANNDREMQRMHDSASRYIHLFSHMLHIMSDYLVEFQYNANTRVMPVHRNANETSTPTNEAATSTSIDENITPLTGAFGESALPQSEGSTDGNASTATNTSDTNLDSNDRSRYLYVFSEMPAQLFQVRLDVDSTIQMPVTSGQTHVFATRTTERASQPGSDPVTTSTAPSQPNPTTETPTGTTRARRQGVPPQFPGPATMENLFRSTLHDSFVHSTATNSMSGQASGASRINGANPRTTIRNGSPLIENVDPYVRCQSRHFQNPSNLRTGAVISTFGGIRFRDSSRSRPRPTESPVATTTTTTTTTVPSTTANTTTNVTDAREGDPVRTFIGGLINSIFSSSGDTMQAAPSTTNDNASSSQPAATNPPIITPSFPQNDLTRLLQSFTSTGTLNLDMPLGQLFPEIFNNQDSDTENNITNQIIQLVVNRLTMIDITQIIHGVYHPLNVLRMPLQDLLLAHQIQCNGSREQMLDHVVLDLESFNRVYMSIFERLRTEDQVDGLSEDARRNFNENIDIHKTINNLNRHHARVVVDMILRSPTDIGFGQLLMNSMFSHHNETLALLDIICNDNDELRQYMVRAFIDSLMASTDDSNDYLSQFINQSRNTFGLDWLFENGNSRLFRRPEQLSELRETVLSAYVVFLDLEADGSALKAPGNNNLIADNTDQIMANVDSLEDMVDSLAGSIIKSNSVTDVTNPLDGVVAEFMDVCSYQQDSVSHAQNGNSWQSVLPPDWIDIVSRDSNVPVDQQTIGIPYSDAYVSGMPPKRRKIILNQRHRSVQQVPELMHDCIDHAIQSAGVVTNESLDTQQFPLGLTNSFQELVSDHVRNRLVEESFNFPNDRFPSVEQNFNRKKRPDDDKNSN 1103          
BLAST of Large proline-rich protein bag6 vs. Planmine SMEST
Match: SMESG000063727.1 (SMESG000063727.1)

HSP 1 Score: 50.8322 bits (120), Expect = 6.930e-6
Identity = 24/72 (33.33%), Postives = 43/72 (59.72%), Query Frame = 3
Query:   96 INVIVKTLDGRNHDFSVPDNINVLQFKAIIHHKMDIAVERQRLLFQGRVLQDDNLLSSYNVAG-NVMHLVTR 308
            + +  KT+DG+   F V +   +   K  I  K+ +A + Q+L++QG +LQDD  +  Y +A  +V+++VTR
Sbjct:  169 MKIFAKTMDGKTVAFEVQNAEKIRDIKLKIQEKIGLASDEQKLVYQGGILQDDKTVKDYGIADRSVINVVTR 240          
BLAST of Large proline-rich protein bag6 vs. Planmine SMEST
Match: SMESG000066693.1 (SMESG000066693.1)

HSP 1 Score: 46.595 bits (109), Expect = 9.046e-6
Identity = 26/72 (36.11%), Postives = 39/72 (54.17%), Query Frame = 3
Query:   96 INVIVKTLDGRNHDFSVPDNINVLQFKAIIHHKMDIAVERQRLLFQGRVLQDDNLLSSYNVAG-NVMHLVTR 308
            + + VKTL G+     V  +  +   KA I  K  I  ++QRL+F G+ L+D   LS YN+   + +HLV R
Sbjct:    1 MQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR 72          
The following BLAST results are available for this feature:
BLAST of Large proline-rich protein bag6 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BAG61.215e-1650.67BCL2 associated athanogene 6 [Source:HGNC Symbol;A... [more]
BAG61.215e-1650.67BCL2 associated athanogene 6 [Source:HGNC Symbol;A... [more]
BAG61.215e-1650.67BCL2 associated athanogene 6 [Source:HGNC Symbol;A... [more]
BAG61.215e-1650.67BCL2 associated athanogene 6 [Source:HGNC Symbol;A... [more]
BAG61.215e-1650.67BCL2 associated athanogene 6 [Source:HGNC Symbol;A... [more]
back to top
BLAST of Large proline-rich protein bag6 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ubq-28.628e-636.11Ubiquitin-60S ribosomal protein L40 Ubiquitin 60S ... [more]
back to top
BLAST of Large proline-rich protein bag6 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG75463.702e-1550.00gene:FBgn0035793 transcript:FBtr0332141[more]
CG75463.764e-1550.00gene:FBgn0035793 transcript:FBtr0076792[more]
CG75464.094e-1550.00gene:FBgn0035793 transcript:FBtr0305073[more]
CG75464.180e-1550.00gene:FBgn0035793 transcript:FBtr0290025[more]
CG75464.481e-1550.00gene:FBgn0035793 transcript:FBtr0332142[more]
back to top
BLAST of Large proline-rich protein bag6 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
bag6l2.035e-1447.95BCL2 associated athanogene 6, like [Source:NCBI ge... [more]
bag63.169e-1449.33BCL2 associated athanogene 6 [Source:ZFIN;Acc:ZDB-... [more]
bag63.500e-1449.33BCL2 associated athanogene 6 [Source:ZFIN;Acc:ZDB-... [more]
bag6l3.595e-1349.30BCL2 associated athanogene 6, like [Source:NCBI ge... [more]
bag6l3.974e-1349.30BCL2 associated athanogene 6, like [Source:NCBI ge... [more]
back to top
BLAST of Large proline-rich protein bag6 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
bag64.714e-1431.18BCL2 associated athanogene 6 [Source:NCBI gene;Acc... [more]
bag65.856e-1431.18BCL2 associated athanogene 6 [Source:NCBI gene;Acc... [more]
bag66.096e-1431.02BCL2 associated athanogene 6 [Source:NCBI gene;Acc... [more]
bag66.963e-1431.18BCL2 associated athanogene 6 [Source:NCBI gene;Acc... [more]
bag68.629e-1450.00BCL2 associated athanogene 6 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Large proline-rich protein bag6 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Bag67.771e-1850.67BCL2-associated athanogene 6 [Source:MGI Symbol;Ac... [more]
Bag68.055e-1750.67BCL2-associated athanogene 6 [Source:MGI Symbol;Ac... [more]
Bag61.542e-1650.67BCL2-associated athanogene 6 [Source:MGI Symbol;Ac... [more]
Bag64.049e-1550.67BCL2-associated athanogene 6 [Source:MGI Symbol;Ac... [more]
Bag67.607e-1550.67BCL2-associated athanogene 6 [Source:MGI Symbol;Ac... [more]
back to top
BLAST of Large proline-rich protein bag6 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9Z1R2|BAG6_MOUSE5.321e-1450.67Large proline-rich protein BAG6 OS=Mus musculus OX... [more]
sp|P46379|BAG6_HUMAN5.460e-1450.67Large proline-rich protein BAG6 OS=Homo sapiens OX... [more]
sp|A5D9M6|BAG6_PIG6.245e-1450.67Large proline-rich protein BAG6 OS=Sus scrofa OX=9... [more]
sp|Q9YHD3|BAG6A_XENLA8.009e-1432.24Large proline-rich protein bag6-A OS=Xenopus laevi... [more]
sp|Q6MG49|BAG6_RAT1.011e-1350.67Large proline-rich protein BAG6 OS=Rattus norvegic... [more]
back to top
BLAST of Large proline-rich protein bag6 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5K3F3161.348e-2229.09Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A0R3U3F41.617e-2229.09Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A267DGM08.690e-2231.51Ubiquitin-like domain-containing protein (Fragment... [more]
A0A267FJD21.241e-2130.38Ubiquitin-like domain-containing protein (Fragment... [more]
A0A0L8IHN24.110e-2126.37Ubiquitin-like domain-containing protein OS=Octopu... [more]
back to top
BLAST of Large proline-rich protein bag6 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
bag61.948e-1447.50large proline-rich protein BAG6-like [Source:NCBI ... [more]
bag6l2.632e-1448.68BCL2 associated athanogene 6, like [Source:NCBI ge... [more]
bag6l2.695e-1448.68BCL2 associated athanogene 6, like [Source:NCBI ge... [more]
bag6l2.743e-1448.68BCL2 associated athanogene 6, like [Source:NCBI ge... [more]
back to top
BLAST of Large proline-rich protein bag6 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Large proline-rich protein bag6 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
RPL40B4.027e-634.72Ubiquitin-ribosomal 60S subunit protein L40B fusio... [more]
RPL40A4.027e-634.72Ubiquitin-ribosomal 60S subunit protein L40A fusio... [more]
back to top
BLAST of Large proline-rich protein bag6 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO433701.972e-1345.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO468661.686e-933.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Large proline-rich protein bag6 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
bag69.012e-1450.68BCL2 associated athanogene 6 [Source:NCBI gene;Acc... [more]
ENSORLT00000015052.24.809e-833.01pep primary_assembly:ASM223467v1:12:2267197:226848... [more]
back to top
BLAST of Large proline-rich protein bag6 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000051496.10.000e+099.27SMESG000051496.1[more]
SMESG000063727.16.930e-633.33SMESG000063727.1[more]
SMESG000066693.19.046e-636.11SMESG000066693.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024653 ID=SMED30024653|Name=Large proline-rich protein bag6|organism=Schmidtea mediterranea sexual|type=transcript|length=3485bp
GGGATTTTATTTTACTAACCCATAGAAATTACTAATTAGTTAAAAACTTC
AATATTTGATTAATATTATTGTTTTTTTCAATTTTAATGAGTACAATAAA
TGTGATAGTAAAGACTCTTGATGGAAGGAATCATGATTTTTCTGTTCCAG
ATAATATTAATGTTTTGCAATTCAAAGCCATTATTCATCATAAAATGGAT
ATCGCTGTTGAGAGGCAGAGATTGTTGTTCCAGGGTCGTGTGTTACAAGA
CGATAATCTTTTATCATCATATAATGTTGCTGGAAATGTAATGCATTTGG
TAACGAGGCCTCCACCAAGTCAAAATAGACTAGCTCCAGACACAACCACT
ACTGAAAGAGAAGAAAATTCTGATATTAATCGAGATCAAATTAGAAATAT
TTTGAGTGATGTTTTTGGTAACATTGCCGAATTAAGCAATCCTATGGGTG
TTTCTGTTAATAATGAAGGAAATAGAGTAGATATTACTGTAAATATGCCA
AGTTCTAATAGATTAAGTCTTGCAAGATTGCGGCAGAATTATATTCATAG
ATTAATGTCTCAAGCTAGAGAATTGCTAGATAATCTTAGAGATCCGAATC
TACCAGCGCCTCGCCCAGATCGTGAAAGACTACATCAAGCAAATGCATAT
GATTTGGGAGCAAATGAAGAAAGAATCACTGCAGTGTCAGCTCAACCATT
ACCAATTCATAACTTAGCCGACATGGTCCACAGCGTCCGAGATATGTGGC
GAGATGCCGATCCACAATTGGAATTATGGGAAAATGTATTGCGACGACAA
AATCTGCCAGACAATATTGCAAATAATGATCGGGAAATGCAACGGATGCA
TGATTCAGCTAGTAGATACATTCATCTGTTCTCTCACATGTTGCACATAA
TGAGTGATTATTTGGTGGAATTCCAATACAATGCCAATACGAGAGTTATG
CCAGTTCACAGAAATGCAAATGAAACCTCAACACCAACCAACGAGGCTGC
TACAAGCACCTCAATTGATGAGAACATTACCCCGCTAACTGGTGCATTCG
GTGAAAGCGCTTTACCTCAATCAGAAGGATCGACTGACGGCAACGCATCG
ACCGCTACTAACACATCTGACACAAATCTTGATAGCAACGATCGCAGTCG
ATATCTATACGTTTTTTCGGAGATGCCAGCCCAATTGTTTCAAGTGAGAT
TAGATGTTGATTCAACAATTCAGATGCCAGCTACGAGTGGTCAAACACAC
GTGTTTGCAACAAGAACTACTGAACGCGCCTCTCAGCCGGGTTCCGATCC
AGTCACCACTAGCACTGCGCCTAGTCAGCCGAATCCGACCACCGAAACAC
CGACCGGAACTACTCGGGCTCGCCGTCAAGGAGTACCGCCACAATTCCCT
GGACCCGCAACAATGGAGAATCTTTTTCGGTCGACATTGCATGACTCGTT
TGTCCATTCAACCGCGACTAACTCCATGTCGGGTCAAGCGAGTGGGGCGT
CACGGATCAACGGTGCCAATCCCCGCACGACTATAAGAAATGGGTCTCCA
TTGATTGAGAACGTCGATCCATATGTAAGATGCCAATCGAGACATTTTCA
GAATCCCTCGAATCTCAGGACTGGAGCGGTTATATCGACATTTGGAGGCA
TTCGGTTTAGGGACAGCTCTAGAAGCCGGCCTCGCCCGACTGAGTCACCG
GTGGCCACTACTACTACTACCACCACCACCACGGTGCCGTCTACCACTGC
CAATACGACTACCAATGTGACCGATGCCAGAGAAGGGGATCCGGTCCGCA
CATTTATTGGTGGATTGATCAATTCAATATTCTCATCGTCAGGTGACACG
ATGCAAGCAGCTCCAAGCACCACTAATGATAACGCCTCCTCATCACAACC
AGCTGCTACCAATCCGCCTATTATTACTCCTTCGTTTCCTCAAAACGATC
TGACGAGATTGTTACAATCGTTTACCAGTACTGGGACGCTCAATCTCGAC
ATGCCTCTCGGACAGCTGTTTCCAGAGATATTCAATAACCAAGACAGCGA
CACCGAGAACAATATCACCAATCAGATCATTCAGCTGGTTGTCAACCGGC
TGACCATGATCGATATCACACAAATCATTCACGGAGTCTATCACCCGTTG
AACGTGTTGCGGATGCCATTGCAGGACTTACTGCTGGCTCACCAGATACA
ATGCAACGGATCGAGAGAGCAGATGTTGGATCACGTTGTCTTGGATTTAC
AGTCCTTCAACCGGGTCTACATGTCGATATTTGAGCGATTGAGAACCGAG
GACCAAGTCGATGGACTGAGCGAGGATGCTCGAAGGAATTTCAATGAAAA
TATCGATATTCACAAAACGATAAATAATCTCAACCGACACCATGCACGAG
TTGTTGTCGACATGATCCTCAGAAGCCCAACTGACATCGGTTTCGGTCAG
TTACTAATGAATAGCATGTTTTCCCATCACAACGAGACCTTGGCACTGTT
GGATATTATATGCAATGATAATGACGAGTTGAGACAATATATGGTCCGAG
CGTTTATTGATTCGCTCATGGCATCCACTGATGATTCCAATGATTACCTA
TCACAATTTATCAACCAGAGCCGAAATACATTTGGATTGGATTGGCTATT
TGAAAATGGAAATTCCCGATTATTCAGACGGCCTGAGCAGTTGTCGGAGT
TGAGGGAAACGGTTTTGTCTGCATATGTTGTGTTCTTGGATCTGGAAGCG
GATGGAAGCGCGTTGAAGGCTCCTGGTAACAATAATTTGATTGCCGACAA
TACCGACCAGATAATGGCAAATGTTGATTCGCTGGAAGATATGGTTGATT
CATTGGCTGGTAGCATTATCAAGTCGAACTCAATAACAGATGTTACCAAT
CCTCTCGATGGCGTCGTGGCTGAATTCATGGATGTCTGTTCTTATCAACA
GGATTCCGTGAGTCATGCCCCAAACGGCAACTCTTGGCAATCAGTTCTTC
CTCCCGATTGGATAGACATTGTATCCCGTGACTCGAACGTCCCAGTTGAC
CAACAGACAATAGGAATCCCTTATAGTGATGCCTACGTGTCCGGAATGCC
TCCTAAACGAAGGAAAATAATTCTCAATCAACGACATCGATCGGTTCAAC
AAGTGCCAGAACTGATGCACGATTGCATTGATCATGCTATTCAATCGGCC
GGTGTCGTTACCAATGAATCGCTCGACACCCAACAGTTCCCATTAGGTCT
CACCAATTCCTTCCAGGAACTGGTCTCAGATCACGTGAGAAACAGATTAG
TCGAGGAAAGTTTTAATTTTCCCAATGACCGTTTCCCGTCTGTTGAACAG
AATTTCAATAGAAAGAAGCGACCAGATGATGATAAGAACAGCAATTAGAC
CGATTTCAGCCAATAATCTGTTCTGTTCACTTATGCTTGGAATTTGCATA
TATACGTCGTTTGCAATACAATTAATTGGTCGGCG
back to top

protein sequence of SMED30024653-orf-1

>SMED30024653-orf-1 ID=SMED30024653-orf-1|Name=SMED30024653-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1104bp
MSTINVIVKTLDGRNHDFSVPDNINVLQFKAIIHHKMDIAVERQRLLFQG
RVLQDDNLLSSYNVAGNVMHLVTRPPPSQNRLAPDTTTTEREENSDINRD
QIRNILSDVFGNIAELSNPMGVSVNNEGNRVDITVNMPSSNRLSLARLRQ
NYIHRLMSQARELLDNLRDPNLPAPRPDRERLHQANAYDLGANEERITAV
SAQPLPIHNLADMVHSVRDMWRDADPQLELWENVLRRQNLPDNIANNDRE
MQRMHDSASRYIHLFSHMLHIMSDYLVEFQYNANTRVMPVHRNANETSTP
TNEAATSTSIDENITPLTGAFGESALPQSEGSTDGNASTATNTSDTNLDS
NDRSRYLYVFSEMPAQLFQVRLDVDSTIQMPATSGQTHVFATRTTERASQ
PGSDPVTTSTAPSQPNPTTETPTGTTRARRQGVPPQFPGPATMENLFRST
LHDSFVHSTATNSMSGQASGASRINGANPRTTIRNGSPLIENVDPYVRCQ
SRHFQNPSNLRTGAVISTFGGIRFRDSSRSRPRPTESPVATTTTTTTTTV
PSTTANTTTNVTDAREGDPVRTFIGGLINSIFSSSGDTMQAAPSTTNDNA
SSSQPAATNPPIITPSFPQNDLTRLLQSFTSTGTLNLDMPLGQLFPEIFN
NQDSDTENNITNQIIQLVVNRLTMIDITQIIHGVYHPLNVLRMPLQDLLL
AHQIQCNGSREQMLDHVVLDLQSFNRVYMSIFERLRTEDQVDGLSEDARR
NFNENIDIHKTINNLNRHHARVVVDMILRSPTDIGFGQLLMNSMFSHHNE
TLALLDIICNDNDELRQYMVRAFIDSLMASTDDSNDYLSQFINQSRNTFG
LDWLFENGNSRLFRRPEQLSELRETVLSAYVVFLDLEADGSALKAPGNNN
LIADNTDQIMANVDSLEDMVDSLAGSIIKSNSITDVTNPLDGVVAEFMDV
CSYQQDSVSHAPNGNSWQSVLPPDWIDIVSRDSNVPVDQQTIGIPYSDAY
VSGMPPKRRKIILNQRHRSVQQVPELMHDCIDHAIQSAGVVTNESLDTQQ
FPLGLTNSFQELVSDHVRNRLVEESFNFPNDRFPSVEQNFNRKKRPDDDK
NSN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005829cytosol
GO:0071818BAT3 complex
Vocabulary: biological process
TermDefinition
GO:0006325chromatin organization
GO:0010498proteasomal protein catabolic process
GO:0001822kidney development
GO:0006511ubiquitin-dependent protein catabolic process
GO:0006810transport
GO:0006915apoptotic process
GO:0007130synaptonemal complex assembly
GO:0007283spermatogenesis
GO:0007420brain development
GO:0009790embryo development
GO:0016569covalent chromatin modification
GO:0018393internal peptidyl-lysine acetylation
GO:0030324lung development
GO:0030433ubiquitin-dependent ERAD pathway
GO:0032435negative regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0042981regulation of apoptotic process
GO:0045861negative regulation of proteolysis
GO:0050821protein stabilization
GO:0070059intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress
GO:0071712ER-associated misfolded protein catabolic process
GO:0071816tail-anchored membrane protein insertion into ER membrane
Vocabulary: INTERPRO
TermDefinition
IPR000626Ubiquitin-like_dom
IPR029071Ubiquitin-like_domsf
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0031593polyubiquitin binding
GO:0043022ribosome binding
GO:0070628proteasome binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000626Ubiquitin-like domainSMARTSM00213ubq_7coord: 4..74
e-value: 3.5E-16
score: 69.7
IPR000626Ubiquitin-like domainPFAMPF00240ubiquitincoord: 7..75
e-value: 4.2E-15
score: 55.3
IPR000626Ubiquitin-like domainPROSITEPS50053UBIQUITIN_2coord: 4..64
score: 16.429
NoneNo IPR availableGENE3DG3DSA:3.10.20.90coord: 1..87
e-value: 6.5E-23
score: 82.2
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 533..565
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 394..430
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1087..1103
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 71..96
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 327..348
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 586..607
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 524..567
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1083..1103
NoneNo IPR availablePANTHERPTHR15204:SF0LARGE PROLINE-RICH PROTEIN BAG6coord: 2..1090
NoneNo IPR availablePANTHERPTHR15204SCYTHE/BAT3coord: 2..1090
NoneNo IPR availableCDDcd01809Ubl_BAG6coord: 4..74
e-value: 2.95062E-26
score: 100.882
IPR029071Ubiquitin-like domain superfamilySUPERFAMILYSSF54236Ubiquitin-likecoord: 2..90