Calreticulin

Overview
NameCalreticulin
Smed IDSMED30024652
Length (bp)1338
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024652

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
reproductive organSMED30024652SMESG000039107.1 Contig47824newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30024652SMESG000039107.1 Contig47824uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Calreticulin vs. Ensembl Human
Match: CALR (calreticulin [Source:HGNC Symbol;Acc:HGNC:1455])

HSP 1 Score: 386.341 bits (991), Expect = 3.872e-131
Identity = 185/323 (57.28%), Postives = 233/323 (72.14%), Query Frame = 2
Query:  107 RWVESTYRGIDQGKFQLGTGKHFGDYWKERGLQTSQNSKFYGIATKFKTPFNNSLKPLVIQYQVKMDEYVQCGGGYIKLLGTDFDPLSFHGHTPYKIMFGPDICGTNKKMVHVILNYKEKYYLTKKDIRCMDDKFSHLYTLIIFPNNTYSVLIDNNQVEGGKLEDDWDLLPPKKVKDPNAMKPVDWVDNDKIDDPNDFKPEEWDQPKTIPDNTVKKPNKWDDEVDGVWEPPLISNPNFKGEWKPKKIDNPNYKGPWIHPEIDNPHYYLDHNLYLQTSIGGVGFDIWQVVSGTIFDNILLTDDPETALRIGETTWRVALAEEKK 1075
            RW+ES ++  D GKF L +GK +GD  K++GLQTSQ+++FY ++  F+ PF+N  + LV+Q+ VK ++ + CGGGY+KL     D    HG + Y IMFGPDICG   K VHVI NYK K  L  KDIRC DD+F+HLYTLI+ P+NTY V IDN+QVE G LEDDWD LPPKK+KDP+A KP DW +  KIDDP D KPE+WD+P+ IPD   KKP  WD+E+DG WEPP+I NP +KGEWKP++IDNP+YKG WIHPEIDNP Y  D ++Y   + G +G D+WQV SGTIFDN L+T+D   A   G  TW V  A EK+
Sbjct:   36 RWIESKHKS-DFGKFVLSSGKFYGDEEKDKGLQTSQDARFYALSASFE-PFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPNSLDQTDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDASKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQ 356          
BLAST of Calreticulin vs. Ensembl Human
Match: CALR (calreticulin [Source:HGNC Symbol;Acc:HGNC:1455])

HSP 1 Score: 247.284 bits (630), Expect = 2.686e-79
Identity = 118/183 (64.48%), Postives = 140/183 (76.50%), Query Frame = 2
Query:  404 GPDICGTNKKMVHVILNYKEKYYLTKKDIRCMDDKFSHLYTLIIFPNNTYSVLIDNNQVEGGKLEDDWDLLPPKKVKDPNAMKPVDWVDNDKIDDPNDFKPEEWDQPKTIPDNTVKKPNKWDDEVDGVWEPPLISNPNFKGEWKPKKIDNPNYKGPWIHPEIDNPHYYLDHNLYLQTSIGGVG 952
            GPDICG   K VHVI NYK K  L  KDIRC DD+F+HLYTLI+ P+NTY V IDN+QVE G LEDDWD LPPKK+KDP+A KP DW +  KIDDP D KPE+WD+P+ IPD   KKP  WD+E+DG WEPP+I NP +KGEWKP++IDNP+YKG WIHPEIDNP Y  D ++Y   + G +G
Sbjct:   65 GPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDASKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDPSIYAYDNFGVLG 247          
BLAST of Calreticulin vs. Ensembl Human
Match: CALR3 (calreticulin 3 [Source:HGNC Symbol;Acc:HGNC:20407])

HSP 1 Score: 247.284 bits (630), Expect = 1.929e-77
Identity = 135/314 (42.99%), Postives = 191/314 (60.83%), Query Frame = 2
Query:  107 RWVESTYRGIDQGKFQLGTGKHFGDYWKERGLQTSQNSKFYGIATKFKTPFNNSLKPLVIQYQVKMDEYVQCGGGYIKLLGTDFDPLSFHGHTPYKIMFGPDICGTNKKMVHVILNYKEKYYLTKKDIRCMDDKFSHLYTLIIFPNNTYSVLIDNNQVEGGKLEDDWDLLPPKKVKDPNAMKPVDWVDNDKIDDPNDFKPEEWDQPKTIPDNTVKKPNKWDDEVDGVWEPPLISNPNFKGEWKPKKIDNPNYKGPWIHPEIDNPHYYLDHNLYLQTSIGGVGFDIWQVVSGTIFDNILLTDDPETALRIGETTW 1048
            RW++ST      G F+L +GK +G   K++GLQT+QN +FY I+ +FK PF+N  K LVIQY VK ++ + CGGGYIK+   D D  + +G + Y IMFGPDICG + K VHVIL++K KY+  KK IRC  D F+HLYTLI+ P+ +Y V ID   +E G +E DW+L   KK   P   K  DW      +   D K ++W+  K   D +  K + W+ ++DG W  P++  P ++   KP+ I    +K  W+H ++ N  Y   ++L    +IG +G ++WQV SGTIFDN L+TDD E A   G+ TW
Sbjct:   36 RWLQST-NDSRFGHFRLSSGKFYGHKEKDKGLQTTQNGRFYAISARFK-PFSNKGKTLVIQYTVKHEQKMDCGGGYIKVFPADIDQKNLNGKSQYYIMFGPDICGFDIKKVHVILHFKNKYHENKKLIRCKVDGFTHLYTLILRPDLSYDVKIDGQSIESGSIEYDWNLTSLKKETSPAESK--DW------EQTKDNKAQDWE--KHFLDASTSKQSDWNGDLDGDWPAPMLQKPPYQDGLKPEGI----HKDVWLHRKMKNTDYLTQYDLSEFENIGAIGLELWQVRSGTIFDNFLITDDEEYADNFGKATW 333          
BLAST of Calreticulin vs. Ensembl Human
Match: CLGN (calmegin [Source:HGNC Symbol;Acc:HGNC:2060])

HSP 1 Score: 202.601 bits (514), Expect = 3.932e-58
Identity = 118/339 (34.81%), Postives = 177/339 (52.21%), Query Frame = 2
Query:  191 ERGLQTSQNSKFYGIATKFKTPFNNSLKPLVIQYQVKMDEYVQCGGGYIKLLGTDFDPL--SFHGHTPYKIMFGPDICGTNKKMVHVILNYK-------EKYYLTKKDI---RCMDDKFSHLYTLIIFPNNTYSVLIDNNQVEGGKLEDDW--DLLPPKKVKDPNAMKPVDWVDNDKIDDPNDFKPEEWDQ---------------------PKTIPDNTVKKPNKWDDEVDGVWE-----------------PPLISNPNFKGEWKPKKIDNPNYKGPWIHPEIDNPHYYLDHNLYLQTSIGGVGFDIWQVVSGTIFDNILLTDDPETALRIGETTWR 1051
            +RGL     +K + I+     PF  + KPL++QY+V   + + CGG YIKLL    D +  +F+  T Y IMFGPD CG + K+ H I  +K       E+ +    D+   +   D+ +HLYTL++ P++T+ VL+D   V  G L +D    + PPK+++DPN  KP +W +  KI DP+  KPE+WD+                     PK IPD   +KP+ W+++ DG WE                 PP+I NP +KG W+P  +DNPNY+G W   +I NP Y+ D + +L TS   +G ++W + S   FDN ++  + E A       WR
Sbjct:  108 DRGLVLKSRAKHHAISAVLAKPFIFADKPLIVQYEVNFQDGIDCGGAYIKLLADTDDLILENFYDKTSYIIMFGPDKCGEDYKL-HFIFRHKHPKTGVFEEKHAKPPDVDLKKFFTDRKTHLYTLVMNPDDTFEVLVDQTVVNKGSLLEDVVPPIKPPKEIEDPNDKKPEEWDERAKIPDPSAVKPEDWDESEPAQIEDSSVVKPAGWLDDEPKFIPDPNAEKPDDWNEDTDGEWEAPQILNPACRIGCGEWKPPMIDNPKYKGVWRPPLVDNPNYQGIWSPRKIPNPDYFEDDHPFLLTSFSALGLELWSMTSDIYFDNFIICSEKEVADHWAADGWR 445          
BLAST of Calreticulin vs. Ensembl Human
Match: CLGN (calmegin [Source:HGNC Symbol;Acc:HGNC:2060])

HSP 1 Score: 202.601 bits (514), Expect = 3.932e-58
Identity = 118/339 (34.81%), Postives = 177/339 (52.21%), Query Frame = 2
Query:  191 ERGLQTSQNSKFYGIATKFKTPFNNSLKPLVIQYQVKMDEYVQCGGGYIKLLGTDFDPL--SFHGHTPYKIMFGPDICGTNKKMVHVILNYK-------EKYYLTKKDI---RCMDDKFSHLYTLIIFPNNTYSVLIDNNQVEGGKLEDDW--DLLPPKKVKDPNAMKPVDWVDNDKIDDPNDFKPEEWDQ---------------------PKTIPDNTVKKPNKWDDEVDGVWE-----------------PPLISNPNFKGEWKPKKIDNPNYKGPWIHPEIDNPHYYLDHNLYLQTSIGGVGFDIWQVVSGTIFDNILLTDDPETALRIGETTWR 1051
            +RGL     +K + I+     PF  + KPL++QY+V   + + CGG YIKLL    D +  +F+  T Y IMFGPD CG + K+ H I  +K       E+ +    D+   +   D+ +HLYTL++ P++T+ VL+D   V  G L +D    + PPK+++DPN  KP +W +  KI DP+  KPE+WD+                     PK IPD   +KP+ W+++ DG WE                 PP+I NP +KG W+P  +DNPNY+G W   +I NP Y+ D + +L TS   +G ++W + S   FDN ++  + E A       WR
Sbjct:  108 DRGLVLKSRAKHHAISAVLAKPFIFADKPLIVQYEVNFQDGIDCGGAYIKLLADTDDLILENFYDKTSYIIMFGPDKCGEDYKL-HFIFRHKHPKTGVFEEKHAKPPDVDLKKFFTDRKTHLYTLVMNPDDTFEVLVDQTVVNKGSLLEDVVPPIKPPKEIEDPNDKKPEEWDERAKIPDPSAVKPEDWDESEPAQIEDSSVVKPAGWLDDEPKFIPDPNAEKPDDWNEDTDGEWEAPQILNPACRIGCGEWKPPMIDNPKYKGVWRPPLVDNPNYQGIWSPRKIPNPDYFEDDHPFLLTSFSALGLELWSMTSDIYFDNFIICSEKEVADHWAADGWR 445          
BLAST of Calreticulin vs. Ensembl Celegans
Match: crt-1 (Calreticulin [Source:UniProtKB/Swiss-Prot;Acc:P27798])

HSP 1 Score: 351.673 bits (901), Expect = 2.583e-118
Identity = 170/301 (56.48%), Postives = 215/301 (71.43%), Query Frame = 2
Query:  107 RWVESTYRGIDQGKFQLGTGKHFGDYWKERGLQTSQNSKFYGIATKFKTPFNNSLKPLVIQYQVKMDEYVQCGGGYIKLLGTDFDPLSFHGHTPYKIMFGPDICGTNKKMVHVILNYKEKYYLTKKDIRCMDDKFSHLYTLIIFPNNTYSVLIDNNQVEGGKLEDDWDLLPPKKVKDPNAMKPVDWVDNDKIDDPNDFKPEEWDQPKTIPDNTVKKPNKWDDEVDGVWEPPLISNPNFKGEWKPKKIDNPNYKGPWIHPEIDNPHYYLDHNLYLQTSIGGVGFDIWQVVSGTIFDNILLTD 1009
            RWV+S ++  D G F+L  GK F    +++G+QTSQ++KFY  A KF   F+N  K LVIQY VK ++ + CGGGY+K++  D D   FHG TPY +MFGPDICG  ++ VHVILNYK +  L KK+I C  D+ +HLYTLI+  +NTY V ID    + G LE+DWDLLP KK+KDP+A KP DW + + IDD  D KPE+W++P+ IPD   KKP  WDDE+DG WEPP+I NP +KGEWKPK+I NP YKG WIHPEI+NP Y  D  LY   S G +GFD+WQV SGTIFDNI++TD
Sbjct:   31 RWVQSKHKD-DFGAFKLSAGKFFDVESRDQGIQTSQDAKFYSRAAKFDKDFSNKGKTLVIQYTVKHEQGIDCGGGYVKVMRADADLGDFHGETPYNVMFGPDICGPTRR-VHVILNYKGENKLIKKEITCKSDELTHLYTLILNSDNTYEVKIDGESAQTGSLEEDWDLLPAKKIKDPDAKKPEDWDEREYIDDAEDAKPEDWEKPEHIPDPDAKKPEDWDDEMDGEWEPPMIDNPEYKGEWKPKQIKNPAYKGKWIHPEIENPEYTPDDELYSYESWGAIGFDLWQVKSGTIFDNIIITD 329          
BLAST of Calreticulin vs. Ensembl Celegans
Match: crt-1 (Calreticulin [Source:UniProtKB/Swiss-Prot;Acc:P27798])

HSP 1 Score: 351.673 bits (901), Expect = 2.583e-118
Identity = 170/301 (56.48%), Postives = 215/301 (71.43%), Query Frame = 2
Query:  107 RWVESTYRGIDQGKFQLGTGKHFGDYWKERGLQTSQNSKFYGIATKFKTPFNNSLKPLVIQYQVKMDEYVQCGGGYIKLLGTDFDPLSFHGHTPYKIMFGPDICGTNKKMVHVILNYKEKYYLTKKDIRCMDDKFSHLYTLIIFPNNTYSVLIDNNQVEGGKLEDDWDLLPPKKVKDPNAMKPVDWVDNDKIDDPNDFKPEEWDQPKTIPDNTVKKPNKWDDEVDGVWEPPLISNPNFKGEWKPKKIDNPNYKGPWIHPEIDNPHYYLDHNLYLQTSIGGVGFDIWQVVSGTIFDNILLTD 1009
            RWV+S ++  D G F+L  GK F    +++G+QTSQ++KFY  A KF   F+N  K LVIQY VK ++ + CGGGY+K++  D D   FHG TPY +MFGPDICG  ++ VHVILNYK +  L KK+I C  D+ +HLYTLI+  +NTY V ID    + G LE+DWDLLP KK+KDP+A KP DW + + IDD  D KPE+W++P+ IPD   KKP  WDDE+DG WEPP+I NP +KGEWKPK+I NP YKG WIHPEI+NP Y  D  LY   S G +GFD+WQV SGTIFDNI++TD
Sbjct:   31 RWVQSKHKD-DFGAFKLSAGKFFDVESRDQGIQTSQDAKFYSRAAKFDKDFSNKGKTLVIQYTVKHEQGIDCGGGYVKVMRADADLGDFHGETPYNVMFGPDICGPTRR-VHVILNYKGENKLIKKEITCKSDELTHLYTLILNSDNTYEVKIDGESAQTGSLEEDWDLLPAKKIKDPDAKKPEDWDEREYIDDAEDAKPEDWEKPEHIPDPDAKKPEDWDDEMDGEWEPPMIDNPEYKGEWKPKQIKNPAYKGKWIHPEIENPEYTPDDELYSYESWGAIGFDLWQVKSGTIFDNIIITD 329          
BLAST of Calreticulin vs. Ensembl Celegans
Match: cnx-1 (Calnexin [Source:UniProtKB/Swiss-Prot;Acc:P34652])

HSP 1 Score: 187.193 bits (474), Expect = 1.092e-52
Identity = 116/345 (33.62%), Postives = 165/345 (47.83%), Query Frame = 2
Query:  197 GLQTSQNSKFYGIATKFKTPFNNSLKPLVIQYQVKMDEYVQCGGGYIKLL--GTDFDPLSFHGHTPYKIMFGPDICGTNKKMVHVILNYKEKYYLTKKDIRCM----------DDKFSHLYTLIIFPNNTYSVLIDNNQVEGGKLEDDWD--LLPPKKVKDPNAMKPVDWVDNDKIDDPNDFKPEEWDQ--PKTIPDNTV-------------------KKPNKWDDEVDGVWEPPLI-------------------SNPNFKGEWKPKKIDNPNYKGPWIHPEIDNPHYYLDHNLYLQTSIGGVGFDIWQVVSGTIFDNILLTDDPETALRIGETTWRVALAEE 1069
            GL     ++ + IA K  TPF       V+QY +K +E  +CGGGY+KLL  G + D  +F   T Y IMFGPD CG   K VH+I  YK     T  +              DD  +HL+TL++ P   YSV +D   +  G +  D    L PPK++ D   +KPVDW + + I+D +  KP++WD+  P+++ D                      KKP  WD+++DG WE PLI                    NP +KG+W   KI NP +KG W    IDNP+Y+          I  VG ++W +    +FDNIL+T   E +  + + T+ V   EE
Sbjct:  111 GLIVKTKARHHAIAAKLNTPFAFDANTFVVQYDIKFEEGQECGGGYLKLLSEGAEKDLANFQDKTAYTIMFGPDKCGATGK-VHLIFRYKNPINGTISEYHANQPTTIGSTYWDDHNTHLFTLVVKPTGEYSVSVDGKSLYYGNMMSDVTPALTPPKQIFDETDLKPVDWDERENIEDESAVKPDDWDENEPQSVVDEAATKPYDWNEEENELIADPEAKKPQDWDEDMDGSWEAPLIDNPACKGLSGCGTWKAPTIKNPKYKGKWIRPKISNPAFKGKWTARLIDNPNYFEPKPFAGLAPITAVGIEMWTMSENILFDNILITSSEEDSSDVAKQTFYVKQKEE 454          
BLAST of Calreticulin vs. Ensembl Celegans
Match: cnx-1 (Calnexin [Source:UniProtKB/Swiss-Prot;Acc:P34652])

HSP 1 Score: 135.576 bits (340), Expect = 4.507e-35
Identity = 89/276 (32.25%), Postives = 128/276 (46.38%), Query Frame = 2
Query:  398 MFGPDICGTNKKMVHVILNYKEKYYLTKKDIRCM----------DDKFSHLYTLIIFPNNTYSVLIDNNQVEGGKLEDDWD--LLPPKKVKDPNAMKPVDWVDNDKIDDPNDFKPEEWDQ--PKTIPDNTV-------------------KKPNKWDDEVDGVWEPPLI-------------------SNPNFKGEWKPKKIDNPNYKGPWIHPEIDNPHYYLDHNLYLQTSIGGVGFDIWQVVSGTIFDNILLTDDPETALRIGETTWRVALAEE 1069
            MFGPD CG   K VH+I  YK     T  +              DD  +HL+TL++ P   YSV +D   +  G +  D    L PPK++ D   +KPVDW + + I+D +  KP++WD+  P+++ D                      KKP  WD+++DG WE PLI                    NP +KG+W   KI NP +KG W    IDNP+Y+          I  VG ++W +    +FDNIL+T   E +  + + T+ V   EE
Sbjct:    1 MFGPDKCGATGK-VHLIFRYKNPINGTISEYHANQPTTIGSTYWDDHNTHLFTLVVKPTGEYSVSVDGKSLYYGNMMSDVTPALTPPKQIFDETDLKPVDWDERENIEDESAVKPDDWDENEPQSVVDEAATKPYDWNEEENELIADPEAKKPQDWDEDMDGSWEAPLIDNPACKGLSGCGTWKAPTIKNPKYKGKWIRPKISNPAFKGKWTARLIDNPNYFEPKPFAGLAPITAVGIEMWTMSENILFDNILITSSEEDSSDVAKQTFYVKQKEE 275          
BLAST of Calreticulin vs. Ensembl Fly
Match: Calr (gene:FBgn0005585 transcript:FBtr0334618)

HSP 1 Score: 373.244 bits (957), Expect = 1.805e-126
Identity = 181/340 (53.24%), Postives = 227/340 (66.76%), Query Frame = 2
Query:  110 WVESTYRGIDQGKFQLGTGKHFGDYWKERGLQTSQNSKFYGIATKFKTPFNNSLKPLVIQYQVKMDEYVQCGGGYIKLLGTDFDPLSFHGHTPYKIMFGPDICGTNKKMVHVILNYKEKYYLTKKDIRCMDDKFSHLYTLIIFPNNTYSVLIDNNQVEGGKLEDDWDLLPPKKVKDPNAMKPVDWVDNDKIDDPNDFKPEEWDQPKTIPDNTVKKPNKWDDEVDGVWEPPLISNPNFKGEWKPKKIDNPNYKGPWIHPEIDNPHYYLDHNLYLQTSIGGVGFDIWQVVSGTIFDNILLTDDPETALRIGETTWRVALAEEK---KNFEFQRNHELAEQRK 1120
            W+ S + G + GKF L  G  + D   ++G+QTSQ+++FY  + KF   F+N  KPLV+Q+ VK ++ + CGGGY+KL     D    HG +PY+IMFGPDICG   K VHVI +YK K +L  KDIRC DD ++H YTLI+ P+NTY VLIDN +VE G LEDDWD L PKK+KDP A KP DW D   I DP+D KPE+WD+P+ IPD    KP  WDDE+DG WEPP+I NP FKGEW+PK++DNPNYKG W HPEI NP Y  D  LYL+  I  +GFD+WQV SGTIFDN+L+TDD E A +           E+K      E QR  +  E +K
Sbjct:   36 WIYSKHPGKEFGKFVLTPGTFYNDAEADKGIQTSQDARFYAASRKFDG-FSNEDKPLVVQFSVKHEQNIDCGGGYVKLFDCSLDQTDMHGESPYEIMFGPDICGPGTKKVHVIFSYKGKNHLISKDIRCKDDVYTHFYTLIVRPDNTYEVLIDNEKVESGNLEDDWDFLAPKKIKDPTATKPEDWDDRATIPDPDDKKPEDWDKPEHIPDPDATKPEDWDDEMDGEWEPPMIDNPEFKGEWQPKQLDNPNYKGAWEHPEIANPEYVPDDKLYLRKEICTLGFDLWQVKSGTIFDNVLITDDVELAAKAAAEVKNTQAGEKKMKEAQDEVQRKKDEEEAKK 374          
BLAST of Calreticulin vs. Ensembl Fly
Match: Calr (gene:FBgn0005585 transcript:FBtr0082103)

HSP 1 Score: 373.244 bits (957), Expect = 1.805e-126
Identity = 181/340 (53.24%), Postives = 227/340 (66.76%), Query Frame = 2
Query:  110 WVESTYRGIDQGKFQLGTGKHFGDYWKERGLQTSQNSKFYGIATKFKTPFNNSLKPLVIQYQVKMDEYVQCGGGYIKLLGTDFDPLSFHGHTPYKIMFGPDICGTNKKMVHVILNYKEKYYLTKKDIRCMDDKFSHLYTLIIFPNNTYSVLIDNNQVEGGKLEDDWDLLPPKKVKDPNAMKPVDWVDNDKIDDPNDFKPEEWDQPKTIPDNTVKKPNKWDDEVDGVWEPPLISNPNFKGEWKPKKIDNPNYKGPWIHPEIDNPHYYLDHNLYLQTSIGGVGFDIWQVVSGTIFDNILLTDDPETALRIGETTWRVALAEEK---KNFEFQRNHELAEQRK 1120
            W+ S + G + GKF L  G  + D   ++G+QTSQ+++FY  + KF   F+N  KPLV+Q+ VK ++ + CGGGY+KL     D    HG +PY+IMFGPDICG   K VHVI +YK K +L  KDIRC DD ++H YTLI+ P+NTY VLIDN +VE G LEDDWD L PKK+KDP A KP DW D   I DP+D KPE+WD+P+ IPD    KP  WDDE+DG WEPP+I NP FKGEW+PK++DNPNYKG W HPEI NP Y  D  LYL+  I  +GFD+WQV SGTIFDN+L+TDD E A +           E+K      E QR  +  E +K
Sbjct:   36 WIYSKHPGKEFGKFVLTPGTFYNDAEADKGIQTSQDARFYAASRKFDG-FSNEDKPLVVQFSVKHEQNIDCGGGYVKLFDCSLDQTDMHGESPYEIMFGPDICGPGTKKVHVIFSYKGKNHLISKDIRCKDDVYTHFYTLIVRPDNTYEVLIDNEKVESGNLEDDWDFLAPKKIKDPTATKPEDWDDRATIPDPDDKKPEDWDKPEHIPDPDATKPEDWDDEMDGEWEPPMIDNPEFKGEWQPKQLDNPNYKGAWEHPEIANPEYVPDDKLYLRKEICTLGFDLWQVKSGTIFDNVLITDDVELAAKAAAEVKNTQAGEKKMKEAQDEVQRKKDEEEAKK 374          
BLAST of Calreticulin vs. Ensembl Fly
Match: Cnx99A (gene:FBgn0015622 transcript:FBtr0334873)

HSP 1 Score: 199.904 bits (507), Expect = 1.802e-57
Identity = 128/369 (34.69%), Postives = 179/369 (48.51%), Query Frame = 2
Query:  197 GLQTSQNSKFYGIATKFKTPFN-NSLKPLVIQYQVKMDEYVQCGGGYIKLL--GTDFDPL-SFHGHTPYKIMFGPDICGTNKKMVHVILNYKEKYYLTKKDIRC----------MDDKFSHLYTLIIFPNNTYSVLIDNNQVEGGKLEDDWD--LLPPKKVKDPNAMKPVDWVDNDKIDDPNDFKPEEWDQ---------------------PKTIPDNTVKKPNKWDDEVDGVWEPPL-------------------ISNPNFKGEWKPKKIDNPNYKGPWIHPEIDNPHYYLDHNLYLQTSIGGVGFDIWQVVSGTIFDNILLTDDPETALRIGETTW---RVALAEEKKNFEFQRNHELAEQRKYK 1126
            GL     +K   IA   + PF   S KPLV+QY+V + E  +CGG Y+KLL  G D + L +F+  TPY IMFGPD CG + KM H I  +      T  +  C            DK  HLY L++ P+N++ + +D+  +  G L  D+   + PP ++ DPN  KP  W + +KI DP   KPE+WD+                     P  I D T  KP  WD E+DG WE PL                   I NPN+KG+W+   I+NPNY+G W   +I NP ++ D   +  T I  VG ++W + S  +FDN+++TDD E A      ++   R  +  E K F     H L  +  YK
Sbjct:  124 GLVLKSKAKHAAIAAPLRKPFEFKSDKPLVVQYEVTLQEGQECGGSYLKLLSAGKDTEQLKAFNDKTPYTIMFGPDKCGNDVKM-HFIFRHVNPINGTITEKHCNKPKNRLEEPFKDKLPHLYQLVVRPDNSFEIRVDHKIINEGSLLTDFKPPVNPPAEIDDPNDHKPESWDEREKIPDPTAHKPEDWDEDAPPQLPDTDAVMPNGWLEDEPDMIFDPTATKPEDWDAEIDGEWEAPLVDNPVCEKAPGCGKWKAPLIPNPNYKGKWRAPMIENPNYQGKWAPRKIPNPDFFEDLKPFQMTPISAVGLELWSMSSDILFDNLIITDDVEVARDFAANSFDIKRRYIDRESKTFW----HRLMRRMNYK 487          
BLAST of Calreticulin vs. Ensembl Fly
Match: Cnx99A (gene:FBgn0015622 transcript:FBtr0085438)

HSP 1 Score: 199.519 bits (506), Expect = 2.825e-57
Identity = 120/342 (35.09%), Postives = 170/342 (49.71%), Query Frame = 2
Query:  197 GLQTSQNSKFYGIATKFKTPFN-NSLKPLVIQYQVKMDEYVQCGGGYIKLL--GTDFDPL-SFHGHTPYKIMFGPDICGTNKKMVHVILNYKEKYYLTKKDIRC----------MDDKFSHLYTLIIFPNNTYSVLIDNNQVEGGKLEDDWD--LLPPKKVKDPNAMKPVDWVDNDKIDDPNDFKPEEWDQ---------------------PKTIPDNTVKKPNKWDDEVDGVWEPPL-------------------ISNPNFKGEWKPKKIDNPNYKGPWIHPEIDNPHYYLDHNLYLQTSIGGVGFDIWQVVSGTIFDNILLTDDPETALRIGETTWRV 1054
            GL     +K   IA   + PF   S KPLV+QY+V + E  +CGG Y+KLL  G D + L +F+  TPY IMFGPD CG + KM H I  +      T  +  C            DK  HLY L++ P+N++ + +D+  +  G L  D+   + PP ++ DPN  KP  W + +KI DP   KPE+WD+                     P  I D T  KP  WD E+DG WE PL                   I NPN+KG+W+   I+NPNY+G W   +I NP ++ D   +  T I  VG ++W + S  +FDN+++TDD E A      ++ +
Sbjct:  124 GLVLKSKAKHAAIAAPLRKPFEFKSDKPLVVQYEVTLQEGQECGGSYLKLLSAGKDTEQLKAFNDKTPYTIMFGPDKCGNDVKM-HFIFRHVNPINGTITEKHCNKPKNRLEEPFKDKLPHLYQLVVRPDNSFEIRVDHKIINEGSLLTDFKPPVNPPAEIDDPNDHKPESWDEREKIPDPTAHKPEDWDEDAPPQLPDTDAVMPNGWLEDEPDMIFDPTATKPEDWDAEIDGEWEAPLVDNPVCEKAPGCGKWKAPLIPNPNYKGKWRAPMIENPNYQGKWAPRKIPNPDFFEDLKPFQMTPISAVGLELWSMSSDILFDNLIITDDVEVARDFAANSFDI 464          
BLAST of Calreticulin vs. Ensembl Fly
Match: Cnx99A (gene:FBgn0015622 transcript:FBtr0085437)

HSP 1 Score: 199.519 bits (506), Expect = 2.825e-57
Identity = 120/342 (35.09%), Postives = 170/342 (49.71%), Query Frame = 2
Query:  197 GLQTSQNSKFYGIATKFKTPFN-NSLKPLVIQYQVKMDEYVQCGGGYIKLL--GTDFDPL-SFHGHTPYKIMFGPDICGTNKKMVHVILNYKEKYYLTKKDIRC----------MDDKFSHLYTLIIFPNNTYSVLIDNNQVEGGKLEDDWD--LLPPKKVKDPNAMKPVDWVDNDKIDDPNDFKPEEWDQ---------------------PKTIPDNTVKKPNKWDDEVDGVWEPPL-------------------ISNPNFKGEWKPKKIDNPNYKGPWIHPEIDNPHYYLDHNLYLQTSIGGVGFDIWQVVSGTIFDNILLTDDPETALRIGETTWRV 1054
            GL     +K   IA   + PF   S KPLV+QY+V + E  +CGG Y+KLL  G D + L +F+  TPY IMFGPD CG + KM H I  +      T  +  C            DK  HLY L++ P+N++ + +D+  +  G L  D+   + PP ++ DPN  KP  W + +KI DP   KPE+WD+                     P  I D T  KP  WD E+DG WE PL                   I NPN+KG+W+   I+NPNY+G W   +I NP ++ D   +  T I  VG ++W + S  +FDN+++TDD E A      ++ +
Sbjct:  124 GLVLKSKAKHAAIAAPLRKPFEFKSDKPLVVQYEVTLQEGQECGGSYLKLLSAGKDTEQLKAFNDKTPYTIMFGPDKCGNDVKM-HFIFRHVNPINGTITEKHCNKPKNRLEEPFKDKLPHLYQLVVRPDNSFEIRVDHKIINEGSLLTDFKPPVNPPAEIDDPNDHKPESWDEREKIPDPTAHKPEDWDEDAPPQLPDTDAVMPNGWLEDEPDMIFDPTATKPEDWDAEIDGEWEAPLVDNPVCEKAPGCGKWKAPLIPNPNYKGKWRAPMIENPNYQGKWAPRKIPNPDFFEDLKPFQMTPISAVGLELWSMSSDILFDNLIITDDVEVARDFAANSFDI 464          
BLAST of Calreticulin vs. Ensembl Zebrafish
Match: calr (calreticulin [Source:ZFIN;Acc:ZDB-GENE-030131-4042])

HSP 1 Score: 396.741 bits (1018), Expect = 1.999e-135
Identity = 189/332 (56.93%), Postives = 238/332 (71.69%), Query Frame = 2
Query:  107 RWVESTYRGIDQGKFQLGTGKHFGDYWKERGLQTSQNSKFYGIATKFKTPFNNSLKPLVIQYQVKMDEYVQCGGGYIKLLGTDFDPLSFHGHTPYKIMFGPDICGTNKKMVHVILNYKEKYYLTKKDIRCMDDKFSHLYTLIIFPNNTYSVLIDNNQVEGGKLEDDWDLLPPKKVKDPNAMKPVDWVDNDKIDDPNDFKPEEWDQPKTIPDNTVKKPNKWDDEVDGVWEPPLISNPNFKGEWKPKKIDNPNYKGPWIHPEIDNPHYYLDHNLYLQTSIGGVGFDIWQVVSGTIFDNILLTDDPETALRIGETTWRVALAEEKKNFEFQRNHE 1102
            RWVES ++  D GKF L  GK +GD  K++GLQTSQ++ FY ++ +F   FNN  +PLVIQ+ VK ++ + CGGGYIKL  +D +    HG + Y IMFGPDICG   K VHVI NYK K +L  KDIRC DD++SHLYTLI+ P+NTY V IDN +VE G LE+DWD LP KK+KDP A KP DW + +KIDDP D KPEEWD+P+ IPD   KKP+ WD+E+DG WEPP+++NP++KGEWKP++IDNP YKG W+HPEIDNP Y  D  +Y   SIG +G D+WQV SGTIFDN L+T+DP+ A  +G  TW      EKK  E Q   +
Sbjct:   37 RWVESKHK-TDYGKFVLSAGKFYGDAEKDKGLQTSQDAHFYAMSARFGD-FNNKDQPLVIQFSVKHEQNIDCGGGYIKLFPSDLNQEDMHGDSTYNIMFGPDICGPGTKKVHVIFNYKGKNHLINKDIRCKDDEYSHLYTLIVNPDNTYEVKIDNKKVESGSLEEDWDFLPSKKIKDPEAKKPEDWDEREKIDDPEDQKPEEWDKPENIPDPDAKKPDDWDEEMDGEWEPPMVTNPDYKGEWKPRQIDNPAYKGKWVHPEIDNPEYTADSEIYKYDSIGVIGLDLWQVKSGTIFDNFLITNDPKLAEEVGTETWGATKDAEKKMKESQEEED 366          
BLAST of Calreticulin vs. Ensembl Zebrafish
Match: calr3a (calreticulin 3a [Source:ZFIN;Acc:ZDB-GENE-000208-17])

HSP 1 Score: 378.637 bits (971), Expect = 2.675e-128
Identity = 180/323 (55.73%), Postives = 234/323 (72.45%), Query Frame = 2
Query:  107 RWVESTYRGIDQGKFQLGTGKHFGDYWKERGLQTSQNSKFYGIATKFKTPFNNSLKPLVIQYQVKMDEYVQCGGGYIKLLGTDFDPLSFHGHTPYKIMFGPDICGTNKKMVHVILNYKEKYYLTKKDIRCMDDKFSHLYTLIIFPNNTYSVLIDNNQVEGGKLEDDWDLLPPKKVKDPNAMKPVDWVDNDKIDDPNDFKPEEWDQPKTIPDNTVKKPNKWDDEVDGVWEPPLISNPNFKGEWKPKKIDNPNYKGPWIHPEIDNPHYYLDHNLYLQTSIGGVGFDIWQVVSGTIFDNILLTDDPETALRIGETTWRVALAEEKK 1075
            RWVES ++  D G+++L +GK +GD   ++GLQTSQ+++FY ++++F + F+N  K LVIQ+ VK ++ + CGGGY+K+   + D    HG + Y IMFGPDICG + K VHVI NYK + +L KKDI+C DD+ +HLYTLI+ P+ TY V IDN +VE G LE+DWD LPPKK+KDP A KP DW D  KIDDP D KPE+WD+P+ IPD   KKP+ WD+++DG WEP +I NP +KGEWKPK+IDNP+YKG W+HPEIDNP Y  D  +Y   SIG +G D+WQV SGTIFDN L+TDD E A + G  TW      EKK
Sbjct:   36 RWVESKHKS-DYGQWKLTSGKFYGDAELDKGLQTSQDARFYALSSRFDS-FSNEGKTLVIQFTVKHEQKIDCGGGYVKVFPAEMDQTEMHGESQYYIMFGPDICGYSTKKVHVIFNYKGQNHLIKKDIKCKDDELTHLYTLILRPDQTYEVKIDNEKVESGSLEEDWDFLPPKKIKDPEAKKPDDWDDRAKIDDPEDTKPEDWDKPENIPDPDAKKPDDWDEDMDGEWEPAMIPNPEYKGEWKPKQIDNPSYKGTWVHPEIDNPEYAADDAIYKFDSIGVLGLDLWQVKSGTIFDNFLITDDVEEAEKFGTDTWGATKGPEKK 356          
BLAST of Calreticulin vs. Ensembl Zebrafish
Match: calr3b (calreticulin 3b [Source:ZFIN;Acc:ZDB-GENE-030131-9907])

HSP 1 Score: 365.155 bits (936), Expect = 4.668e-123
Identity = 173/314 (55.10%), Postives = 224/314 (71.34%), Query Frame = 2
Query:  107 RWVESTYRGIDQGKFQLGTGKHFGDYWKERGLQTSQNSKFYGIATKFKTPFNNSLKPLVIQYQVKMDEYVQCGGGYIKLLGTDFDPLSFHGHTPYKIMFGPDICGTNKKMVHVILNYKEKYYLTKKDIRCMDDKFSHLYTLIIFPNNTYSVLIDNNQVEGGKLEDDWDLLPPKKVKDPNAMKPVDWVDNDKIDDPNDFKPEEWDQPKTIPDNTVKKPNKWDDEVDGVWEPPLISNPNFKGEWKPKKIDNPNYKGPWIHPEIDNPHYYLDHNLYLQTSIGGVGFDIWQVVSGTIFDNILLTDDPETALRIGETTW 1048
            RWV S ++  D G+F+L  G  +GD  K++GLQTSQ+++FY  + +F+ PF+N  K LVIQ+ VK ++ + CGGGY+K+   D +    HG + Y IMFGPDICG + K VHVI NYK + +L KKDI+C DD+ +HLYTLI+ P+ TY V IDN +VE G LE+DWD LPPKK+KDP A KP DW D  KIDD  D KPE+WD+P+ IPD   KKP  WD+++DG WEP +I NP +KGEWKPK+IDNPNYKG W+HPEIDNP +  D  +Y   +IG +G D+WQV SGTIFDN  ++DD + A   G  TW
Sbjct:   37 RWVNSEHKS-DYGQFKLTAGNFYGDAEKDKGLQTSQDARFYATSVRFE-PFSNEGKTLVIQFTVKHEQKIDCGGGYVKVFPADLNQADMHGDSQYYIMFGPDICGYSTKKVHVIFNYKGQNHLIKKDIKCKDDELTHLYTLILNPDQTYEVKIDNEKVESGSLEEDWDFLPPKKIKDPEAKKPEDWDDRAKIDDETDTKPEDWDKPENIPDPDAKKPEDWDEDMDGEWEPAMIPNPEYKGEWKPKQIDNPNYKGAWVHPEIDNPEHVPDDQIYKFDNIGVLGLDLWQVKSGTIFDNFFISDDVKEAEEFGNETW 348          
BLAST of Calreticulin vs. Ensembl Zebrafish
Match: clgn (calmegin [Source:ZFIN;Acc:ZDB-GENE-060929-708])

HSP 1 Score: 200.675 bits (509), Expect = 1.844e-57
Identity = 118/338 (34.91%), Postives = 171/338 (50.59%), Query Frame = 2
Query:  197 GLQTSQNSKFYGIATKFKTPFNNSLKPLVIQYQVKMDEYVQCGGGYIKLLG--TDFDPLSFHGHTPYKIMFGPDICGTNKKMVHVILNYK-------EKYYLTKKDI---RCMDDKFSHLYTLIIFPNNTYSVLIDNNQVEGGKLEDDW--DLLPPKKVKDPNAMKPVDWVDNDKIDDPNDFKPEEWDQ---------------------PKTIPDNTVKKPNKWDDEVDGVWE-------------------PPLISNPNFKGEWKPKKIDNPNYKGPWIHPEIDNPHYYLDHNLYLQTSIGGVGFDIWQVVSGTIFDNILLTDDPETALRIGETTW 1048
            GL     +K + I+     PF    KPL++QY+V   + + CGG YIKLL    D +   FH  TPY IMFGPD CG + K+ H I  +K       E+ +  + D+   +   DK +HL+TL++ P+N+Y   ID + V  G L  D    + PPK++ DP   KP DW +  KI DP   KPEEWD+                     P+ + D T +KP+ WD+E+DG WE                   PP+++NP +KG+WK   IDNPNY+G W   +I NP ++ D + +       VG ++W + S   FDN ++T + E A R    +W
Sbjct:  120 GLVLKSRAKHHAISALLNKPFVFKDKPLIVQYEVNFQDGIDCGGAYIKLLSDSKDLELEQFHDRTPYSIMFGPDKCGEDYKL-HFIFRHKNPLNGDVEEKHAKRPDVDLKKIYTDKKTHLFTLVLNPDNSYETFIDQSSVSRGSLLTDVVPPVNPPKEIDDPKDSKPEDWDERAKIPDPEAVKPEEWDEEALAKVPDPDAVKPDGWLDDEPEFVSDPTAEKPDDWDEEMDGEWEAPQVPNPACTSAPGCGEWKPPMVNNPKYKGKWKAPLIDNPNYQGVWSPRKIPNPDHFEDLHPFRMEPFRAVGLELWSMTSDIYFDNFIITTEKEVADRWAADSW 456          
BLAST of Calreticulin vs. Ensembl Zebrafish
Match: canx (calnexin [Source:ZFIN;Acc:ZDB-GENE-040426-2797])

HSP 1 Score: 198.364 bits (503), Expect = 8.105e-57
Identity = 122/347 (35.16%), Postives = 172/347 (49.57%), Query Frame = 2
Query:  191 ERGLQTSQNSKFYGIATKFKTPFNNSLKPLVIQYQVKMDEYVQCGGGYIKLLGT--DFDPLSFHGHTPYKIMFGPDICGTNKKMVHVILNYK-------EKYYLTK--KDIRCM-DDKFSHLYTLIIFPNNTYSVLIDNNQVEGGKLEDDWD--LLPPKKVKDPNAMKPVDWVDNDKIDDPNDFKPEEWDQ---------------------PKTIPDNTVKKPNKWDDEVDG-------------------VWEPPLISNPNFKGEWKPKKIDNPNYKGPWIHPEIDNPHYYLDHNLYLQTSIGGVGFDIWQVVSGTIFDNILLTDDPETALRIGETTWRVALAEE 1069
            ++GL     +K + I+     PF    KPL++QY+V     + CGG Y+KLL    D D   F   TPY IMFGPD CG + K+ H I  +K       E+ +  K   D+R    DK +HLYTL++ P+NT+ +LID   V  G L +D    + PP +++DP+  KP DW +  KI DP+  KPE+WD+                     P+ I D    KP  WD+++DG                    WE P+I NPN+KG+WK   IDNPNY+G W   +I NP ++ D + +  T    VG ++W + S   FDN  +T D   A R     W +  A E
Sbjct:  125 DKGLVLKSKAKHHAISALLLRPFTFDTKPLIVQYEVNFQTGIDCGGAYVKLLSQTPDLDLEEFVDKTPYTIMFGPDKCGEDYKL-HFIFRHKNPKTGEFEEKHAKKPDSDLRSYYTDKKTHLYTLVLNPDNTFEILIDQTVVNSGSLLNDVTPPVNPPAEIEDPDDHKPEDWDERPKIQDPDAVKPEDWDEDAPAKIADEDAVKPDGWLDDEPEYISDPDAVKPEDWDEDMDGEWEAPQIPNPVCETAPGCGAWERPMIDNPNYKGKWKSPMIDNPNYQGVWKPRKIPNPDFFEDLHPFRMTPFSAVGLELWSMSSDIFFDNFFITSDRNVAERWANDGWGLKKAAE 470          
BLAST of Calreticulin vs. Ensembl Xenopus
Match: calr (calreticulin [Source:NCBI gene;Acc:407962])

HSP 1 Score: 379.022 bits (972), Expect = 8.076e-129
Identity = 185/328 (56.40%), Postives = 231/328 (70.43%), Query Frame = 2
Query:  107 RWVESTYRGIDQGKFQLGTGKHFGDYWKERGLQTSQNSKFYGIATKFKTPFNNSLKPLVIQYQVKMDEYVQCGGGYIKLLGTDFDPLSFHGHTPYKIMFGPDICGTNKKMVHVILNYKEKYYLTKKDIRCMDDKFSHLYTLIIFPNNTYSVLIDNNQVEGGKLEDDWDLLPPKKVKDPNAMKPVDWVDNDKIDDPNDFKPEEWDQPKTIPDNTVKKPNKWDDEVDGVWEPPLISNPNFKGEWKPKKIDNPNYKGPWIHPEIDNPHYYLDHNLYLQTSIGGVGFDIWQVVSGTIFDNILLTDDPETALRIGETTWRVALAEEKKNFEFQ 1090
            RWVES ++  D GKF+L  GK +GD  K++GLQTSQ+++FY ++T+F + F+N  K LVIQ+ VK ++ + CGGGY+KL   + +    HG + Y IMFGPDICG   K VHVI  YK+K     KDIRC DD F+HLYTLI+ P+NTY V IDN++VE G LE+DWD LP KK+KDP A KP DW +  KIDDP D KPE+WD+ + IPD    KP  WD+E+DG WEPP+I NP++KGEWKP++IDNP+YKG WIHPEIDNP Y  D  LY   S G +G D+WQV SGTIFDN L+TDD + A   G  TW V    EKK  E Q
Sbjct:    7 RWVESKHKS-DYGKFKLSAGKFYGDAEKDKGLQTSQDARFYALSTRFDS-FSNKDKTLVIQFSVKHEQNIDCGGGYVKLFPAELEQSEMHGESEYNIMFGPDICGPPTKKVHVIFQYKKKNLQINKDIRCRDDSFTHLYTLIVRPDNTYEVKIDNSKVESGSLEEDWDFLPAKKIKDPEAKKPDDWDERPKIDDPEDKKPEDWDKAEHIPDPDAVKPEDWDEEMDGEWEPPVIQNPDYKGEWKPRQIDNPDYKGKWIHPEIDNPEYTPDSTLYQYDSFGVLGLDLWQVKSGTIFDNFLMTDDEKYAEEYGNETWGVTKEAEKKMKEQQ 332          
BLAST of Calreticulin vs. Ensembl Xenopus
Match: calr (calreticulin [Source:NCBI gene;Acc:407962])

HSP 1 Score: 379.022 bits (972), Expect = 1.507e-128
Identity = 185/328 (56.40%), Postives = 231/328 (70.43%), Query Frame = 2
Query:  107 RWVESTYRGIDQGKFQLGTGKHFGDYWKERGLQTSQNSKFYGIATKFKTPFNNSLKPLVIQYQVKMDEYVQCGGGYIKLLGTDFDPLSFHGHTPYKIMFGPDICGTNKKMVHVILNYKEKYYLTKKDIRCMDDKFSHLYTLIIFPNNTYSVLIDNNQVEGGKLEDDWDLLPPKKVKDPNAMKPVDWVDNDKIDDPNDFKPEEWDQPKTIPDNTVKKPNKWDDEVDGVWEPPLISNPNFKGEWKPKKIDNPNYKGPWIHPEIDNPHYYLDHNLYLQTSIGGVGFDIWQVVSGTIFDNILLTDDPETALRIGETTWRVALAEEKKNFEFQ 1090
            RWVES ++  D GKF+L  GK +GD  K++GLQTSQ+++FY ++T+F + F+N  K LVIQ+ VK ++ + CGGGY+KL   + +    HG + Y IMFGPDICG   K VHVI  YK+K     KDIRC DD F+HLYTLI+ P+NTY V IDN++VE G LE+DWD LP KK+KDP A KP DW +  KIDDP D KPE+WD+ + IPD    KP  WD+E+DG WEPP+I NP++KGEWKP++IDNP+YKG WIHPEIDNP Y  D  LY   S G +G D+WQV SGTIFDN L+TDD + A   G  TW V    EKK  E Q
Sbjct:   28 RWVESKHKS-DYGKFKLSAGKFYGDAEKDKGLQTSQDARFYALSTRFDS-FSNKDKTLVIQFSVKHEQNIDCGGGYVKLFPAELEQSEMHGESEYNIMFGPDICGPPTKKVHVIFQYKKKNLQINKDIRCRDDSFTHLYTLIVRPDNTYEVKIDNSKVESGSLEEDWDFLPAKKIKDPEAKKPDDWDERPKIDDPEDKKPEDWDKAEHIPDPDAVKPEDWDEEMDGEWEPPVIQNPDYKGEWKPRQIDNPDYKGKWIHPEIDNPEYTPDSTLYQYDSFGVLGLDLWQVKSGTIFDNFLMTDDEKYAEEYGNETWGVTKEAEKKMKEQQ 353          
BLAST of Calreticulin vs. Ensembl Xenopus
Match: calr (calreticulin [Source:NCBI gene;Acc:407962])

HSP 1 Score: 379.022 bits (972), Expect = 2.388e-128
Identity = 185/328 (56.40%), Postives = 231/328 (70.43%), Query Frame = 2
Query:  107 RWVESTYRGIDQGKFQLGTGKHFGDYWKERGLQTSQNSKFYGIATKFKTPFNNSLKPLVIQYQVKMDEYVQCGGGYIKLLGTDFDPLSFHGHTPYKIMFGPDICGTNKKMVHVILNYKEKYYLTKKDIRCMDDKFSHLYTLIIFPNNTYSVLIDNNQVEGGKLEDDWDLLPPKKVKDPNAMKPVDWVDNDKIDDPNDFKPEEWDQPKTIPDNTVKKPNKWDDEVDGVWEPPLISNPNFKGEWKPKKIDNPNYKGPWIHPEIDNPHYYLDHNLYLQTSIGGVGFDIWQVVSGTIFDNILLTDDPETALRIGETTWRVALAEEKKNFEFQ 1090
            RWVES ++  D GKF+L  GK +GD  K++GLQTSQ+++FY ++T+F + F+N  K LVIQ+ VK ++ + CGGGY+KL   + +    HG + Y IMFGPDICG   K VHVI  YK+K     KDIRC DD F+HLYTLI+ P+NTY V IDN++VE G LE+DWD LP KK+KDP A KP DW +  KIDDP D KPE+WD+ + IPD    KP  WD+E+DG WEPP+I NP++KGEWKP++IDNP+YKG WIHPEIDNP Y  D  LY   S G +G D+WQV SGTIFDN L+TDD + A   G  TW V    EKK  E Q
Sbjct:   37 RWVESKHKS-DYGKFKLSAGKFYGDAEKDKGLQTSQDARFYALSTRFDS-FSNKDKTLVIQFSVKHEQNIDCGGGYVKLFPAELEQSEMHGESEYNIMFGPDICGPPTKKVHVIFQYKKKNLQINKDIRCRDDSFTHLYTLIVRPDNTYEVKIDNSKVESGSLEEDWDFLPAKKIKDPEAKKPDDWDERPKIDDPEDKKPEDWDKAEHIPDPDAVKPEDWDEEMDGEWEPPVIQNPDYKGEWKPRQIDNPDYKGKWIHPEIDNPEYTPDSTLYQYDSFGVLGLDLWQVKSGTIFDNFLMTDDEKYAEEYGNETWGVTKEAEKKMKEQQ 362          
BLAST of Calreticulin vs. Ensembl Xenopus
Match: calr (calreticulin [Source:NCBI gene;Acc:407962])

HSP 1 Score: 378.637 bits (971), Expect = 2.802e-128
Identity = 185/328 (56.40%), Postives = 231/328 (70.43%), Query Frame = 2
Query:  107 RWVESTYRGIDQGKFQLGTGKHFGDYWKERGLQTSQNSKFYGIATKFKTPFNNSLKPLVIQYQVKMDEYVQCGGGYIKLLGTDFDPLSFHGHTPYKIMFGPDICGTNKKMVHVILNYKEKYYLTKKDIRCMDDKFSHLYTLIIFPNNTYSVLIDNNQVEGGKLEDDWDLLPPKKVKDPNAMKPVDWVDNDKIDDPNDFKPEEWDQPKTIPDNTVKKPNKWDDEVDGVWEPPLISNPNFKGEWKPKKIDNPNYKGPWIHPEIDNPHYYLDHNLYLQTSIGGVGFDIWQVVSGTIFDNILLTDDPETALRIGETTWRVALAEEKKNFEFQ 1090
            RWVES ++  D GKF+L  GK +GD  K++GLQTSQ+++FY ++T+F + F+N  K LVIQ+ VK ++ + CGGGY+KL   + +    HG + Y IMFGPDICG   K VHVI  YK+K     KDIRC DD F+HLYTLI+ P+NTY V IDN++VE G LE+DWD LP KK+KDP A KP DW +  KIDDP D KPE+WD+ + IPD    KP  WD+E+DG WEPP+I NP++KGEWKP++IDNP+YKG WIHPEIDNP Y  D  LY   S G +G D+WQV SGTIFDN L+TDD + A   G  TW V    EKK  E Q
Sbjct:   30 RWVESKHKS-DYGKFKLSAGKFYGDAEKDKGLQTSQDARFYALSTRFDS-FSNKDKTLVIQFSVKHEQNIDCGGGYVKLFPAELEQSEMHGESEYNIMFGPDICGPPTKKVHVIFQYKKKNLQINKDIRCRDDSFTHLYTLIVRPDNTYEVKIDNSKVESGSLEEDWDFLPAKKIKDPEAKKPDDWDERPKIDDPEDKKPEDWDKAEHIPDPDAVKPEDWDEEMDGEWEPPVIQNPDYKGEWKPRQIDNPDYKGKWIHPEIDNPEYTPDSTLYQYDSFGVLGLDLWQVKSGTIFDNFLMTDDEKYAEEYGNETWGVTKEAEKKMKEQQ 355          
BLAST of Calreticulin vs. Ensembl Xenopus
Match: calr (calreticulin [Source:NCBI gene;Acc:407962])

HSP 1 Score: 377.481 bits (968), Expect = 4.800e-128
Identity = 185/328 (56.40%), Postives = 231/328 (70.43%), Query Frame = 2
Query:  107 RWVESTYRGIDQGKFQLGTGKHFGDYWKERGLQTSQNSKFYGIATKFKTPFNNSLKPLVIQYQVKMDEYVQCGGGYIKLLGTDFDPLSFHGHTPYKIMFGPDICGTNKKMVHVILNYKEKYYLTKKDIRCMDDKFSHLYTLIIFPNNTYSVLIDNNQVEGGKLEDDWDLLPPKKVKDPNAMKPVDWVDNDKIDDPNDFKPEEWDQPKTIPDNTVKKPNKWDDEVDGVWEPPLISNPNFKGEWKPKKIDNPNYKGPWIHPEIDNPHYYLDHNLYLQTSIGGVGFDIWQVVSGTIFDNILLTDDPETALRIGETTWRVALAEEKKNFEFQ 1090
            RWVES ++  D GKF+L  GK +GD  K++GLQTSQ+++FY ++T+F + F+N  K LVIQ+ VK ++ + CGGGY+KL   + +    HG + Y IMFGPDICG   K VHVI  YK+K     KDIRC DD F+HLYTLI+ P+NTY V IDN++VE G LE+DWD LP KK+KDP A KP DW +  KIDDP D KPE+WD+ + IPD    KP  WD+E+DG WEPP+I NP++KGEWKP++IDNP+YKG WIHPEIDNP Y  D  LY   S G +G D+WQV SGTIFDN L+TDD + A   G  TW V    EKK  E Q
Sbjct:   20 RWVESKHKS-DYGKFKLSAGKFYGDAEKDKGLQTSQDARFYALSTRFDS-FSNKDKTLVIQFSVKHEQNIDCGGGYVKLFPAELEQSEMHGESEYNIMFGPDICGPPTKKVHVIFQYKKKNLQINKDIRCRDDSFTHLYTLIVRPDNTYEVKIDNSKVESGSLEEDWDFLPAKKIKDPEAKKPDDWDERPKIDDPEDKKPEDWDKAEHIPDPDAVKPEDWDEEMDGEWEPPVIQNPDYKGEWKPRQIDNPDYKGKWIHPEIDNPEYTPDSTLYQYDSFGVLGLDLWQVKSGTIFDNFLMTDDEKYAEEYGNETWGVTKEAEKKMKEQQ 345          
BLAST of Calreticulin vs. Ensembl Mouse
Match: Calr (calreticulin [Source:MGI Symbol;Acc:MGI:88252])

HSP 1 Score: 390.578 bits (1002), Expect = 4.599e-133
Identity = 188/323 (58.20%), Postives = 234/323 (72.45%), Query Frame = 2
Query:  107 RWVESTYRGIDQGKFQLGTGKHFGDYWKERGLQTSQNSKFYGIATKFKTPFNNSLKPLVIQYQVKMDEYVQCGGGYIKLLGTDFDPLSFHGHTPYKIMFGPDICGTNKKMVHVILNYKEKYYLTKKDIRCMDDKFSHLYTLIIFPNNTYSVLIDNNQVEGGKLEDDWDLLPPKKVKDPNAMKPVDWVDNDKIDDPNDFKPEEWDQPKTIPDNTVKKPNKWDDEVDGVWEPPLISNPNFKGEWKPKKIDNPNYKGPWIHPEIDNPHYYLDHNLYLQTSIGGVGFDIWQVVSGTIFDNILLTDDPETALRIGETTWRVALAEEKK 1075
            RWVES ++  D GKF L +GK +GD  K++GLQTSQ+++FY ++ KF+ PF+N  + LV+Q+ VK ++ + CGGGY+KL  +  D    HG + Y IMFGPDICG   K VHVI NYK K  L  KDIRC DD+F+HLYTLI+ P+NTY V IDN+QVE G LEDDWD LPPKK+KDP+A KP DW +  KIDDP D KPE+WD+P+ IPD   KKP  WD+E+DG WEPP+I NP +KGEWKP++IDNP+YKG WIHPEIDNP Y  D N+Y   S   +G D+WQV SGTIFDN L+T+D   A   G  TW V  A EK+
Sbjct:   36 RWVESKHKS-DFGKFVLSSGKFYGDLEKDKGLQTSQDARFYALSAKFE-PFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPSGLDQKDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDAAKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDANIYAYDSFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQ 356          
BLAST of Calreticulin vs. Ensembl Mouse
Match: Calr4 (calreticulin 4 [Source:MGI Symbol;Acc:MGI:2140435])

HSP 1 Score: 329.717 bits (844), Expect = 3.273e-109
Identity = 159/314 (50.64%), Postives = 217/314 (69.11%), Query Frame = 2
Query:  107 RWVESTYRGIDQGKFQLGTGKHFGDYWKERGLQTSQNSKFYGIATKFKTPFNNSLKPLVIQYQVKMDEYVQCGGGYIKLLGTDFDPLSFHGHTPYKIMFGPDICGTNKKMVHVILNYKEKYYLTKKDIRCMDDKFSHLYTLIIFPNNTYSVLIDNNQVEGGKLEDDWDLLPPKKVKDPNAMKPVDWVDNDKIDDPNDFKPEEWDQPKTIPDNTVKKPNKWDDEVDGVWEPPLISNPNFKGEWKPKKIDNPNYKGPWIHPEIDNPHYYLDHNLYLQTSIGGVGFDIWQVVSGTIFDNILLTDDPETALRIGETTW 1048
            RWV+S ++  D G+FQL +GK + D  +++GLQT++++KFY ++T+FK PF+N  + LV+Q+ VK ++ + CGGGY+KL     +    H  + Y IMFGPDICG     + VIL++K KY+   K ++C  +K +HLYTLI+ PN TY V IDN +V  G LEDDWD LPPKK+KDP A KP  W +  +I+DP+D KPE+W+  + IPD   KKP+ W++ +DGVWE PLI N  + GEWKP+ IDNPNY+G WIHPEIDNP Y  D  +    +I  +G D+WQV SG+IFDN LLT+D E A  +G  TW
Sbjct:   22 RWVQSKHQS-DYGQFQLASGKFYQDKERDKGLQTTEDAKFYALSTRFK-PFSNENETLVVQFSVKHEQGIDCGGGYVKLFPAALNQEDMHSESQYYIMFGPDICGFGNNRLQVILSHKGKYHENNKTLKCRINKDTHLYTLILRPNATYEVKIDNQKVTSGGLEDDWDFLPPKKIKDPYARKPRKWDERQQIEDPDDKKPEDWEDSEFIPDPDAKKPDDWNEAMDGVWEGPLIPNVKYMGEWKPRIIDNPNYQGEWIHPEIDNPKYRPDPTIGHYHNISVLGLDLWQVKSGSIFDNFLLTNDEEFAEEVGNMTW 333          
BLAST of Calreticulin vs. Ensembl Mouse
Match: Calr4 (calreticulin 4 [Source:MGI Symbol;Acc:MGI:2140435])

HSP 1 Score: 251.521 bits (641), Expect = 3.519e-80
Identity = 122/226 (53.98%), Postives = 155/226 (68.58%), Query Frame = 2
Query:  371 FHGHTPYKIMFGPDICGTNKKMVHVILNYKEKYYLTKKDIRCMDDKFSHLYTLIIFPNNTYSVLIDNNQVEGGKLEDDWDLLPPKKVKDPNAMKPVDWVDNDKIDDPNDFKPEEWDQPKTIPDNTVKKPNKWDDEVDGVWEPPLISNPNFKGEWKPKKIDNPNYKGPWIHPEIDNPHYYLDHNLYLQTSIGGVGFDIWQVVSGTIFDNILLTDDPETALRIGETTW 1048
             H  + Y IMFGPDICG     + VIL++K KY+   K ++C  +K +HLYTLI+ PN TY V IDN +V  G LEDDWD LPPKK+KDP A KP  W +  +I+DP+D KPE+W+  + IPD   KKP+ W++ +DGVWE PLI N  + GEWKP+ IDNPNY+G WIHPEIDNP Y  D  +    +I  +G D+WQV SG+IFDN LLT+D E A  +G  TW
Sbjct:    1 MHSESQYYIMFGPDICGFGNNRLQVILSHKGKYHENNKTLKCRINKDTHLYTLILRPNATYEVKIDNQKVTSGGLEDDWDFLPPKKIKDPYARKPRKWDERQQIEDPDDKKPEDWEDSEFIPDPDAKKPDDWNEAMDGVWEGPLIPNVKYMGEWKPRIIDNPNYQGEWIHPEIDNPKYRPDPTIGHYHNISVLGLDLWQVKSGSIFDNFLLTNDEEFAEEVGNMTW 226          
BLAST of Calreticulin vs. Ensembl Mouse
Match: Calr4 (calreticulin 4 [Source:MGI Symbol;Acc:MGI:2140435])

HSP 1 Score: 251.521 bits (641), Expect = 3.519e-80
Identity = 122/226 (53.98%), Postives = 155/226 (68.58%), Query Frame = 2
Query:  371 FHGHTPYKIMFGPDICGTNKKMVHVILNYKEKYYLTKKDIRCMDDKFSHLYTLIIFPNNTYSVLIDNNQVEGGKLEDDWDLLPPKKVKDPNAMKPVDWVDNDKIDDPNDFKPEEWDQPKTIPDNTVKKPNKWDDEVDGVWEPPLISNPNFKGEWKPKKIDNPNYKGPWIHPEIDNPHYYLDHNLYLQTSIGGVGFDIWQVVSGTIFDNILLTDDPETALRIGETTW 1048
             H  + Y IMFGPDICG     + VIL++K KY+   K ++C  +K +HLYTLI+ PN TY V IDN +V  G LEDDWD LPPKK+KDP A KP  W +  +I+DP+D KPE+W+  + IPD   KKP+ W++ +DGVWE PLI N  + GEWKP+ IDNPNY+G WIHPEIDNP Y  D  +    +I  +G D+WQV SG+IFDN LLT+D E A  +G  TW
Sbjct:    1 MHSESQYYIMFGPDICGFGNNRLQVILSHKGKYHENNKTLKCRINKDTHLYTLILRPNATYEVKIDNQKVTSGGLEDDWDFLPPKKIKDPYARKPRKWDERQQIEDPDDKKPEDWEDSEFIPDPDAKKPDDWNEAMDGVWEGPLIPNVKYMGEWKPRIIDNPNYQGEWIHPEIDNPKYRPDPTIGHYHNISVLGLDLWQVKSGSIFDNFLLTNDEEFAEEVGNMTW 226          
BLAST of Calreticulin vs. Ensembl Mouse
Match: Calr4 (calreticulin 4 [Source:MGI Symbol;Acc:MGI:2140435])

HSP 1 Score: 251.521 bits (641), Expect = 3.519e-80
Identity = 122/226 (53.98%), Postives = 155/226 (68.58%), Query Frame = 2
Query:  371 FHGHTPYKIMFGPDICGTNKKMVHVILNYKEKYYLTKKDIRCMDDKFSHLYTLIIFPNNTYSVLIDNNQVEGGKLEDDWDLLPPKKVKDPNAMKPVDWVDNDKIDDPNDFKPEEWDQPKTIPDNTVKKPNKWDDEVDGVWEPPLISNPNFKGEWKPKKIDNPNYKGPWIHPEIDNPHYYLDHNLYLQTSIGGVGFDIWQVVSGTIFDNILLTDDPETALRIGETTW 1048
             H  + Y IMFGPDICG     + VIL++K KY+   K ++C  +K +HLYTLI+ PN TY V IDN +V  G LEDDWD LPPKK+KDP A KP  W +  +I+DP+D KPE+W+  + IPD   KKP+ W++ +DGVWE PLI N  + GEWKP+ IDNPNY+G WIHPEIDNP Y  D  +    +I  +G D+WQV SG+IFDN LLT+D E A  +G  TW
Sbjct:    1 MHSESQYYIMFGPDICGFGNNRLQVILSHKGKYHENNKTLKCRINKDTHLYTLILRPNATYEVKIDNQKVTSGGLEDDWDFLPPKKIKDPYARKPRKWDERQQIEDPDDKKPEDWEDSEFIPDPDAKKPDDWNEAMDGVWEGPLIPNVKYMGEWKPRIIDNPNYQGEWIHPEIDNPKYRPDPTIGHYHNISVLGLDLWQVKSGSIFDNFLLTNDEEFAEEVGNMTW 226          
BLAST of Calreticulin vs. UniProt/SwissProt
Match: sp|P15253|CALR_RABIT (Calreticulin OS=Oryctolagus cuniculus OX=9986 GN=CALR PE=1 SV=1)

HSP 1 Score: 390.963 bits (1003), Expect = 2.250e-132
Identity = 189/337 (56.08%), Postives = 239/337 (70.92%), Query Frame = 2
Query:  107 RWVESTYRGIDQGKFQLGTGKHFGDYWKERGLQTSQNSKFYGIATKFKTPFNNSLKPLVIQYQVKMDEYVQCGGGYIKLLGTDFDPLSFHGHTPYKIMFGPDICGTNKKMVHVILNYKEKYYLTKKDIRCMDDKFSHLYTLIIFPNNTYSVLIDNNQVEGGKLEDDWDLLPPKKVKDPNAMKPVDWVDNDKIDDPNDFKPEEWDQPKTIPDNTVKKPNKWDDEVDGVWEPPLISNPNFKGEWKPKKIDNPNYKGPWIHPEIDNPHYYLDHNLYLQTSIGGVGFDIWQVVSGTIFDNILLTDDPETALRIGETTWRVALAEEKKNFEFQRNHELAEQR 1117
            RW+ES ++  D GKF L +GK +GD  K++GLQTSQ+++FY ++ +F+ PF+N  +PLV+Q+ VK ++ + CGGGY+KL     D    HG + Y IMFGPDICG   K VHVI NYK K  L  KDIRC DD+F+HLYTLI+ P+NTY V IDN+QVE G LEDDWD LPPKK+KDP+A KP DW +  KIDDP D KPE+WD+P+ IPD   KKP  WD+E+DG WEPP+I NP +KGEWKP++IDNP+YKG WIHPEIDNP Y  D N+Y   S   +G D+WQV SGTIFDN L+T+D   A   G  TW V    EK+     ++ +  EQR
Sbjct:   36 RWIESKHKS-DFGKFVLSSGKFYGDQEKDKGLQTSQDARFYALSARFE-PFSNKGQPLVVQFTVKHEQNIDCGGGYVKLFPAGLDQKDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDASKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDANIYAYDSFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKTAEKQ----MKDKQDEEQR 366          
BLAST of Calreticulin vs. UniProt/SwissProt
Match: sp|P14211|CALR_MOUSE (Calreticulin OS=Mus musculus OX=10090 GN=Calr PE=1 SV=1)

HSP 1 Score: 390.578 bits (1002), Expect = 3.217e-132
Identity = 188/323 (58.20%), Postives = 234/323 (72.45%), Query Frame = 2
Query:  107 RWVESTYRGIDQGKFQLGTGKHFGDYWKERGLQTSQNSKFYGIATKFKTPFNNSLKPLVIQYQVKMDEYVQCGGGYIKLLGTDFDPLSFHGHTPYKIMFGPDICGTNKKMVHVILNYKEKYYLTKKDIRCMDDKFSHLYTLIIFPNNTYSVLIDNNQVEGGKLEDDWDLLPPKKVKDPNAMKPVDWVDNDKIDDPNDFKPEEWDQPKTIPDNTVKKPNKWDDEVDGVWEPPLISNPNFKGEWKPKKIDNPNYKGPWIHPEIDNPHYYLDHNLYLQTSIGGVGFDIWQVVSGTIFDNILLTDDPETALRIGETTWRVALAEEKK 1075
            RWVES ++  D GKF L +GK +GD  K++GLQTSQ+++FY ++ KF+ PF+N  + LV+Q+ VK ++ + CGGGY+KL  +  D    HG + Y IMFGPDICG   K VHVI NYK K  L  KDIRC DD+F+HLYTLI+ P+NTY V IDN+QVE G LEDDWD LPPKK+KDP+A KP DW +  KIDDP D KPE+WD+P+ IPD   KKP  WD+E+DG WEPP+I NP +KGEWKP++IDNP+YKG WIHPEIDNP Y  D N+Y   S   +G D+WQV SGTIFDN L+T+D   A   G  TW V  A EK+
Sbjct:   36 RWVESKHKS-DFGKFVLSSGKFYGDLEKDKGLQTSQDARFYALSAKFE-PFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPSGLDQKDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDAAKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDANIYAYDSFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQ 356          
BLAST of Calreticulin vs. UniProt/SwissProt
Match: sp|P52193|CALR_BOVIN (Calreticulin OS=Bos taurus OX=9913 GN=CALR PE=1 SV=2)

HSP 1 Score: 389.808 bits (1000), Expect = 7.199e-132
Identity = 187/323 (57.89%), Postives = 232/323 (71.83%), Query Frame = 2
Query:  107 RWVESTYRGIDQGKFQLGTGKHFGDYWKERGLQTSQNSKFYGIATKFKTPFNNSLKPLVIQYQVKMDEYVQCGGGYIKLLGTDFDPLSFHGHTPYKIMFGPDICGTNKKMVHVILNYKEKYYLTKKDIRCMDDKFSHLYTLIIFPNNTYSVLIDNNQVEGGKLEDDWDLLPPKKVKDPNAMKPVDWVDNDKIDDPNDFKPEEWDQPKTIPDNTVKKPNKWDDEVDGVWEPPLISNPNFKGEWKPKKIDNPNYKGPWIHPEIDNPHYYLDHNLYLQTSIGGVGFDIWQVVSGTIFDNILLTDDPETALRIGETTWRVALAEEKK 1075
            RW+ES ++  D GKF L +GK +GD  K++GLQTSQ+++FY ++ +F+ PF+N  + LV+Q+ VK ++ + CGGGY+KL     D    HG + Y IMFGPDICG   K VHVI NYK K  L  KDIRC DD+F+HLYTLI+ PNNTY V IDN+QVE G LEDDWD LPPKK+KDP+A KP DW D  KIDDP D KPE+WD+P+ IPD   KKP  WD+E+DG WEPP+I NP +KGEWKP++IDNP YKG WIHPEIDNP Y  D N+Y   +   +G D+WQV SGTIFDN L+T+D   A   G  TW V  A EK+
Sbjct:   36 RWIESKHKP-DFGKFVLSSGKFYGDQEKDKGLQTSQDARFYALSARFE-PFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPAGLDQTDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPNNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDAAKPEDWDDRAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPEYKGIWIHPEIDNPEYSPDSNIYAYENFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQ 356          
BLAST of Calreticulin vs. UniProt/SwissProt
Match: sp|Q8K3H7|CALR_CRIGR (Calreticulin OS=Cricetulus griseus OX=10029 GN=CALR PE=1 SV=1)

HSP 1 Score: 389.423 bits (999), Expect = 9.552e-132
Identity = 187/323 (57.89%), Postives = 233/323 (72.14%), Query Frame = 2
Query:  107 RWVESTYRGIDQGKFQLGTGKHFGDYWKERGLQTSQNSKFYGIATKFKTPFNNSLKPLVIQYQVKMDEYVQCGGGYIKLLGTDFDPLSFHGHTPYKIMFGPDICGTNKKMVHVILNYKEKYYLTKKDIRCMDDKFSHLYTLIIFPNNTYSVLIDNNQVEGGKLEDDWDLLPPKKVKDPNAMKPVDWVDNDKIDDPNDFKPEEWDQPKTIPDNTVKKPNKWDDEVDGVWEPPLISNPNFKGEWKPKKIDNPNYKGPWIHPEIDNPHYYLDHNLYLQTSIGGVGFDIWQVVSGTIFDNILLTDDPETALRIGETTWRVALAEEKK 1075
            RWVES ++  D GKF L +GK +GD  K++GLQTSQ+++FY ++ +F+ PF+N  + LV+Q+ VK ++ + CGGGY+KL     D    HG + Y IMFGPDICG   K VHVI NYK K  L  KDIRC DD+F+HLYTLI+ P+NTY V IDN+QVE G LEDDWD LPPKK+KDP+A KP DW +  KIDDP D KPE+WD+P+ IPD   KKP  WD+E+DG WEPP+I NP +KGEWKP++IDNP+YKG WIHPEIDNP Y  D N+Y   S   +G D+WQV SGTIFDN L+T+D   A   G  TW V  A EK+
Sbjct:   36 RWVESKHKS-DFGKFVLSSGKFYGDQEKDKGLQTSQDARFYALSARFE-PFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPGSLDQKDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDAAKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDANIYAYDSFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKASEKQ 356          
BLAST of Calreticulin vs. UniProt/SwissProt
Match: sp|P18418|CALR_RAT (Calreticulin OS=Rattus norvegicus OX=10116 GN=Calr PE=1 SV=1)

HSP 1 Score: 389.037 bits (998), Expect = 1.443e-131
Identity = 187/323 (57.89%), Postives = 233/323 (72.14%), Query Frame = 2
Query:  107 RWVESTYRGIDQGKFQLGTGKHFGDYWKERGLQTSQNSKFYGIATKFKTPFNNSLKPLVIQYQVKMDEYVQCGGGYIKLLGTDFDPLSFHGHTPYKIMFGPDICGTNKKMVHVILNYKEKYYLTKKDIRCMDDKFSHLYTLIIFPNNTYSVLIDNNQVEGGKLEDDWDLLPPKKVKDPNAMKPVDWVDNDKIDDPNDFKPEEWDQPKTIPDNTVKKPNKWDDEVDGVWEPPLISNPNFKGEWKPKKIDNPNYKGPWIHPEIDNPHYYLDHNLYLQTSIGGVGFDIWQVVSGTIFDNILLTDDPETALRIGETTWRVALAEEKK 1075
            RWVES ++  D GKF L +GK +GD  K++GLQTSQ+++FY ++ +F+ PF+N  + LV+Q+ VK ++ + CGGGY+KL     D    HG + Y IMFGPDICG   K VHVI NYK K  L  KDIRC DD+F+HLYTLI+ P+NTY V IDN+QVE G LEDDWD LPPKK+KDP+A KP DW +  KIDDP D KPE+WD+P+ IPD   KKP  WD+E+DG WEPP+I NP +KGEWKP++IDNP+YKG WIHPEIDNP Y  D N+Y   S   +G D+WQV SGTIFDN L+T+D   A   G  TW V  A EK+
Sbjct:   36 RWVESKHKS-DFGKFVLSSGKFYGDQEKDKGLQTSQDARFYALSARFE-PFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPGGLDQKDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDAAKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDANIYAYDSFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQ 356          
BLAST of Calreticulin vs. TrEMBL
Match: V9XRS2 (Calreticulin OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 432.565 bits (1111), Expect = 2.207e-146
Identity = 205/323 (63.47%), Postives = 246/323 (76.16%), Query Frame = 2
Query:  107 RWVESTYRGIDQGKFQLGTGKHFGDYWKERGLQTSQNSKFYGIATKFKTPFNNSLKPLVIQYQVKMDEYVQCGGGYIKLLGTDFDPLSFHGHTPYKIMFGPDICGTNKKMVHVILNYKEKYYLTKKDIRCMDDKFSHLYTLIIFPNNTYSVLIDNNQVEGGKLEDDWDLLPPKKVKDPNAMKPVDWVDNDKIDDPNDFKPEEWDQPKTIPDNTVKKPNKWDDEVDGVWEPPLISNPNFKGEWKPKKIDNPNYKGPWIHPEIDNPHYYLDHNLYLQTSIGGVGFDIWQVVSGTIFDNILLTDDPETALRIGETTWRVALAEEKK 1075
            +WVEST++G DQGKF    GK + D  K++G+QTSQ++KFYGI+ KF   F+N  K LVIQ+QVK ++ + CGGGY+KL+G++F+   FHG TPY IMFGPDICG + K VHVI NYK +  L KKDI+C DD+F+H+YTLI+ P+NTY VLIDN +VE G LEDDWD L PKK+KDPNA KP DW DN+KIDD  D KPEEWD+PKTIPD   KKP  WDDE+DG WE P I NP +KGEWKPK+IDNP YKGPW+HPEI NP Y  D NLY+   IG +GFD+WQV SGTIFDNILLTDDP  A +  E TW+V    EKK
Sbjct:   33 QWVESTFKGADQGKFTWTAGKFYNDAEKDKGIQTSQDAKFYGISKKFDKAFSNEGKKLVIQFQVKHEQTIDCGGGYVKLVGSNFEQDKFHGETPYHIMFGPDICGLSTKKVHVIFNYKGQNLLIKKDIKCKDDEFTHVYTLIVNPDNTYEVLIDNEKVESGSLEDDWDFLAPKKIKDPNAKKPEDWEDNEKIDDITDKKPEEWDKPKTIPDPKAKKPEDWDDEMDGEWEAPQIDNPEYKGEWKPKQIDNPKYKGPWVHPEIPNPDYKPDTNLYVYKDIGAIGFDLWQVKSGTIFDNILLTDDPAYAKKYAEQTWKVTADGEKK 355          
BLAST of Calreticulin vs. TrEMBL
Match: A0A1I8HX98 (Calreticulin OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig013267g1 PE=3 SV=1)

HSP 1 Score: 431.409 bits (1108), Expect = 6.825e-146
Identity = 205/328 (62.50%), Postives = 250/328 (76.22%), Query Frame = 2
Query:  107 RWVESTYRGIDQGKFQLGTGKHFGDYWKERGLQTSQNSKFYGIATKFKTPFNNSLKPLVIQYQVKMDEYVQCGGGYIKLLGTDFDPLSFHGHTPYKIMFGPDICGTNKKMVHVILNYKEKYYLTKKDIRCMDDKFSHLYTLIIFPNNTYSVLIDNNQVEGGKLEDDWDLLPPKKVKDPNAMKPVDWVDNDKIDDPNDFKPEEWDQPKTIPDNTVKKPNKWDDEVDGVWEPPLISNPNFKGEWKPKKIDNPNYKGPWIHPEIDNPHYYLDHNLYLQTSIGGVGFDIWQVVSGTIFDNILLTDDPETALRIGETTWRVALAEEKKNFEFQ 1090
            RWVESTY+G DQGK+    GK + D  K+RG++T+Q++KFY I+ KF  PF+N  KPLVIQ+QVK ++ + CGGGY+KLLG+D D  +FHG +PYKIMFGPDICG   K VHVI NYK K  LTKK+IRC DD+ SHLYTLI+ P+NTY VLIDN + EGG+LE DWD LPPKK+KDP A KP DW + +KIDDPND KPE+WD+PKTIPD   KKP+ WDDE+DG WEPP+I NP++KGEWKPK+IDNP YKG WIHPEIDNP Y  D  LY  T IG +GFD+WQV SG+IFDN+ + DDP  A    + T++  +  EKK  E Q
Sbjct:   33 RWVESTYKGADQGKWDWSAGKFYNDAQKDRGIKTTQDAKFYDISAKFDKPFSNQGKPLVIQFQVKHEQNIDCGGGYVKLLGSDIDQKNFHGDSPYKIMFGPDICGPGTKKVHVIFNYKGKNLLTKKEIRCKDDELSHLYTLIVKPDNTYEVLIDNERAEGGELEADWDFLPPKKIKDPAAKKPDDWDEREKIDDPNDKKPEDWDKPKTIPDPKAKKPDDWDDEMDGEWEPPMIDNPDYKGEWKPKQIDNPAYKGKWIHPEIDNPDYSPDPELYKYTDIGAIGFDLWQVKSGSIFDNVFVGDDPAEARAFADETFKKTVEGEKKMKEKQ 360          
BLAST of Calreticulin vs. TrEMBL
Match: A0A267GGU3 (Calreticulin OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig013267g2 PE=3 SV=1)

HSP 1 Score: 431.409 bits (1108), Expect = 7.447e-146
Identity = 205/328 (62.50%), Postives = 250/328 (76.22%), Query Frame = 2
Query:  107 RWVESTYRGIDQGKFQLGTGKHFGDYWKERGLQTSQNSKFYGIATKFKTPFNNSLKPLVIQYQVKMDEYVQCGGGYIKLLGTDFDPLSFHGHTPYKIMFGPDICGTNKKMVHVILNYKEKYYLTKKDIRCMDDKFSHLYTLIIFPNNTYSVLIDNNQVEGGKLEDDWDLLPPKKVKDPNAMKPVDWVDNDKIDDPNDFKPEEWDQPKTIPDNTVKKPNKWDDEVDGVWEPPLISNPNFKGEWKPKKIDNPNYKGPWIHPEIDNPHYYLDHNLYLQTSIGGVGFDIWQVVSGTIFDNILLTDDPETALRIGETTWRVALAEEKKNFEFQ 1090
            RWVESTY+G DQGK+    GK + D  K+RG++T+Q++KFY I+ KF  PF+N  KPLVIQ+QVK ++ + CGGGY+KLLG+D D  +FHG +PYKIMFGPDICG   K VHVI NYK K  LTKK+IRC DD+ SHLYTLI+ P+NTY VLIDN + EGG+LE DWD LPPKK+KDP A KP DW + +KIDDPND KPE+WD+PKTIPD   KKP+ WDDE+DG WEPP+I NP++KGEWKPK+IDNP YKG WIHPEIDNP Y  D  LY  T IG +GFD+WQV SG+IFDN+ + DDP  A    + T++  +  EKK  E Q
Sbjct:   33 RWVESTYKGADQGKWDWSAGKFYNDAQKDRGIKTTQDAKFYDISAKFDKPFSNQGKPLVIQFQVKHEQNIDCGGGYVKLLGSDIDQKNFHGDSPYKIMFGPDICGPGTKKVHVIFNYKGKNLLTKKEIRCKDDELSHLYTLIVKPDNTYEVLIDNERAEGGELEADWDFLPPKKIKDPAAKKPDDWDEREKIDDPNDKKPEDWDKPKTIPDPKAKKPDDWDDEMDGEWEPPMIDNPDYKGEWKPKQIDNPAYKGKWIHPEIDNPDYSPDPELYKYTDIGAIGFDLWQVKSGSIFDNVFVGDDPAEARTFADETFKKTVEGEKKMKEKQ 360          
BLAST of Calreticulin vs. TrEMBL
Match: A0A1I8I182 (Calreticulin OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 429.869 bits (1104), Expect = 1.380e-145
Identity = 205/328 (62.50%), Postives = 250/328 (76.22%), Query Frame = 2
Query:  107 RWVESTYRGIDQGKFQLGTGKHFGDYWKERGLQTSQNSKFYGIATKFKTPFNNSLKPLVIQYQVKMDEYVQCGGGYIKLLGTDFDPLSFHGHTPYKIMFGPDICGTNKKMVHVILNYKEKYYLTKKDIRCMDDKFSHLYTLIIFPNNTYSVLIDNNQVEGGKLEDDWDLLPPKKVKDPNAMKPVDWVDNDKIDDPNDFKPEEWDQPKTIPDNTVKKPNKWDDEVDGVWEPPLISNPNFKGEWKPKKIDNPNYKGPWIHPEIDNPHYYLDHNLYLQTSIGGVGFDIWQVVSGTIFDNILLTDDPETALRIGETTWRVALAEEKKNFEFQ 1090
            RWVESTY+G DQGK+    GK + D  K+RG++T+Q++KFY I+ KF  PF+N  KPLVIQ+QVK ++ + CGGGY+KLLG+D D  +FHG +PYKIMFGPDICG   K VHVI NYK K  LTKK+IRC DD+ SHLYTLI+ P+NTY VLIDN + EGG+LE DWD LPPKK+KDP A KP DW + +KIDDPND KPE+WD+PKTIPD   KKP+ WDDE+DG WEPP+I NP++KGEWKPK+IDNP YKG WIHPEIDNP Y  D  LY  T IG +GFD+WQV SG+IFDN+ + DDP  A    + T++  +  EKK  E Q
Sbjct:   33 RWVESTYKGADQGKWDWSAGKFYNDAQKDRGIKTTQDAKFYDISAKFDKPFSNQGKPLVIQFQVKHEQNIDCGGGYVKLLGSDIDQKNFHGDSPYKIMFGPDICGPGTKKVHVIFNYKGKNLLTKKEIRCKDDELSHLYTLIVKPDNTYEVLIDNERAEGGELEADWDFLPPKKIKDPAAKKPDDWDEREKIDDPNDKKPEDWDKPKTIPDPKAKKPDDWDDEMDGEWEPPMIDNPDYKGEWKPKQIDNPAYKGKWIHPEIDNPDYSPDPELYKYTDIGAIGFDLWQVKSGSIFDNVFVGDDPAEARTFADETFKKTVEGEKKMKEKQ 360          
BLAST of Calreticulin vs. TrEMBL
Match: A0A267FN87 (Calreticulin OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig004264g3 PE=3 SV=1)

HSP 1 Score: 428.328 bits (1100), Expect = 1.125e-144
Identity = 204/328 (62.20%), Postives = 253/328 (77.13%), Query Frame = 2
Query:  107 RWVESTYRGIDQGKFQLGTGKHFGDYWKERGLQTSQNSKFYGIATKFKTPFNNSLKPLVIQYQVKMDEYVQCGGGYIKLLGTDFDPLSFHGHTPYKIMFGPDICGTNKKMVHVILNYKEKYYLTKKDIRCMDDKFSHLYTLIIFPNNTYSVLIDNNQVEGGKLEDDWDLLPPKKVKDPNAMKPVDWVDNDKIDDPNDFKPEEWDQPKTIPDNTVKKPNKWDDEVDGVWEPPLISNPNFKGEWKPKKIDNPNYKGPWIHPEIDNPHYYLDHNLYLQTSIGGVGFDIWQVVSGTIFDNILLTDDPETALRIGETTWRVALAEEKKNFEFQ 1090
            RWVESTY+G DQGK++   GK + D  K++G++TSQ++KFYGI+ KF +PF+N+ K LVIQ+QVK ++ + CGGGY+K+LG+D D  +FHG TPYKIMFGPDICG   K VHVI NYK K  LTKK+IRC DD+ SHLYTLI+ P+NTY VLIDN + EGG+LE DWD LPPKK+KDP A KP DW + +KIDDPND KPE+WD+PKTIPD   KKP+ WDDE+DG WEPP+I NP++KG+WKPK+IDNP YKG WIHPEIDNP Y  D  LY  T IG +GFD+WQV SG+IFDN+ + DDP  A    + T++  +  EKK  E Q
Sbjct:   33 RWVESTYKGNDQGKWEWTAGKFYNDAEKDKGIKTSQDAKFYGISAKFNSPFSNAGKTLVIQFQVKHEQNIDCGGGYVKVLGSDVDQKNFHGDTPYKIMFGPDICGPGTKKVHVIFNYKGKNLLTKKEIRCKDDELSHLYTLIVKPDNTYEVLIDNERAEGGELEADWDFLPPKKIKDPAAKKPDDWDEREKIDDPNDKKPEDWDKPKTIPDPKAKKPDDWDDEMDGEWEPPMIDNPDYKGDWKPKQIDNPAYKGKWIHPEIDNPDYSPDPELYKYTDIGAIGFDLWQVKSGSIFDNVFVGDDPAEAKAFADETFKKTVEGEKKMKEKQ 360          
BLAST of Calreticulin vs. Ensembl Cavefish
Match: ENSAMXT00000019127.2 (calreticulin-like [Source:NCBI gene;Acc:103024869])

HSP 1 Score: 392.889 bits (1008), Expect = 5.646e-134
Identity = 189/323 (58.51%), Postives = 235/323 (72.76%), Query Frame = 2
Query:  107 RWVESTYRGIDQGKFQLGTGKHFGDYWKERGLQTSQNSKFYGIATKFKTPFNNSLKPLVIQYQVKMDEYVQCGGGYIKLLGTDFDPLSFHGHTPYKIMFGPDICGTNKKMVHVILNYKEKYYLTKKDIRCMDDKFSHLYTLIIFPNNTYSVLIDNNQVEGGKLEDDWDLLPPKKVKDPNAMKPVDWVDNDKIDDPNDFKPEEWDQPKTIPDNTVKKPNKWDDEVDGVWEPPLISNPNFKGEWKPKKIDNPNYKGPWIHPEIDNPHYYLDHNLYLQTSIGGVGFDIWQVVSGTIFDNILLTDDPETALRIGETTWRVALAEEKK 1075
            RWVES ++  D GKF L  GK +GD  K++GLQTSQ++ FY I+++FK  F+N  + LV+Q+ VK ++ + CGGGYIKL  +D      HG + Y IMFGPDICG   K VHVI NYK K +L  KDIRC DD+ +HLYTLI+ P+NTY V IDN +VE G LEDDWD LPPKK+KDPNA KP DW + +KIDDP D KPE+W++ + IPD   KKP+ WDDE+DG WEPP++SNP +KGEWKPK+IDNP YKG W+HPEIDNP Y  D  +Y  +SIG +G D+WQV SGTIFDN L+T+DP+ A  IG  TW      EKK
Sbjct:   38 RWVESEHKS-DYGKFVLTAGKFYGDAEKDKGLQTSQDAHFYSISSRFKD-FSNKDQTLVLQFTVKHEQSIDCGGGYIKLFPSDLKQEDMHGDSIYNIMFGPDICGPGTKKVHVIFNYKGKNHLINKDIRCKDDEHTHLYTLIVNPDNTYEVKIDNKKVESGSLEDDWDFLPPKKIKDPNAKKPEDWDEREKIDDPEDQKPEDWEKAENIPDPDAKKPDDWDDEMDGEWEPPMVSNPEYKGEWKPKQIDNPGYKGKWVHPEIDNPEYTADPEIYAYSSIGVIGLDLWQVKSGTIFDNFLITNDPKLAEEIGNETWGATKDAEKK 358          
BLAST of Calreticulin vs. Ensembl Cavefish
Match: calr3b (calreticulin-like [Source:NCBI gene;Acc:103040817])

HSP 1 Score: 377.096 bits (967), Expect = 9.529e-128
Identity = 179/323 (55.42%), Postives = 232/323 (71.83%), Query Frame = 2
Query:  107 RWVESTYRGIDQGKFQLGTGKHFGDYWKERGLQTSQNSKFYGIATKFKTPFNNSLKPLVIQYQVKMDEYVQCGGGYIKLLGTDFDPLSFHGHTPYKIMFGPDICGTNKKMVHVILNYKEKYYLTKKDIRCMDDKFSHLYTLIIFPNNTYSVLIDNNQVEGGKLEDDWDLLPPKKVKDPNAMKPVDWVDNDKIDDPNDFKPEEWDQPKTIPDNTVKKPNKWDDEVDGVWEPPLISNPNFKGEWKPKKIDNPNYKGPWIHPEIDNPHYYLDHNLYLQTSIGGVGFDIWQVVSGTIFDNILLTDDPETALRIGETTWRVALAEEKK 1075
            RWV S ++  D G+F+L +G  +GD  K++GLQTSQ+++FY  + +F+ PF+N  K LV+Q+ VK ++ + CGGGY+K+  +D D  + HG + Y IMFGPDICG + K VHVI NYK K +L KK+I+C DD+ +HLYTLI+ P+ TY V IDN +VE G LE+DWD LP KK+KDP A KP DW D  KIDD  D KPE+WD+P+ IPD   KKP  WD+++DG WEPP+I NP +KGEWKPK+IDNPNYKG W+HPEIDNP Y  D  +Y    IG +G D+WQV +GTIFDN L+TDD +TA    + TW V    EKK
Sbjct:   38 RWVNSEHKS-DYGQFKLTSGNFYGDVEKDKGLQTSQDARFYAASARFE-PFSNEGKSLVVQFSVKHEQKIDCGGGYVKIFPSDLDQTNMHGDSQYYIMFGPDICGYSTKKVHVIFNYKGKNHLIKKEIKCKDDELTHLYTLILNPDQTYEVKIDNEKVESGSLEEDWDFLPAKKIKDPEAKKPEDWDDRAKIDDETDTKPEDWDKPENIPDPDAKKPEDWDEDMDGEWEPPMIPNPEYKGEWKPKQIDNPNYKGAWVHPEIDNPEYSPDAEIYKFEKIGVLGLDLWQVKAGTIFDNFLITDDVQTADEFAKETWGVTKGPEKK 358          
BLAST of Calreticulin vs. Ensembl Cavefish
Match: ENSAMXT00000022283.2 (pep primary_assembly:Astyanax_mexicanus-2.0:5:25050572:25055355:1 gene:ENSAMXG00000021635.2 transcript:ENSAMXT00000022283.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 367.851 bits (943), Expect = 1.508e-124
Identity = 174/314 (55.41%), Postives = 227/314 (72.29%), Query Frame = 2
Query:  173 FGDYWKERGLQTSQNSKFYGIATKFKTPFNNSLKPLVIQYQVKMDEYVQCGGGYIKLLGTDFDPLSFHGHTPYKIMFGPDICGTNKKMVHVILNYKEKYYLTKKDIRCMDDKFSHLYTLIIFPNNTYSVLIDNNQVEGGKLEDDWDLLPPKKVKDPNAMKPVDWVDNDKIDDPNDFKPEEWDQPKTIPDNTVKKPNKWDDEVDGVWEPPLISNPNFKGEWKPKKIDNPNYKGPWIHPEIDNPHYYLDHNLYLQTSIGGVGFDIWQVVSGTIFDNILLTDDPETALRIGETTWRVALAEEKKNFEFQRNHELAEQ 1114
            F + + + GLQTSQ+++FY ++++F+ PF+N  KPLVIQ+ VK ++ + CGGGY+K+  TD D  + HG + Y IMFGPDICG + K VHVI NYK + +L KKDIRC DD+ +HLYTLI+ P+ TY V I+N +VE G LE+DWD LPPKK+KDP A KP DW D  KIDDP D KPE+WD+P+ IPD   KKP+ WD+++DG WEPP+I NP +KGEWKPK+IDNPNYKG W+HPEIDNP Y  D ++Y   +IG +G D+WQV SGTIFDN  ++DD + A   G+ TW      EKK  E Q   E  ++
Sbjct:   23 FKEQFLDGGLQTSQDARFYALSSRFE-PFSNEGKPLVIQFTVKHEQKIDCGGGYVKIFPTDLDQANMHGDSQYYIMFGPDICGYSTKKVHVIFNYKGQNHLIKKDIRCKDDEHTHLYTLILHPDQTYEVKINNEKVESGSLEEDWDFLPPKKIKDPEAKKPEDWDDRAKIDDPEDTKPEDWDKPENIPDPDAKKPDDWDEDMDGEWEPPMIPNPEYKGEWKPKQIDNPNYKGTWVHPEIDNPEYTADDSIYKYDNIGVLGLDLWQVKSGTIFDNFFISDDVKEAEEFGKETWGATKGPEKKMKEKQDEEERKQR 335          
BLAST of Calreticulin vs. Ensembl Cavefish
Match: clgn (calnexin [Source:NCBI gene;Acc:103035256])

HSP 1 Score: 202.986 bits (515), Expect = 1.178e-58
Identity = 124/365 (33.97%), Postives = 182/365 (49.86%), Query Frame = 2
Query:  197 GLQTSQNSKFYGIATKFKTPFNNSLKPLVIQYQVKMDEYVQCGGGYIKLLG--TDFDPLSFHGHTPYKIMFGPDICGTNKKMVHVILNYK-------EKYYLTKKDI---RCMDDKFSHLYTLIIFPNNTYSVLIDNNQVEGGKLEDDW--DLLPPKKVKDPNAMKPVDWVDNDKIDDPNDFKPEEWDQ---------------------PKTIPDNTVKKPNKWDDEVDGVWEPP-------------------LISNPNFKGEWKPKKIDNPNYKGPWIHPEIDNPHYYLDHNLYLQTSIGGVGFDIWQVVSGTIFDNILLTDDPETALRIGETTW--RVALAEEKKNFEFQRNHELAEQRKY 1123
            GL     +K + I++    P+    +PLV+QY+V   + + CGG YIKLL    D D   FH  TPY IMFGPD CG + K+ H I  +K       E+ +  + D    +   DK +HL+TL++ P+N+Y + ID +    G L  D    + PPK++ DP   KP DW +  KI DP   KP++WD+                     P+ +PD T  KP+ WD+E+DG WE P                    I+NP +KG+WK   IDNPNY+G W   +I NP Y+ D   +  T++  VG ++W + S   FDN ++T D E A R    +W  +  +A   +   F +    AE+R +
Sbjct:  121 GLVLKSRAKHHAISSPLSKPYIFKDRPLVVQYEVNFQDGIDCGGAYIKLLSDSPDLDLEQFHDRTPYSIMFGPDKCGEDYKL-HFIFRHKNPLNEDFEEKHAKRADADLRKVYSDKKTHLFTLVLNPDNSYEIFIDQSSASKGNLLTDVIPPVNPPKEIDDPKDTKPEDWDERAKIPDPEAVKPDDWDEEAPAMIPDPDALKPDGWLDEEPEFVPDPTATKPDDWDEEMDGEWEAPQVPNPACQTAPGCGEWKSPTINNPKYKGKWKAPLIDNPNYQGVWSPRKILNPDYFEDLEPFKMTAVRAVGLELWSMTSDIYFDNFIITADKEVADRWAADSWGLKKLVASANEPGVFTQLTLAAEERPW 484          
BLAST of Calreticulin vs. Ensembl Cavefish
Match: clgn (calnexin [Source:NCBI gene;Acc:103035256])

HSP 1 Score: 203.756 bits (517), Expect = 1.570e-58
Identity = 124/365 (33.97%), Postives = 182/365 (49.86%), Query Frame = 2
Query:  197 GLQTSQNSKFYGIATKFKTPFNNSLKPLVIQYQVKMDEYVQCGGGYIKLLG--TDFDPLSFHGHTPYKIMFGPDICGTNKKMVHVILNYK-------EKYYLTKKDI---RCMDDKFSHLYTLIIFPNNTYSVLIDNNQVEGGKLEDDW--DLLPPKKVKDPNAMKPVDWVDNDKIDDPNDFKPEEWDQ---------------------PKTIPDNTVKKPNKWDDEVDGVWEPP-------------------LISNPNFKGEWKPKKIDNPNYKGPWIHPEIDNPHYYLDHNLYLQTSIGGVGFDIWQVVSGTIFDNILLTDDPETALRIGETTW--RVALAEEKKNFEFQRNHELAEQRKY 1123
            GL     +K + I++    P+    +PLV+QY+V   + + CGG YIKLL    D D   FH  TPY IMFGPD CG + K+ H I  +K       E+ +  + D    +   DK +HL+TL++ P+N+Y + ID +    G L  D    + PPK++ DP   KP DW +  KI DP   KP++WD+                     P+ +PD T  KP+ WD+E+DG WE P                    I+NP +KG+WK   IDNPNY+G W   +I NP Y+ D   +  T++  VG ++W + S   FDN ++T D E A R    +W  +  +A   +   F +    AE+R +
Sbjct:  134 GLVLKSRAKHHAISSPLSKPYIFKDRPLVVQYEVNFQDGIDCGGAYIKLLSDSPDLDLEQFHDRTPYSIMFGPDKCGEDYKL-HFIFRHKNPLNEDFEEKHAKRADADLRKVYSDKKTHLFTLVLNPDNSYEIFIDQSSASKGNLLTDVIPPVNPPKEIDDPKDTKPEDWDERAKIPDPEAVKPDDWDEEAPAMIPDPDALKPDGWLDEEPEFVPDPTATKPDDWDEEMDGEWEAPQVPNPACQTAPGCGEWKSPTINNPKYKGKWKAPLIDNPNYQGVWSPRKILNPDYFEDLEPFKMTAVRAVGLELWSMTSDIYFDNFIITADKEVADRWAADSWGLKKLVASANEPGVFTQLTLAAEERPW 497          
BLAST of Calreticulin vs. Ensembl Sea Lamprey
Match: calr (calreticulin [Source:ZFIN;Acc:ZDB-GENE-030131-4042])

HSP 1 Score: 381.333 bits (978), Expect = 1.503e-130
Identity = 188/331 (56.80%), Postives = 234/331 (70.69%), Query Frame = 2
Query:  107 RWVESTYRGIDQGKFQLGTGKHFGDYWKERGLQTSQNSKFYGIATKFKTPFNNSLKPLVIQYQVKMDEYVQCGGGYIKLLGTDFDPLSFHGHTPYKIMFGPDICGTNKKMVHVILNYKEKYYLTKKDIRCMDDKFSHLYTLIIFPNNTYSVLIDNNQVEGGKLEDDWDLLPPKKVKDPNAMKPVDWVDNDKIDDPNDFKPE---EWDQPKTIPDNTVKKPNKWDDEVDGVWEPPLISNPNFKGEWKPKKIDNPNYKGPWIHPEIDNPHYYLDHNLYLQTSIGGVGFDIWQVVSGTIFDNILLTDDPETALRIGETTWRVALAEEKKNFEFQ 1090
            RWV S ++  D GKF L  GK +GD  K++GLQTSQ+++FY ++  F + F+N  K LVIQ+ VK ++ + CGGGYIKL   D +    HG + Y IMFGPDICG   K VHVI NYK K +L  KDIRC DD+++HLYTLI+ P+ TY V IDN +VE G LE+DWD+LP KK+KDP A KP DW D  KIDDP D KPE   +W++P+ IPD   KKP  WDDE+DG WEPP++ NP +KGEWKP++IDNP YKG W+HPEIDNP Y  D N+YL  +IG +G D+WQV SGTIFD+ L+TDD + A  IGE TW V    EKK  E Q
Sbjct:   37 RWVVSKHKS-DYGKFVLSAGKFYGDAEKDKGLQTSQDARFYALSAGFDS-FSNKDKTLVIQFTVKHEQNIDCGGGYIKLFPKDMNQEEMHGDSQYFIMFGPDICGPGTKKVHVIFNYKGKNHLINKDIRCKDDEYTHLYTLIVRPDQTYEVKIDNKKVESGSLEEDWDILPAKKIKDPEAHKPEDWEDQSKIDDPTDVKPEPTKDWEKPEHIPDPDAKKPEDWDDEMDGEWEPPMVENPEYKGEWKPRQIDNPKYKGVWVHPEIDNPEYAPDSNIYLSENIGVIGLDLWQVKSGTIFDSFLITDDEKYAETIGEETWGVTKEGEKKMKEAQ 365          
BLAST of Calreticulin vs. Ensembl Sea Lamprey
Match: calr3b (calreticulin 3b [Source:ZFIN;Acc:ZDB-GENE-030131-9907])

HSP 1 Score: 360.147 bits (923), Expect = 8.440e-122
Identity = 173/338 (51.18%), Postives = 235/338 (69.53%), Query Frame = 2
Query:  107 RWVESTYRGIDQGKFQLGTGKHFGDYWKERGLQTSQNSKFYGIATKFKTPFNNSLKPLVIQYQVKMDEYVQCGGGYIKLLGTDFDPLSFHGHTPYKIMF--GPDICGTNKKMVHVILNYKEKYYLTKKDIRCMDDKFSHLYTLIIFPNNTYSVLIDNNQVEGGKLEDDWDLLPPKKVKDPNAMKPVDWVDNDKIDDPNDFKP----EEWDQPKTIPDNTVKKPNKWDDEVDGVWEPPLISNPNFKGEWKPKKIDNPNYKGPWIHPEIDNPHYYLDHNLYLQTSIGGVGFDIWQVVSGTIFDNILLTDDPETALRIGETTWRVALAEEKKNFEFQRNHE 1102
            RWVES ++  D GK +L  G  +GD  +++GLQT+Q+ +FY I+  F  PF+N  + LV+Q+ VK ++ + CGGGY+KL   + D    HG + Y +MF  GPDICG   K VHVI+NYK K +L  KDIRC DD+F+HLYTL++ P+ TY V ID  +VE G LEDDWD+LPP++V+DP A++P DW +   IDDP+D K     ++WDQP+ IPD   KKP+ WDDE+DG WEPP++ NP+FK EWKPK+I NP+YKG W+HP+IDNP +  D N+Y   +IG +G D+WQV SGTIFDN L+TDD + A  + + TW +    E+K  E +R  E
Sbjct:   35 RWVESQHKS-DYGKMRLSAGAFYGDAERDKGLQTTQDVRFYAISAAF-PPFSNKGRTLVLQFSVKHEQDIDCGGGYVKLFPAELDQQDMHGDSRYYLMFAEGPDICGPGTKKVHVIINYKGKNHLINKDIRCRDDEFTHLYTLVLRPDQTYEVKIDGERVESGSLEDDWDVLPPRRVEDPAAVRPDDWDERPSIDDPHDTKKPDRGQDWDQPEHIPDPDAKKPDDWDDEMDGEWEPPMVENPDFKSEWKPKQISNPDYKGTWVHPKIDNPDFASDPNIYYFDNIGVLGLDLWQVKSGTIFDNFLITDDEQYAEEVAKKTWGLTKDAERKMKEERRKRE 370          
BLAST of Calreticulin vs. Ensembl Sea Lamprey
Match: si:ch211-274f20.2 (si:ch211-274f20.2 [Source:ZFIN;Acc:ZDB-GENE-091204-91])

HSP 1 Score: 199.519 bits (506), Expect = 1.019e-57
Identity = 119/368 (32.34%), Postives = 187/368 (50.82%), Query Frame = 2
Query:  191 ERGLQTSQNSKFYGIATKFKTPFNNSLKPLVIQYQVKMDEYVQCGGGYIKLLG--TDFDPLSFHGHTPYKIMFGPDICGTNKKMVHVILNYK-------EKYYLTKKDIRC---MDDKFSHLYTLIIFPNNTYSVLIDNNQVEGGKLEDDWD--LLPPKKVKDPNAMKPVDWVDNDKIDDPNDFKPEEWDQ---------------------PKTIPDNTVKKPNKWDDEVDG-------------------VWEPPLISNPNFKGEWKPKKIDNPNYKGPWIHPEIDNPHYYLDHNLYLQTSIGGVGFDIWQVVSGTIFDNILLTDDPETALRIGETTW---RVALAEEKKNFEFQRNHELAEQRKY 1123
            ++GL     +K + IA     PF+   KPL++QY+V     ++CGG Y+KLL    D D   F+  TPY IMFGPD CG + K+ H I+ ++       E+ +  K D+       DK  HLY+L++ P+N Y +LID   V  G L +D    + P ++++DP+  KP DW +  KI DP+  KPE+WD+                     P+   D    KP  WD+E+DG                   VW+ P++SNP +KG+WKP  IDNPNY+G W   +I NP ++ D + +  T+   +G ++W + S  +FDN ++  +   A +    +W   R A A ++      + ++ AE+R +
Sbjct:  162 DKGLVLKTRAKHHAIAGALTRPFHFIDKPLIVQYEVNFQNGIECGGAYVKLLSGNADLDLTKFYDKTPYTIMFGPDKCGEDYKL-HFIMRHRNPKTGTYEEKHAKKSDVDLKPYYTDKKPHLYSLVLSPDNRYEILIDQTVVGSGSLLEDMTPPVNPAREIEDPDDSKPEDWDERAKIPDPDAIKPEDWDEDAPAQISDPDAVKPEGWLDDEPEYTADPEAVKPEDWDEEMDGEWEAPQVPNPTCEAAPGCGVWKAPMVSNPAYKGKWKPSNIDNPNYQGVWKPRKIANPDFFEDLHPFRLTAFNAIGLELWSMTSDILFDNFIVCSERAVADQWAADSWGLKRQAAAADEPGI-VMKLYQAAEERPW 527          
BLAST of Calreticulin vs. Ensembl Yeast
Match: CNE1 (Calnexin; integral membrane ER chaperone involved in folding and quality control of glycoproteins; chaperone activity is inhibited by Mpd1p, with which Cne1p interacts; 24% identical to mammalian calnexin; Ca+ binding not yet shown in yeast [Source:SGD;Acc:S000000054])

HSP 1 Score: 130.954 bits (328), Expect = 6.825e-34
Identity = 104/364 (28.57%), Postives = 159/364 (43.68%), Query Frame = 2
Query:  143 GKFQLGTGKHFGDYWKERGLQTSQNSKFYGIATKFKTPFNNS-LKPLVIQYQVKMDEYVQCGGGYIKLLGTDFDPLSFHGHTP----YKIMFGPDICGTNKKMVHVILNYKEKY-------YLTKKDI-RCMDDKFSHLYTLIIFPN-NTYSVLIDNNQV-------EGGKLEDDWDLLPPKKVKDPNAMKPVDWVDNDKIDDPNDFK-------------------PEEWDQ--PKTIPDNTVKKPNKWDDEVDGVWEPPLISNP-------------------NFKGEWKPKKIDNPNYKGPWIHPEIDNPHYYLD-HNLYLQTSIGGVGFDIWQVVSGTIFDNILLTDDPETALRIGETTW 1048
             +++L  G+  G  W ++G+     +    I    +TP N S    LV+QY++K+D  + CGG +IKL+    +  +   + P     +++FGPD C      V   +N  +K        YL +  + +  D   SHLYTLII  +  ++ +LID   V       +  K+  +  + PP  + D +  KP DW D  +I DP   K                   P EW+   P+ I D   +KP+ W +   G W PP+I NP                    +KG  +  +I NPNY G W  PEI+NP YY + H L ++  I GV  + W      +  NI +  +   A  IG  TW
Sbjct:   66 AQWRLSQGRLQGSAW-DKGIAVRTGNAAAMIGHLLETPINVSETDTLVVQYEIKLDNSLTCGGAFIKLMSGFMNVEALKHYAPDTEGVELVFGPDYCAPEINGVQFAINKVDKITHESKLRYLQEMPLSKLTDTSQSHLYTLIIDESAQSFQILIDGKTVMVREHIEDKKKVNFEPPITPPLMIPDVSVAKPHDWDDRIRIPDPEAVKLSDRDERDPLMIPHPDGTEPPEWNSSIPEYILDPNAQKPSWWKELEHGEWIPPMIKNPLCTAERGCGQQIPGLINNAKYKGPGELNEIINPNYMGEWHPPEIENPLYYEEQHPLRIENVISGVILEFWSGSPNMLISNIYVGKNVTEAQIIGNKTW 428          
BLAST of Calreticulin vs. Ensembl Nematostella
Match: EDO48109 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK57])

HSP 1 Score: 403.29 bits (1035), Expect = 2.474e-139
Identity = 191/323 (59.13%), Postives = 233/323 (72.14%), Query Frame = 2
Query:  107 RWVESTYRGIDQGKFQLGTGKHFGDYWKERGLQTSQNSKFYGIATKFKTPFNNSLKPLVIQYQVKMDEYVQCGGGYIKLLGTDFDPLSFHGHTPYKIMFGPDICGTNKKMVHVILNYKEKYYLTKKDIRCMDDKFSHLYTLIIFPNNTYSVLIDNNQVEGGKLEDDWDLLPPKKVKDPNAMKPVDWVDNDKIDDPNDFKPEEWDQPKTIPDNTVKKPNKWDDEVDGVWEPPLISNPNFKGEWKPKKIDNPNYKGPWIHPEIDNPHYYLDHNLYLQTSIGGVGFDIWQVVSGTIFDNILLTDDPETALRIGETTWRVALAEEKK 1075
            RWV ST +G  QGKF+   GK +GD   ++G+QTS+++KFYGI+ KF+ PF N  K LVIQ+ VK ++ + CGGGY K+  +D D  + HG +PY IMFGPDICG   K VHVI NYK K  LTKKDIRC DD+ +HLYTLI+ P+NTY V IDN +VE G+LE DWD LPPK +KDP A KP DW D   IDDP D KPE+WD+P+ IPD   KKP  WDDE+DG WEPP+I NP +KGEWKPK+IDNPNYKG W+HPEIDNP Y  D  LY+   IG +GFD+WQV SGTIFDN+L+TD  E A +  + T+      EKK
Sbjct:    5 RWVSSTSKGAQQGKFKWTAGKFYGDAEADKGIQTSEDAKFYGISAKFEKPFTNEGKTLVIQFSVKHEQNIDCGGGYAKVFPSDVDQKNLHGDSPYLIMFGPDICGPGTKKVHVIFNYKGKNLLTKKDIRCKDDEMTHLYTLIVRPDNTYEVKIDNEKVESGELEKDWDFLPPKTIKDPEAKKPEDWDDKKMIDDPEDKKPEDWDKPQNIPDPDAKKPEDWDDEIDGEWEPPMIDNPEYKGEWKPKQIDNPNYKGEWVHPEIDNPEYKADDKLYMYKDIGAIGFDLWQVKSGTIFDNVLVTDSVEHAEQFAKETFDKTKEGEKK 327          
BLAST of Calreticulin vs. Ensembl Nematostella
Match: EDO49786 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFV3])

HSP 1 Score: 203.371 bits (516), Expect = 1.121e-60
Identity = 119/337 (35.31%), Postives = 175/337 (51.93%), Query Frame = 2
Query:  197 GLQTSQNSKFYGIATKFKTPFNNSLKPLVIQYQVKMDEYVQCGGGYIKLL--GTDFDPLSFHGHTPYKIMFGPDICGTNKKMVHVILNYKEKYYLTKKDIRC----------MDDKFSHLYTLIIFPNNTYSVLIDNNQVEGGKLEDDWD--LLPPKKVKDPNAMKPVDWVDNDKIDDPNDFKPEEWDQ--PKTIPDNTVKKPNKW-DDEVD------------------------------------GVWEPPLISNPNFKGEWKPKKIDNPNYKGPWIHPEIDNPHYYLDHNLYLQTSIGGVGFDIWQVVSGTIFDNILLTDDPETALRIGETTW 1048
            GL     ++ + IA      F+ + KP ++QY+VK  + ++CGG Y+KLL  G  F P SF   TPY IMFGPD CG ++K+ H I  +K     T ++              D K +HL+TL++ P+NT+ V ID   V  G L +D    + PP +++DP+  +P DW + +KI DP+  KP++WD+  P  IPD   KKP  W DDE +                                    G W+PP+  NP +KG+W    IDNPNYKG W    I NPH++ D   +  TSI GVG ++W + S  +FDN+++T+D   A +  + +W
Sbjct:   37 GLVLKSRARHHAIAAHLDKKFDFTDKPFIVQYEVKFQQPMECGGAYLKLLSDGQGFKPESFGDKTPYTIMFGPDKCGEDRKL-HFIFRHKNPKNGTIEEKHAKKPTGNYNSVFDGKKTHLFTLVVRPDNTFEVFIDQESVNKGSLLEDMTPPVNPPAEIEDPDDKRPEDWDEREKIPDPDAEKPDDWDEDAPVKIPDTNAKKPEGWLDDEPEYVPDPNGIKPEDWDDEEDGEWEAPQIANPKCEKVGCGEWKPPMADNPEYKGKWSAPLIDNPNYKGIWKPRLIPNPHFFEDKEPFKMTSIVGVGLELWSMTSDILFDNVIVTNDKAVADKWAQDSW 372          
BLAST of Calreticulin vs. Ensembl Medaka
Match: ENSORLT00000003653.2 (calreticulin [Source:NCBI gene;Acc:101160304])

HSP 1 Score: 391.734 bits (1005), Expect = 1.235e-133
Identity = 182/330 (55.15%), Postives = 244/330 (73.94%), Query Frame = 2
Query:  107 RWVESTYRGIDQGKFQLGTGKHFGDYWKERGLQTSQNSKFYGIATKFKTPFNNSLKPLVIQYQVKMDEYVQCGGGYIKLLGTDFDPLSFHGHTPYKIMFGPDICGTNKKMVHVILNYKEKYYLTKKDIRCMDDKFSHLYTLIIFPNNTYSVLIDNNQVEGGKLEDDWDLLPPKKVKDPNAMKPVDWVDNDKIDDPNDFKPEEWDQPKTIPDNTVKKPNKWDDEVDGVWEPPLISNPNFKGEWKPKKIDNPNYKGPWIHPEIDNPHYYLDHNLYLQTSIGGVGFDIWQVVSGTIFDNILLTDDPETALRIGETTWRVALAEEKKNFEFQRN 1096
            RW+ES ++  D G+++L +GK +GD   ++G+QTSQ+++FY ++ +F  PF+N  K LVIQ+ VK ++ + CGGGY+K+  +D D    HG + Y +MFGPDICG + K VHVI NYK + +L KKDI+C DD+ +HLYTLI+ P+ TY V IDN +VE G LEDDWD+LPPKK+KDP+A KP DW D   IDDP+D KPE+WDQP+TIPD   KKP+ WD+++DG WEPP+I+NP FKGEWKPK++ NPNYKG W+HPE+DNP Y  D N+YL  +IG +G D+WQV SGTIFDN L+TDD + A  + + TW V    EKK  + Q +
Sbjct:   35 RWLESKHKS-DYGQWKLSSGKFYGDAEADKGVQTSQDARFYALSARF-PPFSNEGKTLVIQFTVKHEQKIDCGGGYVKVFPSDLDQSDMHGDSKYYVMFGPDICGYSTKKVHVIFNYKGQNHLIKKDIKCKDDELTHLYTLILNPDQTYEVRIDNEKVESGSLEDDWDMLPPKKIKDPDAKKPSDWDDRATIDDPSDTKPEDWDQPETIPDPDAKKPDDWDEDMDGEWEPPMITNPEFKGEWKPKQMSNPNYKGAWVHPEVDNPEYAPDANMYLFDNIGVLGLDLWQVKSGTIFDNFLITDDIKEAEEVAKETWEVTKGPEKKMRDDQED 362          
BLAST of Calreticulin vs. Ensembl Medaka
Match: calr3b (calreticulin [Source:NCBI gene;Acc:101169735])

HSP 1 Score: 379.022 bits (972), Expect = 9.527e-129
Identity = 179/323 (55.42%), Postives = 234/323 (72.45%), Query Frame = 2
Query:  107 RWVESTYRGIDQGKFQLGTGKHFGDYWKERGLQTSQNSKFYGIATKFKTPFNNSLKPLVIQYQVKMDEYVQCGGGYIKLLGTDFDPLSFHGHTPYKIMFGPDICGTNKKMVHVILNYKEKYYLTKKDIRCMDDKFSHLYTLIIFPNNTYSVLIDNNQVEGGKLEDDWDLLPPKKVKDPNAMKPVDWVDNDKIDDPNDFKPEEWDQPKTIPDNTVKKPNKWDDEVDGVWEPPLISNPNFKGEWKPKKIDNPNYKGPWIHPEIDNPHYYLDHNLYLQTSIGGVGFDIWQVVSGTIFDNILLTDDPETALRIGETTWRVALAEEKK 1075
            RWV S ++  D G+++L  G  +GD  K++GLQTSQ+++FY  + +F+ PF+N  K LVIQ+ VK ++ + CGGGY+K+  +D D    HG + Y +MFGPDICG   K VHVI NYK K +L KK+I+C DD+F+HLYTLI+ P+ TY V IDN +VE G LE+DWD LPPKK+KDP A KP DW D  KIDDP D KPE+W++P+ IPD   KKP  W +++DG WEPP+ISNP +KGEWKPK+IDNP+YKG W+HPEIDNP Y  D N+Y   SIG +G D+WQV SGT+FDN L+TDD + A  +G+ TW      E+K
Sbjct:   35 RWVNSKHKS-DYGEWKLTAGNFYGDAEKDKGLQTSQDARFYAASARFE-PFSNEGKSLVIQFTVKHEQKIDCGGGYVKVFPSDLDQTDMHGDSSYYVMFGPDICGYTTKKVHVIFNYKGKNHLIKKEIKCKDDEFTHLYTLILNPDQTYQVKIDNEKVESGSLEEDWDFLPPKKIKDPEAKKPEDWDDRPKIDDPEDTKPEDWEKPEYIPDPDAKKPEDWQEDMDGEWEPPMISNPEYKGEWKPKQIDNPDYKGAWVHPEIDNPEYSPDANIYKFDSIGVLGLDLWQVKSGTVFDNFLITDDVKEAEDVGKETWGATKEPEQK 355          
BLAST of Calreticulin vs. Ensembl Medaka
Match: calr3b (calreticulin [Source:NCBI gene;Acc:101169735])

HSP 1 Score: 348.977 bits (894), Expect = 1.650e-117
Identity = 168/323 (52.01%), Postives = 224/323 (69.35%), Query Frame = 2
Query:  107 RWVESTYRGIDQGKFQLGTGKHFGDYWKERGLQTSQNSKFYGIATKFKTPFNNSLKPLVIQYQVKMDEYVQCGGGYIKLLGTDFDPLSFHGHTPYKIMFGPDICGTNKKMVHVILNYKEKYYLTKKDIRCMDDKFSHLYTLIIFPNNTYSVLIDNNQVEGGKLEDDWDLLPPKKVKDPNAMKPVDWVDNDKIDDPNDFKPEEWDQPKTIPDNTVKKPNKWDDEVDGVWEPPLISNPNFKGEWKPKKIDNPNYKGPWIHPEIDNPHYYLDHNLYLQTSIGGVGFDIWQVVSGTIFDNI-LLTDDPETALRIGETTWRVALAEEK 1072
            RWV S ++  D G+++L  G  +GD  K++GLQTSQ+++FY  + +F+ PF+N  K LVIQ+ VK ++ + CGGGY+K+  +D D    HG + Y +MFGPDICG   K VHVI NYK K +L KK+I+C DD+F+HLYTLI+ P+ TY V IDN +VE G LE+DWD LPPKK+KDP A KP DW D  KIDDP D KPE+W++P+ IPD   KKP  W +++DG WEPP+ISNP +KGEWKPK+IDNP+YKG W+HPEIDNP Y  D N+Y   SIG +G D+WQ  +     +  L   +PE  ++  +   +    EEK
Sbjct:   13 RWVNSKHKS-DYGEWKLTAGNFYGDAEKDKGLQTSQDARFYAASARFE-PFSNEGKSLVIQFTVKHEQKIDCGGGYVKVFPSDLDQTDMHGDSSYYVMFGPDICGYTTKKVHVIFNYKGKNHLIKKEIKCKDDEFTHLYTLILNPDQTYQVKIDNEKVESGSLEEDWDFLPPKKIKDPEAKKPEDWDDRPKIDDPEDTKPEDWEKPEYIPDPDAKKPEDWQEDMDGEWEPPMISNPEYKGEWKPKQIDNPDYKGAWVHPEIDNPEYSPDANIYKFDSIGVLGLDLWQSRNRIKLCSFSLFLQEPEQKMKQEQDELKRKDEEEK 333          
BLAST of Calreticulin vs. Ensembl Medaka
Match: ENSORLT00000021485.3 (calreticulin [Source:NCBI gene;Acc:101162115])

HSP 1 Score: 295.049 bits (754), Expect = 2.544e-96
Identity = 154/328 (46.95%), Postives = 199/328 (60.67%), Query Frame = 2
Query:  107 RWVESTYRGIDQGKFQLGTGKHFGDYWKERGLQTSQNSKFYGIATKFKTPFNNSLKPLVIQYQVKMDEYVQCGGGYIKLLGTDFDPLSFHGHTPYKIMFGPDICGTNKKMVHVILNYKEKYYLTKKDIRCMDDKFSHLYTLIIFPNNTYSVLIDNNQVEGGKLEDDWDLLPPKKVKDPNAMKPVDWVDNDKIDDPNDFKPEEWDQPKTIPDNTVKKPNKWDDEVDGVWEPPLISNPNFKGEWKPKKIDNPNYKGPWIHPEIDNPHYYLDHNLYLQTSIGGVGFDIWQVVSGTIFDNILLTDDPETALRIGETTWRVALAEEKKNFEFQ 1090
            RW+ES ++  D G+  L  GK +GD  K++GLQTSQ++ FY  + +F   F+N  +PLVIQ+ VK ++ + CGGGYIKL  ++ +    HG + Y IMFGPDICG   K VHVI NYK K +L  KDIRC DD+F+HLYTL++ P+NTY V IDN +VE G LE+DWD LPPKK+KDP+A KP DW D +KI DP+D KPE+WD+P+ IPD   KKP  WDDE+DG WEPP+I+NP++K                                                V SGTIFDN L+T+DP  A  +G  TW      E+K  E Q
Sbjct:   37 RWIESKHKS-DYGQLVLTAGKFYGDGEKDKGLQTSQDAHFYASSARFDD-FSNKGQPLVIQFTVKHEQSIDCGGGYIKLFPSELNQEDMHGDSVYNIMFGPDICGPGTKKVHVIFNYKGKNHLINKDIRCKDDEFTHLYTLVVNPDNTYEVKIDNKKVESGNLEEDWDFLPPKKIKDPDAKKPEDWDDREKIPDPDDKKPEDWDKPENIPDPDAKKPEDWDDEMDGEWEPPMIANPDYK------------------------------------------------VKSGTIFDNFLITNDPNLAEEVGNDTWGKTKDAERKMKESQ 314          
BLAST of Calreticulin vs. Ensembl Medaka
Match: canx (calnexin [Source:NCBI gene;Acc:101165199])

HSP 1 Score: 196.823 bits (499), Expect = 2.750e-56
Identity = 122/347 (35.16%), Postives = 176/347 (50.72%), Query Frame = 2
Query:  191 ERGLQTSQNSKFYGIATKFKTPFNNSLKPLVIQYQVKMDEYVQCGGGYIKLLGT--DFDPLSFHGHTPYKIMFGPDICGTNKKMVHVILNYK-------EKYYLTK--KDIRC-MDDKFSHLYTLIIFPNNTYSVLIDNNQVEGGKLEDDWD--LLPPKKVKDPNAMKPVDWVDNDKIDDPNDFKPEEWDQ--PKTIPD-NTVK------------------KPNKWDDEVDGVWEPP-------------------LISNPNFKGEWKPKKIDNPNYKGPWIHPEIDNPHYYLDHNLYLQTSIGGVGFDIWQVVSGTIFDNILLTDDPETALRIGETTWRVALAEE 1069
            ++GL     +K + I+ +   PF    KPL++QY+V     + CGG Y+KLL    + +   F   TPY IMFGPD CG + K+ H I  +K       E+ +  K   D+R    DK +HL++L++ P+N++ VL+D   V  G L  D    + PP +++DP   KP DW +  KI DP+  KPE+WD+  P  IPD N VK                  KP+ WD+++DG WE P                   +I NPN KG+WK   IDNPNY+G W   +I NP ++ D   +  T+   VG ++W + S   FDN  +T+D  TA R     W +  A E
Sbjct:  137 DKGLVLKSRAKHHAISARLLRPFTFDTKPLIVQYEVNFQSGIDCGGAYVKLLTETPELNLDQFVDRTPYTIMFGPDKCGEDYKL-HFIFRHKNPKTGEYEEKHAKKPDADLRSYFTDKKTHLFSLVVNPDNSFEVLVDQTVVNSGNLLKDMTPPVNPPAEIEDPEDHKPEDWDERPKIQDPDAVKPEDWDEDAPAQIPDDNAVKPDGWLDDEPEYIGDPDAVKPDDWDEDMDGEWEAPQIPNPACESAPGCGEWKRPMIDNPNHKGKWKAPMIDNPNYQGIWKPRKIPNPAFFEDLEPFRMTAFSAVGLELWSMTSDIFFDNFFITNDRNTADRWAADGWGLKKAAE 482          
BLAST of Calreticulin vs. Planmine SMEST
Match: SMESG000039107.1 (SMESG000039107.1)

HSP 1 Score: 757.673 bits (1955), Expect = 0.000e+0
Identity = 414/414 (100.00%), Postives = 414/414 (100.00%), Query Frame = 2
Query:   14 MRKIIFLLFAMXXXXXXXXXXXXXXXXXXXXRWVESTYRGIDQGKFQLGTGKHFGDYWKERGLQTSQNSKFYGIATKFKTPFNNSLKPLVIQYQVKMDEYVQCGGGYIKLLGTDFDPLSFHGHTPYKIMFGPDICGTNKKMVHVILNYKEKYYLTKKDIRCMDDKFSHLYTLIIFPNNTYSVLIDNNQVEGGKLEDDWDLLPPKKVKDPNAMKPVDWVDNDKIDDPNDFKPEEWDQPKTIPDNTVKKPNKWDDEVDGVWEPPLISNPNFKGEWKPKKIDNPNYKGPWIHPEIDNPHYYLDHNLYLQTSIGGVGFDIWQVVSGTIFDNILLTDDPETALRIGETTWRVALAEEKKNFEFQRNHELAEQRKYKKIXXXXXXXXXXXXXXXXXXXWFPTRCISPFGRKLLEVSGWLL 1255
            MRKIIFLLFAMENIFCEIYFYEEFFDESYTERWVESTYRGIDQGKFQLGTGKHFGDYWKERGLQTSQNSKFYGIATKFKTPFNNSLKPLVIQYQVKMDEYVQCGGGYIKLLGTDFDPLSFHGHTPYKIMFGPDICGTNKKMVHVILNYKEKYYLTKKDIRCMDDKFSHLYTLIIFPNNTYSVLIDNNQVEGGKLEDDWDLLPPKKVKDPNAMKPVDWVDNDKIDDPNDFKPEEWDQPKTIPDNTVKKPNKWDDEVDGVWEPPLISNPNFKGEWKPKKIDNPNYKGPWIHPEIDNPHYYLDHNLYLQTSIGGVGFDIWQVVSGTIFDNILLTDDPETALRIGETTWRVALAEEKKNFEFQRNHELAEQRKYKKISDDNDSDEAFDDDEDNRDNWFPTRCISPFGRKLLEVSGWLL
Sbjct:    1 MRKIIFLLFAMENIFCEIYFYEEFFDESYTERWVESTYRGIDQGKFQLGTGKHFGDYWKERGLQTSQNSKFYGIATKFKTPFNNSLKPLVIQYQVKMDEYVQCGGGYIKLLGTDFDPLSFHGHTPYKIMFGPDICGTNKKMVHVILNYKEKYYLTKKDIRCMDDKFSHLYTLIIFPNNTYSVLIDNNQVEGGKLEDDWDLLPPKKVKDPNAMKPVDWVDNDKIDDPNDFKPEEWDQPKTIPDNTVKKPNKWDDEVDGVWEPPLISNPNFKGEWKPKKIDNPNYKGPWIHPEIDNPHYYLDHNLYLQTSIGGVGFDIWQVVSGTIFDNILLTDDPETALRIGETTWRVALAEEKKNFEFQRNHELAEQRKYKKISDDNDSDEAFDDDEDNRDNWFPTRCISPFGRKLLEVSGWLL 414          
BLAST of Calreticulin vs. Planmine SMEST
Match: SMESG000039107.1 (SMESG000039107.1)

HSP 1 Score: 751.895 bits (1940), Expect = 0.000e+0
Identity = 408/412 (99.03%), Postives = 410/412 (99.51%), Query Frame = 2
Query:   14 MRKIIFLLFAMXXXXXXXXXXXXXXXXXXXXRWVESTYRGIDQGKFQLGTGKHFGDYWKERGLQTSQNSKFYGIATKFKTPFNNSLKPLVIQYQVKMDEYVQCGGGYIKLLGTDFDPLSFHGHTPYKIMFGPDICGTNKKMVHVILNYKEKYYLTKKDIRCMDDKFSHLYTLIIFPNNTYSVLIDNNQVEGGKLEDDWDLLPPKKVKDPNAMKPVDWVDNDKIDDPNDFKPEEWDQPKTIPDNTVKKPNKWDDEVDGVWEPPLISNPNFKGEWKPKKIDNPNYKGPWIHPEIDNPHYYLDHNLYLQTSIGGVGFDIWQVVSGTIFDNILLTDDPETALRIGETTWRVALAEEKKNFEFQRNHELAEQRKYKKIXXXXXXXXXXXXXXXXXXXWFPTRCISPFGRKLLEVSGW 1249
            MRKIIFLLFAMENIFCEIYFYEEFFDESYTERWVESTYRGIDQGKFQLGTGKHFGDYWKERGLQTSQNSKFYGIATKFKTPFNNSLKPLVIQYQVKMDEYVQCGGGYIKLLGTDFDPLSFHGHTPYKIMFGPDICGTNKKMVHVILNYKEKYYLTKKDIRCMDDKFSHLYTLIIFPNNTYSVLIDNNQVEGGKLEDDWDLLPPKKVKDPNAMKPVDWVDNDKIDDPNDFKPEEWDQPKTIPDNTVKKPNKWDDEVDGVWEPPLISNPNFKGEWKPKKIDNPNYKGPWIHPEIDNPHYYLDHNLYLQTSIGGVGFDIWQVVSGTIFDNILLTDDPETALRIGETTWRVALAEEKKNFEFQRNHELAEQRKYKKISDDNDSDEAFDDDEDNRDNWFPTRCISPFGRKLLE+  +
Sbjct:    1 MRKIIFLLFAMENIFCEIYFYEEFFDESYTERWVESTYRGIDQGKFQLGTGKHFGDYWKERGLQTSQNSKFYGIATKFKTPFNNSLKPLVIQYQVKMDEYVQCGGGYIKLLGTDFDPLSFHGHTPYKIMFGPDICGTNKKMVHVILNYKEKYYLTKKDIRCMDDKFSHLYTLIIFPNNTYSVLIDNNQVEGGKLEDDWDLLPPKKVKDPNAMKPVDWVDNDKIDDPNDFKPEEWDQPKTIPDNTVKKPNKWDDEVDGVWEPPLISNPNFKGEWKPKKIDNPNYKGPWIHPEIDNPHYYLDHNLYLQTSIGGVGFDIWQVVSGTIFDNILLTDDPETALRIGETTWRVALAEEKKNFEFQRNHELAEQRKYKKISDDNDSDEAFDDDEDNRDNWFPTRCISPFGRKLLEICEY 412          
BLAST of Calreticulin vs. Planmine SMEST
Match: SMESG000039107.1 (SMESG000039107.1)

HSP 1 Score: 742.265 bits (1915), Expect = 0.000e+0
Identity = 383/383 (100.00%), Postives = 383/383 (100.00%), Query Frame = 2
Query:  107 RWVESTYRGIDQGKFQLGTGKHFGDYWKERGLQTSQNSKFYGIATKFKTPFNNSLKPLVIQYQVKMDEYVQCGGGYIKLLGTDFDPLSFHGHTPYKIMFGPDICGTNKKMVHVILNYKEKYYLTKKDIRCMDDKFSHLYTLIIFPNNTYSVLIDNNQVEGGKLEDDWDLLPPKKVKDPNAMKPVDWVDNDKIDDPNDFKPEEWDQPKTIPDNTVKKPNKWDDEVDGVWEPPLISNPNFKGEWKPKKIDNPNYKGPWIHPEIDNPHYYLDHNLYLQTSIGGVGFDIWQVVSGTIFDNILLTDDPETALRIGETTWRVALAEEKKNFEFQRNHELAEQRKYKKIXXXXXXXXXXXXXXXXXXXWFPTRCISPFGRKLLEVSGWLL 1255
            RWVESTYRGIDQGKFQLGTGKHFGDYWKERGLQTSQNSKFYGIATKFKTPFNNSLKPLVIQYQVKMDEYVQCGGGYIKLLGTDFDPLSFHGHTPYKIMFGPDICGTNKKMVHVILNYKEKYYLTKKDIRCMDDKFSHLYTLIIFPNNTYSVLIDNNQVEGGKLEDDWDLLPPKKVKDPNAMKPVDWVDNDKIDDPNDFKPEEWDQPKTIPDNTVKKPNKWDDEVDGVWEPPLISNPNFKGEWKPKKIDNPNYKGPWIHPEIDNPHYYLDHNLYLQTSIGGVGFDIWQVVSGTIFDNILLTDDPETALRIGETTWRVALAEEKKNFEFQRNHELAEQRKYKKISDDNDSDEAFDDDEDNRDNWFPTRCISPFGRKLLEVSGWLL
Sbjct:   22 RWVESTYRGIDQGKFQLGTGKHFGDYWKERGLQTSQNSKFYGIATKFKTPFNNSLKPLVIQYQVKMDEYVQCGGGYIKLLGTDFDPLSFHGHTPYKIMFGPDICGTNKKMVHVILNYKEKYYLTKKDIRCMDDKFSHLYTLIIFPNNTYSVLIDNNQVEGGKLEDDWDLLPPKKVKDPNAMKPVDWVDNDKIDDPNDFKPEEWDQPKTIPDNTVKKPNKWDDEVDGVWEPPLISNPNFKGEWKPKKIDNPNYKGPWIHPEIDNPHYYLDHNLYLQTSIGGVGFDIWQVVSGTIFDNILLTDDPETALRIGETTWRVALAEEKKNFEFQRNHELAEQRKYKKISDDNDSDEAFDDDEDNRDNWFPTRCISPFGRKLLEVSGWLL 404          
BLAST of Calreticulin vs. Planmine SMEST
Match: SMESG000039107.1 (SMESG000039107.1)

HSP 1 Score: 736.487 bits (1900), Expect = 0.000e+0
Identity = 377/381 (98.95%), Postives = 379/381 (99.48%), Query Frame = 2
Query:  107 RWVESTYRGIDQGKFQLGTGKHFGDYWKERGLQTSQNSKFYGIATKFKTPFNNSLKPLVIQYQVKMDEYVQCGGGYIKLLGTDFDPLSFHGHTPYKIMFGPDICGTNKKMVHVILNYKEKYYLTKKDIRCMDDKFSHLYTLIIFPNNTYSVLIDNNQVEGGKLEDDWDLLPPKKVKDPNAMKPVDWVDNDKIDDPNDFKPEEWDQPKTIPDNTVKKPNKWDDEVDGVWEPPLISNPNFKGEWKPKKIDNPNYKGPWIHPEIDNPHYYLDHNLYLQTSIGGVGFDIWQVVSGTIFDNILLTDDPETALRIGETTWRVALAEEKKNFEFQRNHELAEQRKYKKIXXXXXXXXXXXXXXXXXXXWFPTRCISPFGRKLLEVSGW 1249
            RWVESTYRGIDQGKFQLGTGKHFGDYWKERGLQTSQNSKFYGIATKFKTPFNNSLKPLVIQYQVKMDEYVQCGGGYIKLLGTDFDPLSFHGHTPYKIMFGPDICGTNKKMVHVILNYKEKYYLTKKDIRCMDDKFSHLYTLIIFPNNTYSVLIDNNQVEGGKLEDDWDLLPPKKVKDPNAMKPVDWVDNDKIDDPNDFKPEEWDQPKTIPDNTVKKPNKWDDEVDGVWEPPLISNPNFKGEWKPKKIDNPNYKGPWIHPEIDNPHYYLDHNLYLQTSIGGVGFDIWQVVSGTIFDNILLTDDPETALRIGETTWRVALAEEKKNFEFQRNHELAEQRKYKKISDDNDSDEAFDDDEDNRDNWFPTRCISPFGRKLLE+  +
Sbjct:   22 RWVESTYRGIDQGKFQLGTGKHFGDYWKERGLQTSQNSKFYGIATKFKTPFNNSLKPLVIQYQVKMDEYVQCGGGYIKLLGTDFDPLSFHGHTPYKIMFGPDICGTNKKMVHVILNYKEKYYLTKKDIRCMDDKFSHLYTLIIFPNNTYSVLIDNNQVEGGKLEDDWDLLPPKKVKDPNAMKPVDWVDNDKIDDPNDFKPEEWDQPKTIPDNTVKKPNKWDDEVDGVWEPPLISNPNFKGEWKPKKIDNPNYKGPWIHPEIDNPHYYLDHNLYLQTSIGGVGFDIWQVVSGTIFDNILLTDDPETALRIGETTWRVALAEEKKNFEFQRNHELAEQRKYKKISDDNDSDEAFDDDEDNRDNWFPTRCISPFGRKLLEICEY 402          
BLAST of Calreticulin vs. Planmine SMEST
Match: SMESG000039107.1 (SMESG000039107.1)

HSP 1 Score: 718.383 bits (1853), Expect = 0.000e+0
Identity = 373/373 (100.00%), Postives = 373/373 (100.00%), Query Frame = 2
Query:   14 MRKIIFLLFAMXXXXXXXXXXXXXXXXXXXXRWVESTYRGIDQGKFQLGTGKHFGDYWKERGLQTSQNSKFYGIATKFKTPFNNSLKPLVIQYQVKMDEYVQCGGGYIKLLGTDFDPLSFHGHTPYKIMFGPDICGTNKKMVHVILNYKEKYYLTKKDIRCMDDKFSHLYTLIIFPNNTYSVLIDNNQVEGGKLEDDWDLLPPKKVKDPNAMKPVDWVDNDKIDDPNDFKPEEWDQPKTIPDNTVKKPNKWDDEVDGVWEPPLISNPNFKGEWKPKKIDNPNYKGPWIHPEIDNPHYYLDHNLYLQTSIGGVGFDIWQVVSGTIFDNILLTDDPETALRIGETTWRVALAEEKKNFEFQRNHELAEQRKYKKI 1132
            MRKIIFLLFAMENIFCEIYFYEEFFDESYTERWVESTYRGIDQGKFQLGTGKHFGDYWKERGLQTSQNSKFYGIATKFKTPFNNSLKPLVIQYQVKMDEYVQCGGGYIKLLGTDFDPLSFHGHTPYKIMFGPDICGTNKKMVHVILNYKEKYYLTKKDIRCMDDKFSHLYTLIIFPNNTYSVLIDNNQVEGGKLEDDWDLLPPKKVKDPNAMKPVDWVDNDKIDDPNDFKPEEWDQPKTIPDNTVKKPNKWDDEVDGVWEPPLISNPNFKGEWKPKKIDNPNYKGPWIHPEIDNPHYYLDHNLYLQTSIGGVGFDIWQVVSGTIFDNILLTDDPETALRIGETTWRVALAEEKKNFEFQRNHELAEQRKYKKI
Sbjct:    1 MRKIIFLLFAMENIFCEIYFYEEFFDESYTERWVESTYRGIDQGKFQLGTGKHFGDYWKERGLQTSQNSKFYGIATKFKTPFNNSLKPLVIQYQVKMDEYVQCGGGYIKLLGTDFDPLSFHGHTPYKIMFGPDICGTNKKMVHVILNYKEKYYLTKKDIRCMDDKFSHLYTLIIFPNNTYSVLIDNNQVEGGKLEDDWDLLPPKKVKDPNAMKPVDWVDNDKIDDPNDFKPEEWDQPKTIPDNTVKKPNKWDDEVDGVWEPPLISNPNFKGEWKPKKIDNPNYKGPWIHPEIDNPHYYLDHNLYLQTSIGGVGFDIWQVVSGTIFDNILLTDDPETALRIGETTWRVALAEEKKNFEFQRNHELAEQRKYKKI 373          
The following BLAST results are available for this feature:
BLAST of Calreticulin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CALR3.872e-13157.28calreticulin [Source:HGNC Symbol;Acc:HGNC:1455][more]
CALR2.686e-7964.48calreticulin [Source:HGNC Symbol;Acc:HGNC:1455][more]
CALR31.929e-7742.99calreticulin 3 [Source:HGNC Symbol;Acc:HGNC:20407][more]
CLGN3.932e-5834.81calmegin [Source:HGNC Symbol;Acc:HGNC:2060][more]
CLGN3.932e-5834.81calmegin [Source:HGNC Symbol;Acc:HGNC:2060][more]
back to top
BLAST of Calreticulin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
crt-12.583e-11856.48Calreticulin [Source:UniProtKB/Swiss-Prot;Acc:P27... [more]
crt-12.583e-11856.48Calreticulin [Source:UniProtKB/Swiss-Prot;Acc:P27... [more]
cnx-11.092e-5233.62Calnexin [Source:UniProtKB/Swiss-Prot;Acc:P34652][more]
cnx-14.507e-3532.25Calnexin [Source:UniProtKB/Swiss-Prot;Acc:P34652][more]
back to top
BLAST of Calreticulin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Calr1.805e-12653.24gene:FBgn0005585 transcript:FBtr0334618[more]
Calr1.805e-12653.24gene:FBgn0005585 transcript:FBtr0082103[more]
Cnx99A1.802e-5734.69gene:FBgn0015622 transcript:FBtr0334873[more]
Cnx99A2.825e-5735.09gene:FBgn0015622 transcript:FBtr0085438[more]
Cnx99A2.825e-5735.09gene:FBgn0015622 transcript:FBtr0085437[more]
back to top
BLAST of Calreticulin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
calr1.999e-13556.93calreticulin [Source:ZFIN;Acc:ZDB-GENE-030131-4042... [more]
calr3a2.675e-12855.73calreticulin 3a [Source:ZFIN;Acc:ZDB-GENE-000208-1... [more]
calr3b4.668e-12355.10calreticulin 3b [Source:ZFIN;Acc:ZDB-GENE-030131-9... [more]
clgn1.844e-5734.91calmegin [Source:ZFIN;Acc:ZDB-GENE-060929-708][more]
canx8.105e-5735.16calnexin [Source:ZFIN;Acc:ZDB-GENE-040426-2797][more]
back to top
BLAST of Calreticulin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
calr8.076e-12956.40calreticulin [Source:NCBI gene;Acc:407962][more]
calr1.507e-12856.40calreticulin [Source:NCBI gene;Acc:407962][more]
calr2.388e-12856.40calreticulin [Source:NCBI gene;Acc:407962][more]
calr2.802e-12856.40calreticulin [Source:NCBI gene;Acc:407962][more]
calr4.800e-12856.40calreticulin [Source:NCBI gene;Acc:407962][more]
back to top
BLAST of Calreticulin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Calr4.599e-13358.20calreticulin [Source:MGI Symbol;Acc:MGI:88252][more]
Calr43.273e-10950.64calreticulin 4 [Source:MGI Symbol;Acc:MGI:2140435][more]
Calr43.519e-8053.98calreticulin 4 [Source:MGI Symbol;Acc:MGI:2140435][more]
Calr43.519e-8053.98calreticulin 4 [Source:MGI Symbol;Acc:MGI:2140435][more]
Calr43.519e-8053.98calreticulin 4 [Source:MGI Symbol;Acc:MGI:2140435][more]
back to top
BLAST of Calreticulin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P15253|CALR_RABIT2.250e-13256.08Calreticulin OS=Oryctolagus cuniculus OX=9986 GN=C... [more]
sp|P14211|CALR_MOUSE3.217e-13258.20Calreticulin OS=Mus musculus OX=10090 GN=Calr PE=1... [more]
sp|P52193|CALR_BOVIN7.199e-13257.89Calreticulin OS=Bos taurus OX=9913 GN=CALR PE=1 SV... [more]
sp|Q8K3H7|CALR_CRIGR9.552e-13257.89Calreticulin OS=Cricetulus griseus OX=10029 GN=CAL... [more]
sp|P18418|CALR_RAT1.443e-13157.89Calreticulin OS=Rattus norvegicus OX=10116 GN=Calr... [more]
back to top
BLAST of Calreticulin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V9XRS22.207e-14663.47Calreticulin OS=Schmidtea mediterranea OX=79327 PE... [more]
A0A1I8HX986.825e-14662.50Calreticulin OS=Macrostomum lignano OX=282301 GN=B... [more]
A0A267GGU37.447e-14662.50Calreticulin OS=Macrostomum lignano OX=282301 GN=B... [more]
A0A1I8I1821.380e-14562.50Calreticulin OS=Macrostomum lignano OX=282301 PE=3... [more]
A0A267FN871.125e-14462.20Calreticulin OS=Macrostomum lignano OX=282301 GN=B... [more]
back to top
BLAST of Calreticulin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000019127.25.646e-13458.51calreticulin-like [Source:NCBI gene;Acc:103024869][more]
calr3b9.529e-12855.42calreticulin-like [Source:NCBI gene;Acc:103040817][more]
ENSAMXT00000022283.21.508e-12455.41pep primary_assembly:Astyanax_mexicanus-2.0:5:2505... [more]
clgn1.178e-5833.97calnexin [Source:NCBI gene;Acc:103035256][more]
clgn1.570e-5833.97calnexin [Source:NCBI gene;Acc:103035256][more]
back to top
BLAST of Calreticulin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
calr1.503e-13056.80calreticulin [Source:ZFIN;Acc:ZDB-GENE-030131-4042... [more]
calr3b8.440e-12251.18calreticulin 3b [Source:ZFIN;Acc:ZDB-GENE-030131-9... [more]
si:ch211-274f20.21.019e-5732.34si:ch211-274f20.2 [Source:ZFIN;Acc:ZDB-GENE-091204... [more]
back to top
BLAST of Calreticulin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
CNE16.825e-3428.57Calnexin; integral membrane ER chaperone involved ... [more]
back to top
BLAST of Calreticulin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO481092.474e-13959.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO497861.121e-6035.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Calreticulin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000003653.21.235e-13355.15calreticulin [Source:NCBI gene;Acc:101160304][more]
calr3b9.527e-12955.42calreticulin [Source:NCBI gene;Acc:101169735][more]
calr3b1.650e-11752.01calreticulin [Source:NCBI gene;Acc:101169735][more]
ENSORLT00000021485.32.544e-9646.95calreticulin [Source:NCBI gene;Acc:101162115][more]
canx2.750e-5635.16calnexin [Source:NCBI gene;Acc:101165199][more]
back to top
BLAST of Calreticulin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000039107.10.000e+0100.00SMESG000039107.1[more]
SMESG000039107.10.000e+099.03SMESG000039107.1[more]
SMESG000039107.10.000e+0100.00SMESG000039107.1[more]
SMESG000039107.10.000e+098.95SMESG000039107.1[more]
SMESG000039107.10.000e+0100.00SMESG000039107.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024652 ID=SMED30024652|Name=Calreticulin|organism=Schmidtea mediterranea sexual|type=transcript|length=1338bp
TTAATCTCAAATAATGAGAAAAATAATTTTCTTATTGTTTGCTATGGAAA
ATATCTTTTGTGAAATTTATTTTTACGAAGAATTTTTTGACGAGTCATAT
ACAGAAAGATGGGTCGAGTCAACTTATCGCGGAATCGACCAAGGAAAGTT
TCAATTAGGAACTGGAAAACATTTTGGTGACTATTGGAAAGAAAGGGGTT
TGCAGACATCACAGAATTCAAAGTTTTATGGAATTGCAACAAAATTTAAA
ACACCATTTAATAATTCCCTAAAACCTCTCGTAATTCAGTATCAAGTGAA
AATGGACGAGTATGTTCAATGTGGCGGGGGCTATATCAAGTTATTGGGTA
CTGATTTTGATCCTCTTTCGTTTCATGGACACACTCCATACAAAATTATG
TTTGGACCGGATATATGTGGAACAAATAAAAAGATGGTCCACGTTATTTT
GAACTATAAAGAAAAGTATTACCTAACGAAAAAAGATATCAGATGTATGG
ATGACAAATTCTCACATTTGTATACTTTAATTATTTTTCCTAACAATACG
TACAGCGTATTAATTGATAACAATCAAGTTGAAGGAGGAAAACTAGAAGA
TGATTGGGATTTGCTGCCCCCTAAAAAAGTGAAGGATCCTAATGCAATGA
AACCTGTAGATTGGGTAGACAATGATAAGATTGACGATCCAAATGACTTC
AAACCGGAAGAATGGGATCAACCTAAAACTATTCCAGATAATACTGTTAA
AAAACCAAATAAATGGGATGATGAAGTTGATGGAGTTTGGGAACCTCCTT
TAATAAGCAATCCAAACTTTAAAGGTGAATGGAAACCAAAAAAGATTGAT
AATCCAAACTATAAGGGTCCCTGGATTCATCCGGAGATTGATAATCCACA
TTACTATCTCGACCATAATTTATATTTGCAAACTTCAATAGGAGGCGTTG
GCTTTGATATTTGGCAGGTGGTATCTGGAACCATATTTGATAATATTTTA
TTGACTGATGATCCAGAAACGGCGCTCAGAATAGGTGAAACAACATGGAG
AGTTGCATTAGCGGAAGAAAAGAAAAACTTTGAATTTCAAAGAAATCATG
AATTAGCAGAACAACGAAAATATAAAAAGATATCGGACGATAACGATTCA
GATGAAGCTTTTGACGATGATGAGGATAATAGGGACAATTGGTTCCCAAC
CAGGTGTATATCTCCCTTTGGGCGAAAACTACTGGAAGTGAGCGGCTGGC
TTTTATAAAGACATGCTAAATTATTAAAAAATATTTGCTATGATTTACTG
TAAAATGATATTGTTTAAGGATATTTTAATTGGATTAT
back to top

protein sequence of SMED30024652-orf-1

>SMED30024652-orf-1 ID=SMED30024652-orf-1|Name=SMED30024652-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=415bp
MRKIIFLLFAMENIFCEIYFYEEFFDESYTERWVESTYRGIDQGKFQLGT
GKHFGDYWKERGLQTSQNSKFYGIATKFKTPFNNSLKPLVIQYQVKMDEY
VQCGGGYIKLLGTDFDPLSFHGHTPYKIMFGPDICGTNKKMVHVILNYKE
KYYLTKKDIRCMDDKFSHLYTLIIFPNNTYSVLIDNNQVEGGKLEDDWDL
LPPKKVKDPNAMKPVDWVDNDKIDDPNDFKPEEWDQPKTIPDNTVKKPNK
WDDEVDGVWEPPLISNPNFKGEWKPKKIDNPNYKGPWIHPEIDNPHYYLD
HNLYLQTSIGGVGFDIWQVVSGTIFDNILLTDDPETALRIGETTWRVALA
EEKKNFEFQRNHELAEQRKYKKISDDNDSDEAFDDDEDNRDNWFPTRCIS
PFGRKLLEVSGWLL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005788endoplasmic reticulum lumen
GO:0005783endoplasmic reticulum
Vocabulary: molecular function
TermDefinition
GO:0046872metal ion binding
GO:0005509calcium ion binding
GO:0051082unfolded protein binding
GO:0005515protein binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR001580Calret/calnex
IPR009169Calreticulin
IPR013320ConA-like_dom_sf
IPR018124Calret/calnex_CS
IPR009033Calreticulin/calnexin_P_dom_sf
Vocabulary: biological process
TermDefinition
GO:0006457protein folding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001580Calreticulin/calnexinPRINTSPR00626CALRETICULINcoord: 240..262
score: 56.83
coord: 213..226
score: 58.64
coord: 311..331
score: 50.06
coord: 98..116
score: 43.57
coord: 124..140
score: 67.85
coord: 278..297
score: 69.3
IPR001580Calreticulin/calnexinPFAMPF00262Calreticulincoord: 257..330
e-value: 6.1E-23
score: 81.3
coord: 20..255
e-value: 1.5E-57
score: 195.2
IPR001580Calreticulin/calnexinPANTHERPTHR11073CALRETICULIN AND CALNEXINcoord: 14..390
IPR009033Calreticulin/calnexin, P domain superfamilyGENE3DG3DSA:2.10.250.10coord: 206..276
e-value: 2.1E-25
score: 90.8
IPR009033Calreticulin/calnexin, P domain superfamilySUPERFAMILYSSF63887P-domain of calnexin/calreticulincoord: 199..311
IPR009169CalreticulinPIRSFPIRSF002356Calreticulincoord: 1..396
e-value: 5.4E-158
score: 523.5
NoneNo IPR availableGENE3DG3DSA:2.60.120.200coord: 17..205
e-value: 2.7E-63
score: 215.7
coord: 291..372
e-value: 1.0E-12
score: 50.1
NoneNo IPR availablePANTHERPTHR11073:SF16CALRETICULINcoord: 14..390
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..16
score: 0.479
IPR018124Calreticulin/calnexin, conserved sitePROSITEPS00803CALRETICULIN_1coord: 96..111
IPR018124Calreticulin/calnexin, conserved sitePROSITEPS00804CALRETICULIN_2coord: 128..136
IPR013320Concanavalin A-like lectin/glucanase domain superfamilySUPERFAMILYSSF49899Concanavalin A-like lectins/glucanasescoord: 18..345