RRM domain-containing protein

Overview
NameRRM domain-containing protein
Smed IDSMED30024648
Length (bp)438
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of RRM domain-containing protein (SMED30024648) t-SNE clustered cells

Violin plots show distribution of expression levels for RRM domain-containing protein (SMED30024648) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of RRM domain-containing protein (SMED30024648) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for RRM domain-containing protein (SMED30024648) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024648

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
tail regionSMED30024648h1SMcG0011376 dd_Smed_v4_1672_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30024648h1SMcG0011376 SmedASXL_067061SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30024648h1SMcG0011376 dd_Smed_v4_11998_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30024648h1SMcG0011376 dd_Smed_v4_11998_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30024648h1SMcG0011376 dd_Smed_v4_11998_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30024648h1SMcG0011376 dd_Smed_v4_1672_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30024648h1SMcG0011376 dd_Smed_v6_11998_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of RRM domain-containing protein vs. Ensembl Human
Match: SF3B6 (splicing factor 3b subunit 6 [Source:HGNC Symbol;Acc:HGNC:30096])

HSP 1 Score: 114.005 bits (284), Expect = 6.998e-33
Identity = 49/93 (52.69%), Postives = 73/93 (78.49%), Query Frame = 2
Query:   26 IAMAQSKK-KIQLPPEVSKMLLIKNLPNQMQKDELYTIFRKYGSIRQIRLGESSDTKGTGFVVFENILDAKTACDHLSGFKLMDNYIVVVYFT 301
            +AM  +K+  I+LPPEV+++L I+NLP ++  +E+Y IF KYG IRQIR+G + +T+GT +VV+E+I DAK ACDHLSGF + + Y+VV+Y+ 
Sbjct:    1 MAMQAAKRANIRLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRVGNTPETRGTAYVVYEDIFDAKNACDHLSGFNVCNRYLVVLYYN 93          
BLAST of RRM domain-containing protein vs. Ensembl Human
Match: SNRPA (small nuclear ribonucleoprotein polypeptide A [Source:HGNC Symbol;Acc:HGNC:11151])

HSP 1 Score: 44.2838 bits (103), Expect = 3.159e-6
Identity = 23/68 (33.82%), Postives = 35/68 (51.47%), Query Frame = 2
Query:   83 LLIKNLPNQMQKDEL----YTIFRKYGSIRQIRLGESSDTKGTGFVVFENILDAKTACDHLSGFKLMD 274
            + I NL  +++KDEL    Y IF ++G I  I +  S   +G  FV+F+ +  A  A   + GF   D
Sbjct:   12 IYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYD 79          
BLAST of RRM domain-containing protein vs. Ensembl Human
Match: SNRPA (small nuclear ribonucleoprotein polypeptide A [Source:HGNC Symbol;Acc:HGNC:11151])

HSP 1 Score: 45.0542 bits (105), Expect = 4.926e-6
Identity = 24/75 (32.00%), Postives = 38/75 (50.67%), Query Frame = 2
Query:   83 LLIKNLPNQMQKDEL----YTIFRKYGSIRQIRLGESSDTKGTGFVVFENILDAKTACDHLSGFKLMDNYIVVVY 295
            + I NL  +++KDEL    Y IF ++G I  I +  S   +G  FV+F+ +  A  A   + GF   D  + + Y
Sbjct:   12 IYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQY 86          
BLAST of RRM domain-containing protein vs. Ensembl Human
Match: SNRPA (small nuclear ribonucleoprotein polypeptide A [Source:HGNC Symbol;Acc:HGNC:11151])

HSP 1 Score: 45.0542 bits (105), Expect = 5.285e-6
Identity = 24/75 (32.00%), Postives = 38/75 (50.67%), Query Frame = 2
Query:   83 LLIKNLPNQMQKDEL----YTIFRKYGSIRQIRLGESSDTKGTGFVVFENILDAKTACDHLSGFKLMDNYIVVVY 295
            + I NL  +++KDEL    Y IF ++G I  I +  S   +G  FV+F+ +  A  A   + GF   D  + + Y
Sbjct:   12 IYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQY 86          
BLAST of RRM domain-containing protein vs. Ensembl Human
Match: SNRPA (small nuclear ribonucleoprotein polypeptide A [Source:HGNC Symbol;Acc:HGNC:11151])

HSP 1 Score: 45.4394 bits (106), Expect = 7.503e-6
Identity = 24/75 (32.00%), Postives = 38/75 (50.67%), Query Frame = 2
Query:   83 LLIKNLPNQMQKDEL----YTIFRKYGSIRQIRLGESSDTKGTGFVVFENILDAKTACDHLSGFKLMDNYIVVVY 295
            + I NL  +++KDEL    Y IF ++G I  I +  S   +G  FV+F+ +  A  A   + GF   D  + + Y
Sbjct:   12 IYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQY 86          
BLAST of RRM domain-containing protein vs. Ensembl Celegans
Match: C50D2.5 (Splicing factor 3B subunit 6-like protein [Source:UniProtKB/Swiss-Prot;Acc:Q8ITY4])

HSP 1 Score: 114.39 bits (285), Expect = 2.571e-33
Identity = 49/99 (49.49%), Postives = 77/99 (77.78%), Query Frame = 2
Query:   26 IAMAQSKKK-IQLPPEVSKMLLIKNLPNQMQKDELYTIFRKYGSIRQIRLGESSDTKGTGFVVFENILDAKTACDHLSGFKLMDNYIVVVYFTPYKIIK 319
            +AMA  + +  +LPPEV+++L IKNLP ++  +E+Y IF K+G++RQIR+G +++T+GT FVV+E+I DAKTAC+HLSG+ + + Y+VV+Y+   K  K
Sbjct:    1 MAMANRQNRGAKLPPEVNRILYIKNLPYKITTEEMYEIFGKFGAVRQIRVGNTAETRGTAFVVYEDIFDAKTACEHLSGYNVSNRYLVVLYYQATKAWK 99          
BLAST of RRM domain-containing protein vs. Ensembl Fly
Match: Sf3b6 (gene:FBgn0035692 transcript:FBtr0077015)

HSP 1 Score: 115.546 bits (288), Expect = 7.807e-34
Identity = 48/92 (52.17%), Postives = 71/92 (77.17%), Query Frame = 2
Query:   44 KKKIQLPPEVSKMLLIKNLPNQMQKDELYTIFRKYGSIRQIRLGESSDTKGTGFVVFENILDAKTACDHLSGFKLMDNYIVVVYFTPYKIIK 319
            +  I+LPPEV+++L ++NLP ++  DE+Y IF K+G+IRQIR+G + +T+GT FVV+E+I DAK ACDHLSGF + + Y+VV+Y+   K  K
Sbjct:    4 RNHIRLPPEVNRLLYVRNLPYKITSDEMYDIFGKFGAIRQIRVGNTPETRGTAFVVYEDIFDAKNACDHLSGFNVCNRYLVVLYYQSNKAFK 95          
BLAST of RRM domain-containing protein vs. Ensembl Fly
Match: elav (gene:FBgn0260400 transcript:FBtr0307173)

HSP 1 Score: 45.8246 bits (107), Expect = 3.088e-6
Identity = 38/111 (34.23%), Postives = 54/111 (48.65%), Query Frame = 2
Query:   83 LLIKNLPNQMQKDELYTIFRKYGSIRQIRL----GESSDTKGTGFVVFENILDAKTACDHLSGFKLMD-NYIVVVYFTPYKIIKVNTPGSLS--IKHQLPSALPPAISKII 394
            L +  LP  M + EL  IF  +G+I   R+    G  + TKG GF+ F+   +A  A   L+G         +VV F+       NTPGS S  I+ QLP+ L P + + I
Sbjct:  250 LYVSGLPKTMTQQELEAIFAPFGAIITSRILQNAGNDTQTKGVGFIRFDKREEATRAIIALNGTTPSSCTDPIVVKFS-------NTPGSTSKIIQPQLPAFLNPQLVRRI 353          
BLAST of RRM domain-containing protein vs. Ensembl Fly
Match: elav (gene:FBgn0260400 transcript:FBtr0070091)

HSP 1 Score: 45.8246 bits (107), Expect = 3.088e-6
Identity = 38/111 (34.23%), Postives = 54/111 (48.65%), Query Frame = 2
Query:   83 LLIKNLPNQMQKDELYTIFRKYGSIRQIRL----GESSDTKGTGFVVFENILDAKTACDHLSGFKLMD-NYIVVVYFTPYKIIKVNTPGSLS--IKHQLPSALPPAISKII 394
            L +  LP  M + EL  IF  +G+I   R+    G  + TKG GF+ F+   +A  A   L+G         +VV F+       NTPGS S  I+ QLP+ L P + + I
Sbjct:  250 LYVSGLPKTMTQQELEAIFAPFGAIITSRILQNAGNDTQTKGVGFIRFDKREEATRAIIALNGTTPSSCTDPIVVKFS-------NTPGSTSKIIQPQLPAFLNPQLVRRI 353          
BLAST of RRM domain-containing protein vs. Ensembl Fly
Match: elav (gene:FBgn0260400 transcript:FBtr0100254)

HSP 1 Score: 45.8246 bits (107), Expect = 3.143e-6
Identity = 38/111 (34.23%), Postives = 54/111 (48.65%), Query Frame = 2
Query:   83 LLIKNLPNQMQKDELYTIFRKYGSIRQIRL----GESSDTKGTGFVVFENILDAKTACDHLSGFKLMD-NYIVVVYFTPYKIIKVNTPGSLS--IKHQLPSALPPAISKII 394
            L +  LP  M + EL  IF  +G+I   R+    G  + TKG GF+ F+   +A  A   L+G         +VV F+       NTPGS S  I+ QLP+ L P + + I
Sbjct:  246 LYVSGLPKTMTQQELEAIFAPFGAIITSRILQNAGNDTQTKGVGFIRFDKREEATRAIIALNGTTPSSCTDPIVVKFS-------NTPGSTSKIIQPQLPAFLNPQLVRRI 349          
BLAST of RRM domain-containing protein vs. Ensembl Fly
Match: elav (gene:FBgn0260400 transcript:FBtr0114366)

HSP 1 Score: 45.8246 bits (107), Expect = 3.143e-6
Identity = 38/111 (34.23%), Postives = 54/111 (48.65%), Query Frame = 2
Query:   83 LLIKNLPNQMQKDELYTIFRKYGSIRQIRL----GESSDTKGTGFVVFENILDAKTACDHLSGFKLMD-NYIVVVYFTPYKIIKVNTPGSLS--IKHQLPSALPPAISKII 394
            L +  LP  M + EL  IF  +G+I   R+    G  + TKG GF+ F+   +A  A   L+G         +VV F+       NTPGS S  I+ QLP+ L P + + I
Sbjct:  246 LYVSGLPKTMTQQELEAIFAPFGAIITSRILQNAGNDTQTKGVGFIRFDKREEATRAIIALNGTTPSSCTDPIVVKFS-------NTPGSTSKIIQPQLPAFLNPQLVRRI 349          
BLAST of RRM domain-containing protein vs. Ensembl Zebrafish
Match: sf3b6 (splicing factor 3b, subunit 6 [Source:ZFIN;Acc:ZDB-GENE-040625-36])

HSP 1 Score: 114.005 bits (284), Expect = 4.452e-33
Identity = 49/93 (52.69%), Postives = 73/93 (78.49%), Query Frame = 2
Query:   26 IAMAQSKK-KIQLPPEVSKMLLIKNLPNQMQKDELYTIFRKYGSIRQIRLGESSDTKGTGFVVFENILDAKTACDHLSGFKLMDNYIVVVYFT 301
            +AM  +K+  I+LPPEV+++L I+NLP ++  +E+Y IF KYG IRQIR+G + +T+GT +VV+E+I DAK ACDHLSGF + + Y+VV+Y+ 
Sbjct:    1 MAMQAAKRANIRLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRVGNTPETRGTAYVVYEDIFDAKNACDHLSGFNVCNRYLVVLYYN 93          
BLAST of RRM domain-containing protein vs. Ensembl Zebrafish
Match: snrpa (small nuclear ribonucleoprotein polypeptide A [Source:ZFIN;Acc:ZDB-GENE-030131-2841])

HSP 1 Score: 45.8246 bits (107), Expect = 3.199e-6
Identity = 25/75 (33.33%), Postives = 38/75 (50.67%), Query Frame = 2
Query:   83 LLIKNLPNQMQKDEL----YTIFRKYGSIRQIRLGESSDTKGTGFVVFENILDAKTACDHLSGFKLMDNYIVVVY 295
            + I NL  +++KDEL    Y IF ++G I  I +  +   KG  FV+F+ I  A  A   + GF   D  + + Y
Sbjct:   12 IYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRTLKMKGQAFVIFKEINSASNALRSMQGFPFYDKPMRIQY 86          
BLAST of RRM domain-containing protein vs. Ensembl Zebrafish
Match: snrpa (small nuclear ribonucleoprotein polypeptide A [Source:ZFIN;Acc:ZDB-GENE-030131-2841])

HSP 1 Score: 45.8246 bits (107), Expect = 3.199e-6
Identity = 25/75 (33.33%), Postives = 38/75 (50.67%), Query Frame = 2
Query:   83 LLIKNLPNQMQKDEL----YTIFRKYGSIRQIRLGESSDTKGTGFVVFENILDAKTACDHLSGFKLMDNYIVVVY 295
            + I NL  +++KDEL    Y IF ++G I  I +  +   KG  FV+F+ I  A  A   + GF   D  + + Y
Sbjct:   12 IYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRTLKMKGQAFVIFKEINSASNALRSMQGFPFYDKPMRIQY 86          
BLAST of RRM domain-containing protein vs. Ensembl Zebrafish
Match: pabpc1b (poly A binding protein, cytoplasmic 1 b [Source:ZFIN;Acc:ZDB-GENE-050308-1])

HSP 1 Score: 45.8246 bits (107), Expect = 4.815e-6
Identity = 27/69 (39.13%), Postives = 38/69 (55.07%), Query Frame = 2
Query:   89 IKNLPNQMQKDELYTIFRKYGSIRQIRL--GESSDTKGTGFVVFENILDAKTACDHLSGFKLMDNYIVV 289
            IKN    M  D+L  IF KYG+   IR+   E+  ++G GFV FE   DA+ A D ++G ++    I V
Sbjct:  195 IKNFGEDMDDDKLKDIFSKYGNAMSIRVMTDENGKSRGFGFVSFERHEDAQRAVDEMNGKEMNGKLIYV 263          
BLAST of RRM domain-containing protein vs. Ensembl Zebrafish
Match: snrpa (small nuclear ribonucleoprotein polypeptide A [Source:ZFIN;Acc:ZDB-GENE-030131-2841])

HSP 1 Score: 45.4394 bits (106), Expect = 4.951e-6
Identity = 25/75 (33.33%), Postives = 38/75 (50.67%), Query Frame = 2
Query:   83 LLIKNLPNQMQKDEL----YTIFRKYGSIRQIRLGESSDTKGTGFVVFENILDAKTACDHLSGFKLMDNYIVVVY 295
            + I NL  +++KDEL    Y IF ++G I  I +  +   KG  FV+F+ I  A  A   + GF   D  + + Y
Sbjct:   12 IYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRTLKMKGQAFVIFKEINSASNALRSMQGFPFYDKPMRIQY 86          
BLAST of RRM domain-containing protein vs. Ensembl Xenopus
Match: sf3b6 (splicing factor 3b subunit 6 [Source:NCBI gene;Acc:550003])

HSP 1 Score: 113.62 bits (283), Expect = 9.808e-33
Identity = 49/93 (52.69%), Postives = 73/93 (78.49%), Query Frame = 2
Query:   26 IAMAQSKK-KIQLPPEVSKMLLIKNLPNQMQKDELYTIFRKYGSIRQIRLGESSDTKGTGFVVFENILDAKTACDHLSGFKLMDNYIVVVYFT 301
            +AM  +K+  I+LPPEV+++L I+NLP ++  +E+Y IF KYG IRQIR+G + +T+GT +VV+E+I DAK ACDHLSGF + + Y+VV+Y+ 
Sbjct:    1 MAMQAAKRANIRLPPEVNRILYIRNLPYKITGEEMYDIFGKYGPIRQIRVGNTPETRGTAYVVYEDIFDAKNACDHLSGFNVCNRYLVVLYYN 93          
BLAST of RRM domain-containing protein vs. Ensembl Xenopus
Match: sf3b6 (splicing factor 3b subunit 6 [Source:NCBI gene;Acc:550003])

HSP 1 Score: 112.079 bits (279), Expect = 3.170e-32
Identity = 47/85 (55.29%), Postives = 68/85 (80.00%), Query Frame = 2
Query:   47 KKIQLPPEVSKMLLIKNLPNQMQKDELYTIFRKYGSIRQIRLGESSDTKGTGFVVFENILDAKTACDHLSGFKLMDNYIVVVYFT 301
            K I+LPPEV+++L I+NLP ++  +E+Y IF KYG IRQIR+G + +T+GT +VV+E+I DAK ACDHLSGF + + Y+VV+Y+ 
Sbjct:    7 KGIRLPPEVNRILYIRNLPYKITGEEMYDIFGKYGPIRQIRVGNTPETRGTAYVVYEDIFDAKNACDHLSGFNVCNRYLVVLYYN 91          
BLAST of RRM domain-containing protein vs. Ensembl Xenopus
Match: tubgcp5 (tubulin gamma complex associated protein 5 [Source:Xenbase;Acc:XB-GENE-494053])

HSP 1 Score: 45.8246 bits (107), Expect = 5.376e-6
Identity = 25/75 (33.33%), Postives = 38/75 (50.67%), Query Frame = 2
Query:   83 LLIKNLPNQMQKDEL----YTIFRKYGSIRQIRLGESSDTKGTGFVVFENILDAKTACDHLSGFKLMDNYIVVVY 295
            + I NL  +++KDEL    Y IF ++G I  I +  S   +G  FV+F+ I  A  A   + GF   D  + + Y
Sbjct:   16 IYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQAFVIFKEISSATNALRSMQGFPFYDKPMRIQY 90          
BLAST of RRM domain-containing protein vs. Ensembl Xenopus
Match: tubgcp5 (tubulin gamma complex associated protein 5 [Source:Xenbase;Acc:XB-GENE-494053])

HSP 1 Score: 45.8246 bits (107), Expect = 5.397e-6
Identity = 25/75 (33.33%), Postives = 38/75 (50.67%), Query Frame = 2
Query:   83 LLIKNLPNQMQKDEL----YTIFRKYGSIRQIRLGESSDTKGTGFVVFENILDAKTACDHLSGFKLMDNYIVVVY 295
            + I NL  +++KDEL    Y IF ++G I  I +  S   +G  FV+F+ I  A  A   + GF   D  + + Y
Sbjct:   12 IYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQAFVIFKEISSATNALRSMQGFPFYDKPMRIQY 86          
BLAST of RRM domain-containing protein vs. Ensembl Mouse
Match: Sf3b6 (splicing factor 3B, subunit 6 [Source:MGI Symbol;Acc:MGI:1913305])

HSP 1 Score: 114.005 bits (284), Expect = 4.804e-33
Identity = 49/93 (52.69%), Postives = 73/93 (78.49%), Query Frame = 2
Query:   26 IAMAQSKK-KIQLPPEVSKMLLIKNLPNQMQKDELYTIFRKYGSIRQIRLGESSDTKGTGFVVFENILDAKTACDHLSGFKLMDNYIVVVYFT 301
            +AM  +K+  I+LPPEV+++L I+NLP ++  +E+Y IF KYG IRQIR+G + +T+GT +VV+E+I DAK ACDHLSGF + + Y+VV+Y+ 
Sbjct:    1 MAMQAAKRANIRLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRVGNTPETRGTAYVVYEDIFDAKNACDHLSGFNVCNRYLVVLYYN 93          
BLAST of RRM domain-containing protein vs. Ensembl Mouse
Match: Sf3b6 (splicing factor 3B, subunit 6 [Source:MGI Symbol;Acc:MGI:1913305])

HSP 1 Score: 111.309 bits (277), Expect = 3.295e-32
Identity = 46/83 (55.42%), Postives = 67/83 (80.72%), Query Frame = 2
Query:   53 IQLPPEVSKMLLIKNLPNQMQKDELYTIFRKYGSIRQIRLGESSDTKGTGFVVFENILDAKTACDHLSGFKLMDNYIVVVYFT 301
            I+LPPEV+++L I+NLP ++  +E+Y IF KYG IRQIR+G + +T+GT +VV+E+I DAK ACDHLSGF + + Y+VV+Y+ 
Sbjct:    1 IRLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRVGNTPETRGTAYVVYEDIFDAKNACDHLSGFNVCNRYLVVLYYN 83          
BLAST of RRM domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9VRV7|SF3B6_DROME (Splicing factor 3B subunit 6 OS=Drosophila melanogaster OX=7227 GN=Sf3b6 PE=1 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 7.826e-33
Identity = 48/92 (52.17%), Postives = 71/92 (77.17%), Query Frame = 2
Query:   44 KKKIQLPPEVSKMLLIKNLPNQMQKDELYTIFRKYGSIRQIRLGESSDTKGTGFVVFENILDAKTACDHLSGFKLMDNYIVVVYFTPYKIIK 319
            +  I+LPPEV+++L ++NLP ++  DE+Y IF K+G+IRQIR+G + +T+GT FVV+E+I DAK ACDHLSGF + + Y+VV+Y+   K  K
Sbjct:    4 RNHIRLPPEVNRLLYVRNLPYKITSDEMYDIFGKFGAIRQIRVGNTPETRGTAFVVYEDIFDAKNACDHLSGFNVCNRYLVVLYYQSNKAFK 95          
BLAST of RRM domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8ITY4|SF3B6_CAEEL (Splicing factor 3B subunit 6-like protein OS=Caenorhabditis elegans OX=6239 GN=C50D2.5 PE=3 SV=2)

HSP 1 Score: 114.39 bits (285), Expect = 3.271e-32
Identity = 49/99 (49.49%), Postives = 77/99 (77.78%), Query Frame = 2
Query:   26 IAMAQSKKK-IQLPPEVSKMLLIKNLPNQMQKDELYTIFRKYGSIRQIRLGESSDTKGTGFVVFENILDAKTACDHLSGFKLMDNYIVVVYFTPYKIIK 319
            +AMA  + +  +LPPEV+++L IKNLP ++  +E+Y IF K+G++RQIR+G +++T+GT FVV+E+I DAKTAC+HLSG+ + + Y+VV+Y+   K  K
Sbjct:    1 MAMANRQNRGAKLPPEVNRILYIKNLPYKITTEEMYEIFGKFGAVRQIRVGNTAETRGTAFVVYEDIFDAKTACEHLSGYNVSNRYLVVLYYQATKAWK 99          
BLAST of RRM domain-containing protein vs. UniProt/SwissProt
Match: sp|P59708|SF3B6_MOUSE (Splicing factor 3B subunit 6 OS=Mus musculus OX=10090 GN=Sf3b6 PE=1 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 3.360e-32
Identity = 49/93 (52.69%), Postives = 73/93 (78.49%), Query Frame = 2
Query:   26 IAMAQSKK-KIQLPPEVSKMLLIKNLPNQMQKDELYTIFRKYGSIRQIRLGESSDTKGTGFVVFENILDAKTACDHLSGFKLMDNYIVVVYFT 301
            +AM  +K+  I+LPPEV+++L I+NLP ++  +E+Y IF KYG IRQIR+G + +T+GT +VV+E+I DAK ACDHLSGF + + Y+VV+Y+ 
Sbjct:    1 MAMQAAKRANIRLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRVGNTPETRGTAYVVYEDIFDAKNACDHLSGFNVCNRYLVVLYYN 93          
BLAST of RRM domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9Y3B4|SF3B6_HUMAN (Splicing factor 3B subunit 6 OS=Homo sapiens OX=9606 GN=SF3B6 PE=1 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 3.360e-32
Identity = 49/93 (52.69%), Postives = 73/93 (78.49%), Query Frame = 2
Query:   26 IAMAQSKK-KIQLPPEVSKMLLIKNLPNQMQKDELYTIFRKYGSIRQIRLGESSDTKGTGFVVFENILDAKTACDHLSGFKLMDNYIVVVYFT 301
            +AM  +K+  I+LPPEV+++L I+NLP ++  +E+Y IF KYG IRQIR+G + +T+GT +VV+E+I DAK ACDHLSGF + + Y+VV+Y+ 
Sbjct:    1 MAMQAAKRANIRLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRVGNTPETRGTAYVVYEDIFDAKNACDHLSGFNVCNRYLVVLYYN 93          
BLAST of RRM domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9FMP4|SF3B6_ARATH (Splicing factor 3B subunit 6-like protein OS=Arabidopsis thaliana OX=3702 GN=At5g12190 PE=2 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 4.045e-29
Identity = 47/92 (51.09%), Postives = 67/92 (72.83%), Query Frame = 2
Query:   44 KKKIQLPPEVSKMLLIKNLPNQMQKDELYTIFRKYGSIRQIRLGESSDTKGTGFVVFENILDAKTACDHLSGFKLMDNYIVVVYFTPYKIIK 319
            K   +LPPEV+++L ++NLP  +  +E+Y IF KYG+IRQIR+G    TKGT FVV+E+I DAK A DHLSGF + + Y++V+Y+   K+ K
Sbjct:    8 KSNTRLPPEVNRVLYVRNLPFNITSEEMYDIFGKYGAIRQIRIGCDKATKGTAFVVYEDIYDAKNAVDHLSGFNVANRYLIVLYYQHAKMSK 99          
BLAST of RRM domain-containing protein vs. TrEMBL
Match: A0A1S3D7L5 (splicing factor 3B subunit 6 OS=Diaphorina citri OX=121845 GN=LOC103513105 PE=4 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 2.547e-35
Identity = 54/98 (55.10%), Postives = 77/98 (78.57%), Query Frame = 2
Query:   26 IAMAQSKKKIQLPPEVSKMLLIKNLPNQMQKDELYTIFRKYGSIRQIRLGESSDTKGTGFVVFENILDAKTACDHLSGFKLMDNYIVVVYFTPYKIIK 319
            +AM+Q +  ++LPPEV+++L I+NLP ++  DE+Y IF KYG+IRQIR+G + DT+GT FVV+E+I DAK ACDHLSGF + + Y+VV+Y+ P K  K
Sbjct:    1 MAMSQRRANVRLPPEVNRVLYIRNLPYKITGDEMYDIFGKYGAIRQIRIGNTPDTRGTAFVVYEDIFDAKNACDHLSGFNVCNRYLVVLYYQPNKAFK 98          
BLAST of RRM domain-containing protein vs. TrEMBL
Match: A0A1Y2BD33 (RNA-binding domain-containing protein OS=Neocallimastix californiae OX=1754190 GN=LY90DRAFT_705195 PE=4 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 1.411e-34
Identity = 53/95 (55.79%), Postives = 75/95 (78.95%), Query Frame = 2
Query:   35 AQSKKKIQLPPEVSKMLLIKNLPNQMQKDELYTIFRKYGSIRQIRLGESSDTKGTGFVVFENILDAKTACDHLSGFKLMDNYIVVVYFTPYKIIK 319
            A+++  I+LPPEV+++L ++NLP ++  DELY +F KYG+IRQIRLG ++DT+GT FVV+E+I DAK ACDHLSGF +M  Y++V+Y  P K  K
Sbjct:    5 AKARANIRLPPEVNRILFVRNLPFKITSDELYDLFGKYGAIRQIRLGNANDTRGTAFVVYEDIFDAKAACDHLSGFNIMGRYLIVLYHQPNKTHK 99          
BLAST of RRM domain-containing protein vs. TrEMBL
Match: A0A267DPF7 (RRM domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig028462g2 PE=4 SV=1)

HSP 1 Score: 126.331 bits (316), Expect = 1.528e-34
Identity = 57/105 (54.29%), Postives = 82/105 (78.10%), Query Frame = 2
Query:    8 CLQQSPIAMAQSKK-KIQLPPEVSKMLLIKNLPNQMQKDELYTIFRKYGSIRQIRLGESSDTKGTGFVVFENILDAKTACDHLSGFKLMDNYIVVVYFTPYKIIK 319
            CL + P +MA SK+  ++LPPEV+++LL+KNLP  +  +E+Y IF KYG+IRQIR+G + +T+GT FVV+E+I DAK ACDHLSGF + + Y+VV+Y+ P K+ K
Sbjct:    1 CLSKQP-SMALSKRLNVRLPPEVNRILLVKNLPFSISAEEMYDIFGKYGAIRQIRVGNTPETRGTAFVVYEDIFDAKNACDHLSGFNVCNRYLVVLYYQPTKVQK 104          
BLAST of RRM domain-containing protein vs. TrEMBL
Match: A0A1Y2AFM2 (RNA-binding domain-containing protein OS=Neocallimastix californiae OX=1754190 GN=LY90DRAFT_390703 PE=4 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 2.281e-34
Identity = 52/95 (54.74%), Postives = 75/95 (78.95%), Query Frame = 2
Query:   35 AQSKKKIQLPPEVSKMLLIKNLPNQMQKDELYTIFRKYGSIRQIRLGESSDTKGTGFVVFENILDAKTACDHLSGFKLMDNYIVVVYFTPYKIIK 319
            A+++  ++LPPEV+++L ++NLP ++  DELY +F KYG+IRQIRLG ++DT+GT FVV+E+I DAK ACDHLSGF +M  Y++V+Y  P K  K
Sbjct:    5 AKARANVRLPPEVNRILFVRNLPFKITSDELYDLFGKYGAIRQIRLGNANDTRGTAFVVYEDIFDAKAACDHLSGFNIMGRYLIVLYHQPNKTHK 99          
BLAST of RRM domain-containing protein vs. TrEMBL
Match: K1QS87 (Pre-mRNA branch site p14-like protein OS=Crassostrea gigas OX=29159 GN=CGI_10024678 PE=4 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 3.793e-34
Identity = 54/102 (52.94%), Postives = 79/102 (77.45%), Query Frame = 2
Query:   14 QQSPIAMAQSKKKIQLPPEVSKMLLIKNLPNQMQKDELYTIFRKYGSIRQIRLGESSDTKGTGFVVFENILDAKTACDHLSGFKLMDNYIVVVYFTPYKIIK 319
            ++S I  A +  K++LPPEV+++L ++NLP ++  +E+Y IF KYG+IRQIR+G +++TKGT FVV+E+I DAK ACDHLSGF + + Y+VV+YF P K  K
Sbjct:    9 EESRIKNAIASAKVRLPPEVNRILYVRNLPYKITAEEMYDIFGKYGAIRQIRVGNTTETKGTAFVVYEDIFDAKNACDHLSGFNVCNRYLVVLYFQPNKAFK 110          
BLAST of RRM domain-containing protein vs. Ensembl Cavefish
Match: sf3b6 (splicing factor 3b subunit 6 [Source:NCBI gene;Acc:103024112])

HSP 1 Score: 114.005 bits (284), Expect = 3.773e-33
Identity = 49/93 (52.69%), Postives = 73/93 (78.49%), Query Frame = 2
Query:   26 IAMAQSKK-KIQLPPEVSKMLLIKNLPNQMQKDELYTIFRKYGSIRQIRLGESSDTKGTGFVVFENILDAKTACDHLSGFKLMDNYIVVVYFT 301
            +AM  +K+  I+LPPEV+++L I+NLP ++  +E+Y IF KYG IRQIR+G + +T+GT +VV+E+I DAK ACDHLSGF + + Y+VV+Y+ 
Sbjct:    1 MAMQAAKRANIRLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRVGNTPETRGTAYVVYEDIFDAKNACDHLSGFNVCNRYLVVLYYN 93          
BLAST of RRM domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000018970.2 (polyadenylate-binding protein 1-like [Source:NCBI gene;Acc:103030422])

HSP 1 Score: 45.0542 bits (105), Expect = 8.034e-6
Identity = 27/69 (39.13%), Postives = 37/69 (53.62%), Query Frame = 2
Query:   89 IKNLPNQMQKDELYTIFRKYGSIRQIRL--GESSDTKGTGFVVFENILDAKTACDHLSGFKLMDNYIVV 289
            IKN    M  ++L  +F KYG    IR+   ES  +KG GFV FE   DA+ A D ++G +L    + V
Sbjct:  195 IKNFGEDMDDEKLKDVFGKYGPALSIRVMTDESGKSKGFGFVSFERHEDAQRAVDEMNGKELNGKQVYV 263          
BLAST of RRM domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006657.1 (pep scaffold:Pmarinus_7.0:GL484402:615:2775:1 gene:ENSPMAG00000006008.1 transcript:ENSPMAT00000006657.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 113.62 bits (283), Expect = 9.110e-34
Identity = 44/93 (47.31%), Postives = 75/93 (80.65%), Query Frame = 2
Query:   26 IAMAQSKKKIQLPPEVSKMLLIKNLPNQMQKDELYTIFRKYGSIRQIRLGESSDTKGTGFVVFENILDAKTACDHLSGFKLMDNYIVVVYFTP 304
            ++++  + +++LPPEV+++L ++NLP ++  +E+Y IF KYG+IRQIR+G + +++GT +VV+E+I DAK ACDHLSGF + + Y+VV+Y+ P
Sbjct:    2 VSVSCVRVQVRLPPEVNRILYVRNLPYKITAEEMYDIFGKYGAIRQIRVGTTPESRGTAYVVYEDIFDAKNACDHLSGFNVCNRYLVVLYYNP 94          
BLAST of RRM domain-containing protein vs. Ensembl Yeast
Match: NSR1 (Nucleolar protein that binds nuclear localization sequences; required for pre-rRNA processing and ribosome biogenesis; binds to single stranded telomeric DNA and mRNA; methylated by Hmt1p; interaction with Top1p and nucleolar localization are negatively regulated by polyphosphorylation [Source:SGD;Acc:S000003391])

HSP 1 Score: 51.2174 bits (121), Expect = 6.579e-9
Identity = 31/91 (34.07%), Postives = 49/91 (53.85%), Query Frame = 2
Query:   38 QSKKKIQLPPEVSKMLLIKNLPNQMQKDELYTIFRKYGSIRQIRLG---ESSDTKGTGFVVFENILDAKTACDHLSGFKLMDNYIVVVYFT 301
            ++KK    P E S  L + NL     +D ++ +F K+G +  +R+    E+   KG G+V F N+ DAK A D L G + +DN  V + F+
Sbjct:  254 RAKKFGDTPSEPSDTLFLGNLSFNADRDAIFELFAKHGEVVSVRIPTHPETEQPKGFGYVQFSNMEDAKKALDALQG-EYIDNRPVRLDFS 343          
BLAST of RRM domain-containing protein vs. Ensembl Yeast
Match: MRD1 (Essential conserved small ribosomal subunit (40s) synthesis factor; component of the 90S preribosome; required for production of 18S rRNA and small ribosomal subunit; contains five consensus RNA-binding domains and binds to the pre-rRNA at two sites within the 18S region [Source:SGD;Acc:S000006316])

HSP 1 Score: 44.2838 bits (103), Expect = 1.716e-6
Identity = 21/76 (27.63%), Postives = 42/76 (55.26%), Query Frame = 2
Query:   74 SKMLLIKNLPNQMQKDELYTIFRKYGSIRQIRLGESSDTKGTGFVVFENIL--DAKTACDHLSGFKLMDNYIVVVY 295
            S  +++KNLP +  + +++ +F  +G ++ +R+ +  D    GF   E +L  +A+ A D L G  L+   +V+ Y
Sbjct:  762 SGKIIVKNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHGVHLLGRRLVMQY 837          
BLAST of RRM domain-containing protein vs. Ensembl Nematostella
Match: EDO36652 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SI29])

HSP 1 Score: 119.013 bits (297), Expect = 1.571e-35
Identity = 51/95 (53.68%), Postives = 72/95 (75.79%), Query Frame = 2
Query:   35 AQSKKKIQLPPEVSKMLLIKNLPNQMQKDELYTIFRKYGSIRQIRLGESSDTKGTGFVVFENILDAKTACDHLSGFKLMDNYIVVVYFTPYKIIK 319
            +Q K  ++LPPEV+++L I+NLP ++  +E+Y IF KYG+IRQIRLG + DT+GT FVV+E+I DAK ACDHLSGF +   Y+VV+Y+   K  +
Sbjct:    5 SQRKANVRLPPEVNRILYIRNLPYKITAEEMYDIFGKYGAIRQIRLGNAPDTRGTAFVVYEDIFDAKNACDHLSGFNVCGRYLVVLYYQSNKAFQ 99          
BLAST of RRM domain-containing protein vs. Ensembl Medaka
Match: sf3b6 (splicing factor 3b subunit 6 [Source:NCBI gene;Acc:101163944])

HSP 1 Score: 112.079 bits (279), Expect = 2.143e-32
Identity = 48/93 (51.61%), Postives = 72/93 (77.42%), Query Frame = 2
Query:   26 IAMAQSKK-KIQLPPEVSKMLLIKNLPNQMQKDELYTIFRKYGSIRQIRLGESSDTKGTGFVVFENILDAKTACDHLSGFKLMDNYIVVVYFT 301
            +AM  +K+  I+LPPEV+++L I+NLP ++  +E+Y IF KYG IRQIR G + +++GT +VV+E+I DAK ACDHLSGF + + Y+VV+Y+ 
Sbjct:    1 MAMQAAKRANIRLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRTGNTPESRGTAYVVYEDIFDAKNACDHLSGFNVCNRYLVVLYYN 93          
BLAST of RRM domain-containing protein vs. Ensembl Medaka
Match: cirbpa (cold inducible RNA binding protein [Source:NCBI gene;Acc:101165004])

HSP 1 Score: 46.595 bits (109), Expect = 9.670e-7
Identity = 27/73 (36.99%), Postives = 41/73 (56.16%), Query Frame = 2
Query:   83 LLIKNLPNQMQKDELYTIFRKYGSIRQ---IRLGESSDTKGTGFVVFENILDAKTACDHLSGFKLMDNYIVVV 292
            L I  L  +  +D L   F KYG+I +   IR  E+  ++G GFV ++N+ DAK A D ++G K +D   + V
Sbjct:    6 LFIGGLSFETNEDSLAAAFGKYGTIEKVDVIRDKETGRSRGFGFVKYDNVEDAKDALDAMNG-KTLDGRAIRV 77          
BLAST of RRM domain-containing protein vs. Ensembl Medaka
Match: cirbpa (cold inducible RNA binding protein [Source:NCBI gene;Acc:101165004])

HSP 1 Score: 46.2098 bits (108), Expect = 1.535e-6
Identity = 27/73 (36.99%), Postives = 41/73 (56.16%), Query Frame = 2
Query:   83 LLIKNLPNQMQKDELYTIFRKYGSIRQ---IRLGESSDTKGTGFVVFENILDAKTACDHLSGFKLMDNYIVVV 292
            L I  L  +  +D L   F KYG+I +   IR  E+  ++G GFV ++N+ DAK A D ++G K +D   + V
Sbjct:    7 LFIGGLSFETNEDSLAAAFGKYGTIEKVDVIRDKETGRSRGFGFVKYDNVEDAKDALDAMNG-KTLDGRAIRV 78          
BLAST of RRM domain-containing protein vs. Ensembl Medaka
Match: snrpa (small nuclear ribonucleoprotein polypeptide A [Source:NCBI gene;Acc:101155621])

HSP 1 Score: 46.595 bits (109), Expect = 1.588e-6
Identity = 28/83 (33.73%), Postives = 42/83 (50.60%), Query Frame = 2
Query:   65 PEV--SKMLLIKNLPNQMQKDEL----YTIFRKYGSIRQIRLGESSDTKGTGFVVFENILDAKTACDHLSGFKLMDNYIVVVY 295
            PEV  +  + I NL  +++KDEL    Y IF ++G I  I +  +   KG  FV+F+ I  A  A   + GF   D  + + Y
Sbjct:    4 PEVRPNHTIYINNLNEKIKKDELKKSLYAIFSQFGQILDILVARTLKMKGQAFVIFKEINSASNALRSMQGFPFYDKPMRIQY 86          
BLAST of RRM domain-containing protein vs. Ensembl Medaka
Match: snrpa (small nuclear ribonucleoprotein polypeptide A [Source:NCBI gene;Acc:101155621])

HSP 1 Score: 46.595 bits (109), Expect = 1.588e-6
Identity = 28/83 (33.73%), Postives = 42/83 (50.60%), Query Frame = 2
Query:   65 PEV--SKMLLIKNLPNQMQKDEL----YTIFRKYGSIRQIRLGESSDTKGTGFVVFENILDAKTACDHLSGFKLMDNYIVVVY 295
            PEV  +  + I NL  +++KDEL    Y IF ++G I  I +  +   KG  FV+F+ I  A  A   + GF   D  + + Y
Sbjct:    4 PEVRPNHTIYINNLNEKIKKDELKKSLYAIFSQFGQILDILVARTLKMKGQAFVIFKEINSASNALRSMQGFPFYDKPMRIQY 86          
BLAST of RRM domain-containing protein vs. Planmine SMEST
Match: SMESG000081357.1 (SMESG000081357.1)

HSP 1 Score: 113.235 bits (282), Expect = 4.989e-33
Identity = 49/97 (50.52%), Postives = 73/97 (75.26%), Query Frame = 2
Query:   32 MAQSKKKI-QLPPEVSKMLLIKNLPNQMQKDELYTIFRKYGSIRQIRLGESSDTKGTGFVVFENILDAKTACDHLSGFKLMDNYIVVVYFTPYKIIK 319
            MA S K+I +LPP VS++L++ NLP +++ DE+Y IF KYG+IRQIR+G + + KG  FVV+E+I DA+ AC+HL+GF + + YI + Y+ P K+ K
Sbjct:    1 MAFSNKRITKLPPNVSRILMVSNLPYELRDDEMYDIFGKYGTIRQIRVGNTPENKGKAFVVYEDIYDAQNACEHLTGFNVCNRYICISYYQPNKVFK 97          
BLAST of RRM domain-containing protein vs. Planmine SMEST
Match: SMESG000078309.1 (SMESG000078309.1)

HSP 1 Score: 48.1358 bits (113), Expect = 4.984e-8
Identity = 25/71 (35.21%), Postives = 40/71 (56.34%), Query Frame = 2
Query:   65 PEVSKMLLIKNLPNQMQKDELYTIFRKYGSIRQIRLG---ESSDTKGTGFVVFENILDAKTACDHLSGFKL 268
            P  +  + + N+P  +++DEL  IF +YG+I    L     S   KG  FV FE+I DA+ + D L G+++
Sbjct:    2 PRSTTTIYVGNIPEDLRRDELKRIFGRYGNIVAATLPVDYYSGIPKGFAFVQFEDIRDAEESFDRLQGYRI 72          
BLAST of RRM domain-containing protein vs. Planmine SMEST
Match: SMESG000016033.1 (SMESG000016033.1)

HSP 1 Score: 46.9802 bits (110), Expect = 3.996e-7
Identity = 30/94 (31.91%), Postives = 48/94 (51.06%), Query Frame = 2
Query:   83 LLIKNLPNQMQKDELYTIFRKYGSIRQIRLG---ESSDTKGTGFVVFENILDAKTACDHLSGFKLMDNYIVVVYFTPYKIIKVNTPGSLSIKHQ 355
            L ++NL ++++ ++L  +F KYG I  I++     S   KG GF  FE+  DA+ A   L G +L+   I V +   YK     TP  +  K +
Sbjct:    9 LFVRNLSDRVRYEDLEKLFGKYGRIYNIKIPLDYYSGRMKGFGFCTFEDFRDAEDAKTRLDGAQLLGREIGVEFTNGYK----KTPAEMRDKEK 98          
BLAST of RRM domain-containing protein vs. Planmine SMEST
Match: SMESG000058799.1 (SMESG000058799.1)

HSP 1 Score: 48.1358 bits (113), Expect = 5.802e-7
Identity = 35/115 (30.43%), Postives = 59/115 (51.30%), Query Frame = 2
Query:   17 QSPIAMAQSKKKIQLPPEVSKMLLIKNLPNQMQKDELYTIFRKYGSIRQIRLGESSDTK---GTGFVVFENILDAKTACDHLSGFKLMDNYIVVVYFTPYKIIKVNTPGSLSIKH 352
            Q     AQ K K     + S++ L +NL   + ++ LY +F  YG I  IRL  +S+T+   G  ++ F    DAKTA D ++  K+  N   + +    K+I+ +  G++ IK+
Sbjct:  560 QQKGTFAQQKTKPSWYSDDSEIFL-ENLHPDVDEEFLYKLFHSYGEILSIRLMRNSETQKSLGVAYITFVRRSDAKTAMDKVNFKKIYRNECRIKWSESNKVIRKSEIGNVFIKN 673          
BLAST of RRM domain-containing protein vs. Planmine SMEST
Match: SMESG000058799.1 (SMESG000058799.1)

HSP 1 Score: 47.7506 bits (112), Expect = 5.843e-7
Identity = 34/111 (30.63%), Postives = 58/111 (52.25%), Query Frame = 2
Query:   29 AMAQSKKKIQLPPEVSKMLLIKNLPNQMQKDELYTIFRKYGSIRQIRLGESSDTK---GTGFVVFENILDAKTACDHLSGFKLMDNYIVVVYFTPYKIIKVNTPGSLSIKH 352
              AQ K K     + S++ L +NL   + ++ LY +F  YG I  IRL  +S+T+   G  ++ F    DAKTA D ++  K+  N   + +    K+I+ +  G++ IK+
Sbjct:  564 TFAQQKTKPSWYSDDSEIFL-ENLHPDVDEEFLYKLFHSYGEILSIRLMRNSETQKSLGVAYITFVRRSDAKTAMDKVNFKKIYRNECRIKWSESNKVIRKSEIGNVFIKN 673          
The following BLAST results are available for this feature:
BLAST of RRM domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SF3B66.998e-3352.69splicing factor 3b subunit 6 [Source:HGNC Symbol;A... [more]
SNRPA3.159e-633.82small nuclear ribonucleoprotein polypeptide A [Sou... [more]
SNRPA4.926e-632.00small nuclear ribonucleoprotein polypeptide A [Sou... [more]
SNRPA5.285e-632.00small nuclear ribonucleoprotein polypeptide A [Sou... [more]
SNRPA7.503e-632.00small nuclear ribonucleoprotein polypeptide A [Sou... [more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
C50D2.52.571e-3349.49Splicing factor 3B subunit 6-like protein [Source... [more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sf3b67.807e-3452.17gene:FBgn0035692 transcript:FBtr0077015[more]
elav3.088e-634.23gene:FBgn0260400 transcript:FBtr0307173[more]
elav3.088e-634.23gene:FBgn0260400 transcript:FBtr0070091[more]
elav3.143e-634.23gene:FBgn0260400 transcript:FBtr0100254[more]
elav3.143e-634.23gene:FBgn0260400 transcript:FBtr0114366[more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sf3b64.452e-3352.69splicing factor 3b, subunit 6 [Source:ZFIN;Acc:ZDB... [more]
snrpa3.199e-633.33small nuclear ribonucleoprotein polypeptide A [Sou... [more]
snrpa3.199e-633.33small nuclear ribonucleoprotein polypeptide A [Sou... [more]
pabpc1b4.815e-639.13poly A binding protein, cytoplasmic 1 b [Source:ZF... [more]
snrpa4.951e-633.33small nuclear ribonucleoprotein polypeptide A [Sou... [more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
sf3b69.808e-3352.69splicing factor 3b subunit 6 [Source:NCBI gene;Acc... [more]
sf3b63.170e-3255.29splicing factor 3b subunit 6 [Source:NCBI gene;Acc... [more]
tubgcp55.376e-633.33tubulin gamma complex associated protein 5 [Source... [more]
tubgcp55.397e-633.33tubulin gamma complex associated protein 5 [Source... [more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Sf3b64.804e-3352.69splicing factor 3B, subunit 6 [Source:MGI Symbol;A... [more]
Sf3b63.295e-3255.42splicing factor 3B, subunit 6 [Source:MGI Symbol;A... [more]
back to top
BLAST of RRM domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9VRV7|SF3B6_DROME7.826e-3352.17Splicing factor 3B subunit 6 OS=Drosophila melanog... [more]
sp|Q8ITY4|SF3B6_CAEEL3.271e-3249.49Splicing factor 3B subunit 6-like protein OS=Caeno... [more]
sp|P59708|SF3B6_MOUSE3.360e-3252.69Splicing factor 3B subunit 6 OS=Mus musculus OX=10... [more]
sp|Q9Y3B4|SF3B6_HUMAN3.360e-3252.69Splicing factor 3B subunit 6 OS=Homo sapiens OX=96... [more]
sp|Q9FMP4|SF3B6_ARATH4.045e-2951.09Splicing factor 3B subunit 6-like protein OS=Arabi... [more]
back to top
BLAST of RRM domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3D7L52.547e-3555.10splicing factor 3B subunit 6 OS=Diaphorina citri O... [more]
A0A1Y2BD331.411e-3455.79RNA-binding domain-containing protein OS=Neocallim... [more]
A0A267DPF71.528e-3454.29RRM domain-containing protein (Fragment) OS=Macros... [more]
A0A1Y2AFM22.281e-3454.74RNA-binding domain-containing protein OS=Neocallim... [more]
K1QS873.793e-3452.94Pre-mRNA branch site p14-like protein OS=Crassostr... [more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
sf3b63.773e-3352.69splicing factor 3b subunit 6 [Source:NCBI gene;Acc... [more]
ENSAMXT00000018970.28.034e-639.13polyadenylate-binding protein 1-like [Source:NCBI ... [more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000006657.19.110e-3447.31pep scaffold:Pmarinus_7.0:GL484402:615:2775:1 gene... [more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
NSR16.579e-934.07Nucleolar protein that binds nuclear localization ... [more]
MRD11.716e-627.63Essential conserved small ribosomal subunit (40s) ... [more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO366521.571e-3553.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sf3b62.143e-3251.61splicing factor 3b subunit 6 [Source:NCBI gene;Acc... [more]
cirbpa9.670e-736.99cold inducible RNA binding protein [Source:NCBI ge... [more]
cirbpa1.535e-636.99cold inducible RNA binding protein [Source:NCBI ge... [more]
snrpa1.588e-633.73small nuclear ribonucleoprotein polypeptide A [Sou... [more]
snrpa1.588e-633.73small nuclear ribonucleoprotein polypeptide A [Sou... [more]
back to top
BLAST of RRM domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000081357.14.989e-3350.52SMESG000081357.1[more]
SMESG000078309.14.984e-835.21SMESG000078309.1[more]
SMESG000016033.13.996e-731.91SMESG000016033.1[more]
SMESG000058799.15.802e-730.43SMESG000058799.1[more]
SMESG000058799.15.843e-730.63SMESG000058799.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024648 ID=SMED30024648|Name=RRM domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=438bp
GTTGCTTTGTTTACAACAGTCACCTATAGCAATGGCGCAAAGCAAAAAAA
AAATTCAACTGCCTCCAGAAGTTAGTAAGATGCTGCTTATAAAAAATCTT
CCTAATCAAATGCAAAAGGATGAATTATATACGATATTTAGAAAATATGG
ATCAATTAGACAAATTCGATTAGGTGAAAGTTCAGACACTAAGGGAACAG
GATTTGTAGTATTTGAAAACATATTAGATGCTAAAACGGCTTGTGATCAT
CTCAGCGGATTTAAATTAATGGACAATTATATAGTAGTCGTTTACTTCAC
ACCATATAAAATTATTAAAGTAAATACTCCTGGGTCGCTTTCAATTAAAC
ACCAATTACCATCAGCTCTACCGCCAGCCATTTCAAAAATTATAATATTC
AAACAAAAAGTATATTAATAACAAGTAACAGATTCCGG
back to top

protein sequence of SMED30024648-orf-1

>SMED30024648-orf-1 ID=SMED30024648-orf-1|Name=SMED30024648-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=139bp
LLCLQQSPIAMAQSKKKIQLPPEVSKMLLIKNLPNQMQKDELYTIFRKYG
SIRQIRLGESSDTKGTGFVVFENILDAKTACDHLSGFKLMDNYIVVVYFT
PYKIIKVNTPGSLSIKHQLPSALPPAISKIIIFKQKVY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0003676nucleic acid binding
GO:0000166nucleotide binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000099neuron
PLANA:0000418head
PLANA:0000421tail
Vocabulary: INTERPRO
TermDefinition
IPR034150SF3B6_RRM
IPR035979RBD_domain_sf
IPR000504RRM_dom
IPR012677Nucleotide-bd_a/b_plait_sf
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000504RNA recognition motif domainSMARTSM00360rrm1_1coord: 27..97
e-value: 2.0E-13
score: 60.6
IPR000504RNA recognition motif domainPFAMPF00076RRM_1coord: 28..94
e-value: 6.6E-15
score: 54.7
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 26..101
score: 14.624
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 21..100
e-value: 3.2E-18
score: 67.6
NoneNo IPR availablePANTHERPTHR12785:SF7SPLICING FACTOR 3B SUBUNIT 6-LIKE PROTEINcoord: 11..104
NoneNo IPR availablePANTHERPTHR12785splicing factor 3Bcoord: 11..104
IPR034150SF3B6, RNA recognition motifCDDcd12241RRM_SF3B14coord: 24..99
e-value: 6.44975E-37
score: 119.258
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 26..105