Expressed conserved protein

Overview
NameExpressed conserved protein
Smed IDSMED30024625
Length (bp)1928
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Expressed conserved protein (SMED30024625) t-SNE clustered cells

Violin plots show distribution of expression levels for Expressed conserved protein (SMED30024625) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Expressed conserved protein (SMED30024625) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Expressed conserved protein (SMED30024625) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024625

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30024625SMESG000056224.1 Contig7090newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30024625SMESG000056224.1 Contig7090uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
muscle cellSMED30024625SMESG000056224.1 dd_Smed_v4_2100_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30024625SMESG000056224.1 dd_Smed_v4_2100_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30024625SMESG000056224.1 dd_Smed_v4_2100_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Expressed conserved protein vs. Ensembl Celegans
Match: H14E04.2 (pep chromosome:WBcel235:III:2376195:2384840:1 gene:WBGene00019199.1 transcript:H14E04.2c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:H14E04.2)

HSP 1 Score: 206.838 bits (525), Expect = 2.139e-58
Identity = 172/611 (28.15%), Postives = 300/611 (49.10%), Query Frame = 2
Query:   59 TNKNTKVVMTPTLK-GNVKTIKVERINSVDTKNIYFEAQGMNSGLIINKEDKNSKDDKVPQEMQLEFTCMMRNEINGDTYAENRRIKFWFIEGLKQMDKLDGS----YEFFKELINPAQFPKDYPMFVKKVMKQLQMDRFSKLKRVDIDFITLNKQEQ----DALVPQMRRAGMEE-KPIELVVKENLQARLDEAYPNCLSMDDLVRILNVKDNVIKPQITELLAKDVIEEVIVEGKGMGFRRKICYHNEDVKVVKETDQMQKIFK-----------KEKPTVAIITNLLCEKLAVDAMMEEKTTFVKFE--GESHVYTIGRIGDKKVISTKVAMVGRELKARISSANTTTRLLGTFQDVQHVLIVGVGGSVPHMYEFDKHSRLGDIVVSYPNDDNSVYIFCERLHINEENNDPNTISFEIKDFKIKDNTLQNVIDDVLENFVNDPKSCEWQRYMEEAKAEIQMS--DINFSRPSAXXXXXXXXXXXXXXXXMKHPEVPKELEHLYLPNQPAVRLGSIGSGRPVTDVDTF----------RDRFSKEHFLLAYDSEYDQVLDSIKGNGLGSFALIRGIADYIDGST--GGIWQPYASLAAAAFMKAVIVRL 1780
            TNK   VV+TP  +  +   +K+ R  +  +  +     G  +GLIIN+ ++ S  +    ++ L F+  + N+ +     E R + F     L++  +LD      ++FFK L+  +  P DY  F+K+ M  LQ D ++++  + ID+  + + +Q    DA   +  + G +    +E V   ++Q  L+ A+PN L    +   L   D      + EL    ++  V  E           +   D K V E+ +  +               E+PTVAII+ L  EK A+DA++EE +T  K++  G+S+VYT+GRIG  +V++TK+A++G   +A  S+ + TTRLLG FQ+++HV IVGV G+VPH  +   H+RLGD++VS        Y++   L  N +        F I+++   D T++ +++   E  ++      W    +EA A +  S  D+ +  P   TD L + VS   V  M HP    +         P + LG++G+   +   + +          R+ F++   +   D+ +D V+ ++ G+ + S+ALIRGI+DY  G +  G +WQ +A+  AA   + +I +L
Sbjct:    3 TNKGHLVVLTPKKQDSDHNIVKIHREETAKSDKVLHIGGGSYAGLIINRYEEKSNFESTA-DVSLSFSVHLSNKNHQKQVQEKRSLFF----KLRKSVELDVGRLVVHKFFKNLL--SNLPGDYVSFMKRAMTLLQKD-YTEIVELVIDYKIVEESDQVTIPDATQYETSKRGKDSGSELEEVTVGHVQEILEHAFPNGLPTCAISECLRCSDEETLAFLAELETSGIVRMVEDE-----------WIRVDTKKVDESIEAHRNAAAAASTSAGNGLSEQPTVAIISCLFVEKQAIDALIEESSTIHKYKSGGDSNVYTLGRIGAHRVVATKLALIGDSREAITSAGSITTRLLGNFQNIEHVFIVGVAGAVPHFTDATLHARLGDVIVSASRPHQ--YVYAHDLLFNRQTE--QITGFAIRNWDADDKTIEKIVETGGEELLS-----AWNSATDEAIALLTSSAGDVEWKAPPTSTDVLAMTVSKGNVVVMPHPNADTK-------TGPEIHLGTVGAMSAMKKYEKWDGEEDSLAKVRETFAESFGIRCIDAGFDSVVGAVVGSCVRSWALIRGISDYDYGQSRAGKVWQAHAAARAAGMARCIIEKL 578          
BLAST of Expressed conserved protein vs. Ensembl Celegans
Match: H14E04.2 (pep chromosome:WBcel235:III:2376195:2384840:1 gene:WBGene00019199.1 transcript:H14E04.2a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:H14E04.2)

HSP 1 Score: 206.453 bits (524), Expect = 2.205e-58
Identity = 172/608 (28.29%), Postives = 300/608 (49.34%), Query Frame = 2
Query:   59 TNKNTKVVMTPTLK-GNVKTIKVERINSVDTKNIYFEAQGMNSGLIINKEDKNSKDDKVPQEMQLEFTCMMRNEINGDTYAENRRIKFWFIEGLKQMDKLDGS----YEFFKELINPAQFPKDYPMFVKKVMKQLQMDRFSKLKRVDIDFITLNKQEQDALVPQMRR--AGMEEKPIELVVKENLQARLDEAYPNCLSMDDLVRILNVKDNVIKPQITELLAKDVIEEVIVEGKGMGFRRKICYHNEDVKVVKETDQMQKIFK-----------KEKPTVAIITNLLCEKLAVDAMMEEKTTFVKFE--GESHVYTIGRIGDKKVISTKVAMVGRELKARISSANTTTRLLGTFQDVQHVLIVGVGGSVPHMYEFDKHSRLGDIVVSYPNDDNSVYIFCERLHINEENNDPNTISFEIKDFKIKDNTLQNVIDDVLENFVNDPKSCEWQRYMEEAKAEIQMS--DINFSRPSAXXXXXXXXXXXXXXXXMKHPEVPKELEHLYLPNQPAVRLGSIGSGRPVTDVDTF----------RDRFSKEHFLLAYDSEYDQVLDSIKGNGLGSFALIRGIADYIDGST--GGIWQPYASLAAAAFMKAVIVRL 1780
            TNK   VV+TP  +  +   +K+ R  +  +  +     G  +GLIIN+ ++ S  +    ++ L F+  + N+ +     E R + F     L++  +LD      ++FFK L+  +  P DY  F+K+ M  LQ D ++++  + ID+  + + +Q   +P   +  +G E   +E V   ++Q  L+ A+PN L    +   L   D      + EL    ++  V  E           +   D K V E+ +  +               E+PTVAII+ L  EK A+DA++EE +T  K++  G+S+VYT+GRIG  +V++TK+A++G   +A  S+ + TTRLLG FQ+++HV IVGV G+VPH  +   H+RLGD++VS        Y++   L  N +        F I+++   D T++ +++   E  ++      W    +EA A +  S  D+ +  P   TD L + VS   V  M HP    +         P + LG++G+   +   + +          R+ F++   +   D+ +D V+ ++ G+ + S+ALIRGI+DY  G +  G +WQ +A+  AA   + +I +L
Sbjct:    3 TNKGHLVVLTPKKQDSDHNIVKIHREETAKSDKVLHIGGGSYAGLIINRYEEKSNFESTA-DVSLSFSVHLSNKNHQKQVQEKRSLFF----KLRKSVELDVGRLVVHKFFKNLL--SNLPGDYVSFMKRAMTLLQKD-YTEIVELVIDYKIVEESDQ-VTIPDATQYDSGSE---LEEVTVGHVQEILEHAFPNGLPTCAISECLRCSDEETLAFLAELETSGIVRMVEDE-----------WIRVDTKKVDESIEAHRNAAAAASTSAGNGLSEQPTVAIISCLFVEKQAIDALIEESSTIHKYKSGGDSNVYTLGRIGAHRVVATKLALIGDSREAITSAGSITTRLLGNFQNIEHVFIVGVAGAVPHFTDATLHARLGDVIVSASRPHQ--YVYAHDLLFNRQTE--QITGFAIRNWDADDKTIEKIVETGGEELLS-----AWNSATDEAIALLTSSAGDVEWKAPPTSTDVLAMTVSKGNVVVMPHPNADTK-------TGPEIHLGTVGAMSAMKKYEKWDGEEDSLAKVRETFAESFGIRCIDAGFDSVVGAVVGSCVRSWALIRGISDYDYGQSRAGKVWQAHAAARAAGMARCIIEKL 571          
BLAST of Expressed conserved protein vs. Ensembl Celegans
Match: H14E04.2 (pep chromosome:WBcel235:III:2376193:2384840:1 gene:WBGene00019199.1 transcript:H14E04.2b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:H14E04.2)

HSP 1 Score: 205.682 bits (522), Expect = 5.575e-58
Identity = 173/610 (28.36%), Postives = 299/610 (49.02%), Query Frame = 2
Query:   59 TNKNTKVVMTPTLK-GNVKTIKVERINSVDTKNIYFEAQGMNSGLIINK--EDKNSKDDKVPQEMQLEFTCMMRNEINGDTYAENRRIKFWFIEGLKQMDKLDGS----YEFFKELINPAQFPKDYPMFVKKVMKQLQMDRFSKLKRVDIDFITLNKQEQDALVPQMRR--AGMEEKPIELVVKENLQARLDEAYPNCLSMDDLVRILNVKDNVIKPQITELLAKDVIEEVIVEGKGMGFRRKICYHNEDVKVVKETDQMQKIFK-----------KEKPTVAIITNLLCEKLAVDAMMEEKTTFVKFE--GESHVYTIGRIGDKKVISTKVAMVGRELKARISSANTTTRLLGTFQDVQHVLIVGVGGSVPHMYEFDKHSRLGDIVVSYPNDDNSVYIFCERLHINEENNDPNTISFEIKDFKIKDNTLQNVIDDVLENFVNDPKSCEWQRYMEEAKAEIQMS--DINFSRPSAXXXXXXXXXXXXXXXXMKHPEVPKELEHLYLPNQPAVRLGSIGSGRPVTDVDTF----------RDRFSKEHFLLAYDSEYDQVLDSIKGNGLGSFALIRGIADYIDGST--GGIWQPYASLAAAAFMKAVIVRL 1780
            TNK   VV+TP  +  +   +K+ R  +  +  +     G  +GLIIN+  E  N    +   ++ L F+  + N+ +     E R + F     L++  +LD      ++FFK L+  +  P DY  F+K+ M  LQ D ++++  + ID+  + + +Q   +P   +  +G E   +E V   ++Q  L+ A+PN L    +   L   D      + EL    ++  V  E           +   D K V E+ +  +               E+PTVAII+ L  EK A+DA++EE +T  K++  G+S+VYT+GRIG  +V++TK+A++G   +A  S+ + TTRLLG FQ+++HV IVGV G+VPH  +   H+RLGD++VS        Y++   L  N +        F I+++   D T++ +++   E  ++      W    +EA A +  S  D+ +  P   TD L + VS   V  M HP    +         P + LG++G+   +   + +          R+ F++   +   D+ +D V+ ++ G+ + S+ALIRGI+DY  G +  G +WQ +A+  AA   + +I +L
Sbjct:    3 TNKGHLVVLTPKKQDSDHNIVKIHREETAKSDKVLHIGGGSYAGLIINRYEEKSNFVFSESTADVSLSFSVHLSNKNHQKQVQEKRSLFF----KLRKSVELDVGRLVVHKFFKNLL--SNLPGDYVSFMKRAMTLLQKD-YTEIVELVIDYKIVEESDQ-VTIPDATQYDSGSE---LEEVTVGHVQEILEHAFPNGLPTCAISECLRCSDEETLAFLAELETSGIVRMVEDE-----------WIRVDTKKVDESIEAHRNAAAAASTSAGNGLSEQPTVAIISCLFVEKQAIDALIEESSTIHKYKSGGDSNVYTLGRIGAHRVVATKLALIGDSREAITSAGSITTRLLGNFQNIEHVFIVGVAGAVPHFTDATLHARLGDVIVSASRPHQ--YVYAHDLLFNRQTE--QITGFAIRNWDADDKTIEKIVETGGEELLS-----AWNSATDEAIALLTSSAGDVEWKAPPTSTDVLAMTVSKGNVVVMPHPNADTK-------TGPEIHLGTVGAMSAMKKYEKWDGEEDSLAKVRETFAESFGIRCIDAGFDSVVGAVVGSCVRSWALIRGISDYDYGQSRAGKVWQAHAAARAAGMARCIIEKL 574          
BLAST of Expressed conserved protein vs. Ensembl Celegans
Match: H14E04.2 (pep chromosome:WBcel235:III:2376396:2384840:1 gene:WBGene00019199.1 transcript:H14E04.2d.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:H14E04.2)

HSP 1 Score: 173.711 bits (439), Expect = 1.607e-47
Identity = 139/481 (28.90%), Postives = 240/481 (49.90%), Query Frame = 2
Query:  425 VKKVMKQLQMDRFSKLKRVDIDFITLNKQEQDALVPQMRR--AGMEEKPIELVVKENLQARLDEAYPNCLSMDDLVRILNVKDNVIKPQITELLAKDVIEEVIVEGKGMGFRRKICYHNEDVKVVKETDQMQKIFK-----------KEKPTVAIITNLLCEKLAVDAMMEEKTTFVKFE--GESHVYTIGRIGDKKVISTKVAMVGRELKARISSANTTTRLLGTFQDVQHVLIVGVGGSVPHMYEFDKHSRLGDIVVSYPNDDNSVYIFCERLHINEENNDPNTISFEIKDFKIKDNTLQNVIDDVLENFVNDPKSCEWQRYMEEAKAEIQMS--DINFSRPSAXXXXXXXXXXXXXXXXMKHPEVPKELEHLYLPNQPAVRLGSIGSGRPVTDVDTF----------RDRFSKEHFLLAYDSEYDQVLDSIKGNGLGSFALIRGIADYIDGST--GGIWQPYASLAAAAFMKAVIVRL 1780
            +K+ M  LQ D ++++  + ID+  + + +Q   +P   +  +G E   +E V   ++Q  L+ A+PN L    +   L   D      + EL    ++  V  E           +   D K V E+ +  +               E+PTVAII+ L  EK A+DA++EE +T  K++  G+S+VYT+GRIG  +V++TK+A++G   +A  S+ + TTRLLG FQ+++HV IVGV G+VPH  +   H+RLGD++VS        Y++   L  N +        F I+++   D T++ +++   E  ++      W    +EA A +  S  D+ +  P   TD L + VS   V  M HP    +         P + LG++G+   +   + +          R+ F++   +   D+ +D V+ ++ G+ + S+ALIRGI+DY  G +  G +WQ +A+  AA   + +I +L
Sbjct:    1 MKRAMTLLQKD-YTEIVELVIDYKIVEESDQ-VTIPDATQYDSGSE---LEEVTVGHVQEILEHAFPNGLPTCAISECLRCSDEETLAFLAELETSGIVRMVEDE-----------WIRVDTKKVDESIEAHRNAAAAASTSAGNGLSEQPTVAIISCLFVEKQAIDALIEESSTIHKYKSGGDSNVYTLGRIGAHRVVATKLALIGDSREAITSAGSITTRLLGNFQNIEHVFIVGVAGAVPHFTDATLHARLGDVIVSASRPHQ--YVYAHDLLFNRQTE--QITGFAIRNWDADDKTIEKIVETGGEELLS-----AWNSATDEAIALLTSSAGDVEWKAPPTSTDVLAMTVSKGNVVVMPHPNADTK-------TGPEIHLGTVGAMSAMKKYEKWDGEEDSLAKVRETFAESFGIRCIDAGFDSVVGAVVGSCVRSWALIRGISDYDYGQSRAGKVWQAHAAARAAGMARCIIEKL 449          
BLAST of Expressed conserved protein vs. Ensembl Fly
Match: CG12065 (gene:FBgn0030052 transcript:FBtr0300750)

HSP 1 Score: 310.071 bits (793), Expect = 1.965e-96
Identity = 209/582 (35.91%), Postives = 329/582 (56.53%), Query Frame = 2
Query:   65 KNTKVVMTPTLK-GNVKTIKVERINSVDTKNIYFEAQGMNSGLIINKED-KNSKDDKVPQEMQLEFTCMMRNEINGDTYAENRRIKFWFIEGLKQMDKLDG-SYEFFKELINPAQFPKDYPMFVKKVMKQLQMDRFSKLKRVDIDFITLNKQEQDALVPQMRRAGMEEKPIEL--VVKENLQARLDEAYPNCLSMDDLVRILNVKDNVIKPQITELLAKDVIEEVIVEGKGMGFRRKICYHNEDVKVVKETDQMQKIFKKEKPTVAIITNLLCEKLAVDAMMEEKTTFVKFE--GESHVYTIGRIGDKKVISTKVAMVGRELKARISSANTTTRLLGTFQDVQHVLIVGVGGSVPHMYEFDKHSRLGDIVVSYPNDDNSVYIFCERLHINEENNDPNTISF----EIKDFKIKDNTLQNVIDDVLENF-VNDPKSCEWQRYMEEA-KAEIQMSDINFSRPSAXXXXXXXXXXXXXXXXMKHPEVPKELEHLYLPNQPAVRLGSIGSGRPVTDVDTFRDRFSKEHFLLAYDSEYDQVLDSIKGNGLGSFALIRGIADYIDGSTGGIWQPYASLAAAAFMKAVI 1771
            +  +VVMTP  K  N   I +ER    +  +    A G ++G+IINK+     K       + LEF   + +   G    E+R ++FWF + L   +K    + +FFKEL++P  FP+DY  F+KK+MK LQ   +S+++ ++I+   L    ++   P  R   +EE   E   + +E +   +++AYPN +S +DL      KD     Q   L+ K + E  +++        +I + ++++KVVK   QM  I   ++PT+AIIT   CEKLAVDAM+E K TFV++   GES+VYT+G IG  +++STK+  VG   +A  ++ NTTTRLLGTFQ V +V IVGV G VPH  ++ KH RLGD+V+S        Y+  +R  I+     P    +    ++K +   +++LQ + + +  N  V  P    W+ Y+ +A +A  Q +D +F+RP A TDKL + + +  V ++ HP    E++ +   N+  + LG IGSGR +   D  R +F++++ LLA D E   VLDSI GN   SF L++GIADY DG++   WQ +A+++AA+ +K+VI
Sbjct:   79 RTEQVVMTPRGKTANSTVILIERKLVDEINDRVHVAGGDHTGIIINKDTVAGQKSASKAAALSLEFRVFLVSANTGKHSQESRTLRFWFRDWLTNEEKQAHIAQDFFKELVSPQDFPRDYVGFIKKIMKLLQHG-YSEIQSIEIELRIL----EETSAPPSRPLSLEESQFESPPLTQEKVLELIEQAYPNPVSPEDLA-----KDYGWSEQDVLLVIKSLQERGLIKSMEYNAYTRIHHEDKEIKVVK---QMPTIASNKQPTIAIITAQYCEKLAVDAMLENKETFVRYTTVGESNVYTLGNIGAHRIVSTKLPSVGSNREAMTATGNTTTRLLGTFQKVDYVFIVGVAGGVPHYTDYKKHVRLGDVVIS--------YVDKQRALISNSKEKPYVYLYKSGEDVKTYFPVNDSLQQIAESLQANMQVKRP----WEDYLNQAQQALAQKTDADFNRPDARTDKLFMNIGNNEVIEVAHPIAADEVDGV---NRLRLHLGPIGSGRDLVRSDELRTQFARKYGLLATDVEMSSVLDSIIGNCRESFILVKGIADYKDGTSTRKWQNFAAISAASVVKSVI 632          
BLAST of Expressed conserved protein vs. Ensembl Fly
Match: CG12065 (gene:FBgn0030052 transcript:FBtr0300751)

HSP 1 Score: 310.071 bits (793), Expect = 1.965e-96
Identity = 209/582 (35.91%), Postives = 329/582 (56.53%), Query Frame = 2
Query:   65 KNTKVVMTPTLK-GNVKTIKVERINSVDTKNIYFEAQGMNSGLIINKED-KNSKDDKVPQEMQLEFTCMMRNEINGDTYAENRRIKFWFIEGLKQMDKLDG-SYEFFKELINPAQFPKDYPMFVKKVMKQLQMDRFSKLKRVDIDFITLNKQEQDALVPQMRRAGMEEKPIEL--VVKENLQARLDEAYPNCLSMDDLVRILNVKDNVIKPQITELLAKDVIEEVIVEGKGMGFRRKICYHNEDVKVVKETDQMQKIFKKEKPTVAIITNLLCEKLAVDAMMEEKTTFVKFE--GESHVYTIGRIGDKKVISTKVAMVGRELKARISSANTTTRLLGTFQDVQHVLIVGVGGSVPHMYEFDKHSRLGDIVVSYPNDDNSVYIFCERLHINEENNDPNTISF----EIKDFKIKDNTLQNVIDDVLENF-VNDPKSCEWQRYMEEA-KAEIQMSDINFSRPSAXXXXXXXXXXXXXXXXMKHPEVPKELEHLYLPNQPAVRLGSIGSGRPVTDVDTFRDRFSKEHFLLAYDSEYDQVLDSIKGNGLGSFALIRGIADYIDGSTGGIWQPYASLAAAAFMKAVI 1771
            +  +VVMTP  K  N   I +ER    +  +    A G ++G+IINK+     K       + LEF   + +   G    E+R ++FWF + L   +K    + +FFKEL++P  FP+DY  F+KK+MK LQ   +S+++ ++I+   L    ++   P  R   +EE   E   + +E +   +++AYPN +S +DL      KD     Q   L+ K + E  +++        +I + ++++KVVK   QM  I   ++PT+AIIT   CEKLAVDAM+E K TFV++   GES+VYT+G IG  +++STK+  VG   +A  ++ NTTTRLLGTFQ V +V IVGV G VPH  ++ KH RLGD+V+S        Y+  +R  I+     P    +    ++K +   +++LQ + + +  N  V  P    W+ Y+ +A +A  Q +D +F+RP A TDKL + + +  V ++ HP    E++ +   N+  + LG IGSGR +   D  R +F++++ LLA D E   VLDSI GN   SF L++GIADY DG++   WQ +A+++AA+ +K+VI
Sbjct:   79 RTEQVVMTPRGKTANSTVILIERKLVDEINDRVHVAGGDHTGIIINKDTVAGQKSASKAAALSLEFRVFLVSANTGKHSQESRTLRFWFRDWLTNEEKQAHIAQDFFKELVSPQDFPRDYVGFIKKIMKLLQHG-YSEIQSIEIELRIL----EETSAPPSRPLSLEESQFESPPLTQEKVLELIEQAYPNPVSPEDLA-----KDYGWSEQDVLLVIKSLQERGLIKSMEYNAYTRIHHEDKEIKVVK---QMPTIASNKQPTIAIITAQYCEKLAVDAMLENKETFVRYTTVGESNVYTLGNIGAHRIVSTKLPSVGSNREAMTATGNTTTRLLGTFQKVDYVFIVGVAGGVPHYTDYKKHVRLGDVVIS--------YVDKQRALISNSKEKPYVYLYKSGEDVKTYFPVNDSLQQIAESLQANMQVKRP----WEDYLNQAQQALAQKTDADFNRPDARTDKLFMNIGNNEVIEVAHPIAADEVDGV---NRLRLHLGPIGSGRDLVRSDELRTQFARKYGLLATDVEMSSVLDSIIGNCRESFILVKGIADYKDGTSTRKWQNFAAISAASVVKSVI 632          
BLAST of Expressed conserved protein vs. Ensembl Fly
Match: CG12065 (gene:FBgn0030052 transcript:FBtr0071216)

HSP 1 Score: 310.071 bits (793), Expect = 1.965e-96
Identity = 209/582 (35.91%), Postives = 329/582 (56.53%), Query Frame = 2
Query:   65 KNTKVVMTPTLK-GNVKTIKVERINSVDTKNIYFEAQGMNSGLIINKED-KNSKDDKVPQEMQLEFTCMMRNEINGDTYAENRRIKFWFIEGLKQMDKLDG-SYEFFKELINPAQFPKDYPMFVKKVMKQLQMDRFSKLKRVDIDFITLNKQEQDALVPQMRRAGMEEKPIEL--VVKENLQARLDEAYPNCLSMDDLVRILNVKDNVIKPQITELLAKDVIEEVIVEGKGMGFRRKICYHNEDVKVVKETDQMQKIFKKEKPTVAIITNLLCEKLAVDAMMEEKTTFVKFE--GESHVYTIGRIGDKKVISTKVAMVGRELKARISSANTTTRLLGTFQDVQHVLIVGVGGSVPHMYEFDKHSRLGDIVVSYPNDDNSVYIFCERLHINEENNDPNTISF----EIKDFKIKDNTLQNVIDDVLENF-VNDPKSCEWQRYMEEA-KAEIQMSDINFSRPSAXXXXXXXXXXXXXXXXMKHPEVPKELEHLYLPNQPAVRLGSIGSGRPVTDVDTFRDRFSKEHFLLAYDSEYDQVLDSIKGNGLGSFALIRGIADYIDGSTGGIWQPYASLAAAAFMKAVI 1771
            +  +VVMTP  K  N   I +ER    +  +    A G ++G+IINK+     K       + LEF   + +   G    E+R ++FWF + L   +K    + +FFKEL++P  FP+DY  F+KK+MK LQ   +S+++ ++I+   L    ++   P  R   +EE   E   + +E +   +++AYPN +S +DL      KD     Q   L+ K + E  +++        +I + ++++KVVK   QM  I   ++PT+AIIT   CEKLAVDAM+E K TFV++   GES+VYT+G IG  +++STK+  VG   +A  ++ NTTTRLLGTFQ V +V IVGV G VPH  ++ KH RLGD+V+S        Y+  +R  I+     P    +    ++K +   +++LQ + + +  N  V  P    W+ Y+ +A +A  Q +D +F+RP A TDKL + + +  V ++ HP    E++ +   N+  + LG IGSGR +   D  R +F++++ LLA D E   VLDSI GN   SF L++GIADY DG++   WQ +A+++AA+ +K+VI
Sbjct:   79 RTEQVVMTPRGKTANSTVILIERKLVDEINDRVHVAGGDHTGIIINKDTVAGQKSASKAAALSLEFRVFLVSANTGKHSQESRTLRFWFRDWLTNEEKQAHIAQDFFKELVSPQDFPRDYVGFIKKIMKLLQHG-YSEIQSIEIELRIL----EETSAPPSRPLSLEESQFESPPLTQEKVLELIEQAYPNPVSPEDLA-----KDYGWSEQDVLLVIKSLQERGLIKSMEYNAYTRIHHEDKEIKVVK---QMPTIASNKQPTIAIITAQYCEKLAVDAMLENKETFVRYTTVGESNVYTLGNIGAHRIVSTKLPSVGSNREAMTATGNTTTRLLGTFQKVDYVFIVGVAGGVPHYTDYKKHVRLGDVVIS--------YVDKQRALISNSKEKPYVYLYKSGEDVKTYFPVNDSLQQIAESLQANMQVKRP----WEDYLNQAQQALAQKTDADFNRPDARTDKLFMNIGNNEVIEVAHPIAADEVDGV---NRLRLHLGPIGSGRDLVRSDELRTQFARKYGLLATDVEMSSVLDSIIGNCRESFILVKGIADYKDGTSTRKWQNFAAISAASVVKSVI 632          
BLAST of Expressed conserved protein vs. Ensembl Fly
Match: CG12065 (gene:FBgn0030052 transcript:FBtr0071217)

HSP 1 Score: 310.071 bits (793), Expect = 1.965e-96
Identity = 209/582 (35.91%), Postives = 329/582 (56.53%), Query Frame = 2
Query:   65 KNTKVVMTPTLK-GNVKTIKVERINSVDTKNIYFEAQGMNSGLIINKED-KNSKDDKVPQEMQLEFTCMMRNEINGDTYAENRRIKFWFIEGLKQMDKLDG-SYEFFKELINPAQFPKDYPMFVKKVMKQLQMDRFSKLKRVDIDFITLNKQEQDALVPQMRRAGMEEKPIEL--VVKENLQARLDEAYPNCLSMDDLVRILNVKDNVIKPQITELLAKDVIEEVIVEGKGMGFRRKICYHNEDVKVVKETDQMQKIFKKEKPTVAIITNLLCEKLAVDAMMEEKTTFVKFE--GESHVYTIGRIGDKKVISTKVAMVGRELKARISSANTTTRLLGTFQDVQHVLIVGVGGSVPHMYEFDKHSRLGDIVVSYPNDDNSVYIFCERLHINEENNDPNTISF----EIKDFKIKDNTLQNVIDDVLENF-VNDPKSCEWQRYMEEA-KAEIQMSDINFSRPSAXXXXXXXXXXXXXXXXMKHPEVPKELEHLYLPNQPAVRLGSIGSGRPVTDVDTFRDRFSKEHFLLAYDSEYDQVLDSIKGNGLGSFALIRGIADYIDGSTGGIWQPYASLAAAAFMKAVI 1771
            +  +VVMTP  K  N   I +ER    +  +    A G ++G+IINK+     K       + LEF   + +   G    E+R ++FWF + L   +K    + +FFKEL++P  FP+DY  F+KK+MK LQ   +S+++ ++I+   L    ++   P  R   +EE   E   + +E +   +++AYPN +S +DL      KD     Q   L+ K + E  +++        +I + ++++KVVK   QM  I   ++PT+AIIT   CEKLAVDAM+E K TFV++   GES+VYT+G IG  +++STK+  VG   +A  ++ NTTTRLLGTFQ V +V IVGV G VPH  ++ KH RLGD+V+S        Y+  +R  I+     P    +    ++K +   +++LQ + + +  N  V  P    W+ Y+ +A +A  Q +D +F+RP A TDKL + + +  V ++ HP    E++ +   N+  + LG IGSGR +   D  R +F++++ LLA D E   VLDSI GN   SF L++GIADY DG++   WQ +A+++AA+ +K+VI
Sbjct:   79 RTEQVVMTPRGKTANSTVILIERKLVDEINDRVHVAGGDHTGIIINKDTVAGQKSASKAAALSLEFRVFLVSANTGKHSQESRTLRFWFRDWLTNEEKQAHIAQDFFKELVSPQDFPRDYVGFIKKIMKLLQHG-YSEIQSIEIELRIL----EETSAPPSRPLSLEESQFESPPLTQEKVLELIEQAYPNPVSPEDLA-----KDYGWSEQDVLLVIKSLQERGLIKSMEYNAYTRIHHEDKEIKVVK---QMPTIASNKQPTIAIITAQYCEKLAVDAMLENKETFVRYTTVGESNVYTLGNIGAHRIVSTKLPSVGSNREAMTATGNTTTRLLGTFQKVDYVFIVGVAGGVPHYTDYKKHVRLGDVVIS--------YVDKQRALISNSKEKPYVYLYKSGEDVKTYFPVNDSLQQIAESLQANMQVKRP----WEDYLNQAQQALAQKTDADFNRPDARTDKLFMNIGNNEVIEVAHPIAADEVDGV---NRLRLHLGPIGSGRDLVRSDELRTQFARKYGLLATDVEMSSVLDSIIGNCRESFILVKGIADYKDGTSTRKWQNFAAISAASVVKSVI 632          
BLAST of Expressed conserved protein vs. Ensembl Fly
Match: CG12065 (gene:FBgn0030052 transcript:FBtr0071215)

HSP 1 Score: 300.056 bits (767), Expect = 3.936e-92
Identity = 211/624 (33.81%), Postives = 335/624 (53.69%), Query Frame = 2
Query:   65 KNTKVVMTPTLK-GNVKTIKVERINSVDTKNIYFEAQGMNSGLIINKED-KNSKDDKVPQEMQLEFTCMMRNEINGDTYAENRRIKFWFIEGLKQMDKLDG-SYEFFKELINPAQFPKDYPMFVKKVMKQLQMDRFSKLKRVDIDFITL-----------------------NKQEQDALVPQMRRAGMEEKPIEL--VVKENLQARLDEAYPNCLSMDDLVRILNVKDNVIKPQITELLAKDVIEEVIVEGKGMGFRRKICYHNEDVKVVKETDQMQKIFKKEKPTVAIITNLLCEKLAVDAMMEEKTTFVKFE---------------------GESHVYTIGRIGDKKVISTKVAMVGRELKARISSANTTTRLLGTFQDVQHVLIVGVGGSVPHMYEFDKHSRLGDIVVSYPNDDNSVYIFCERLHINEENNDPNTISF----EIKDFKIKDNTLQNVIDDVLENF-VNDPKSCEWQRYMEEA-KAEIQMSDINFSRPSAXXXXXXXXXXXXXXXXMKHPEVPKELEHLYLPNQPAVRLGSIGSGRPVTDVDTFRDRFSKEHFLLAYDSEYDQVLDSIKGNGLGSFALIRGIADYIDGSTGGIWQPYASLAAAAFMKAVI 1771
            +  +VVMTP  K  N   I +ER    +  +    A G ++G+IINK+     K       + LEF   + +   G    E+R ++FWF + L   +K    + +FFKEL++P  FP+DY  F+KK+MK LQ   +S+++ ++I+   L                       N++ ++AL+ Q +   +EE   E   + +E +   +++AYPN +S +DL      KD     Q   L+ K + E  +++        +I + ++++KVVK   QM  I   ++PT+AIIT   CEKLAVDAM+E K TFV++                      GES+VYT+G IG  +++STK+  VG   +A  ++ NTTTRLLGTFQ V +V IVGV G VPH  ++ KH RLGD+V+SY +         +R  I+     P    +    ++K +   +++LQ + + +  N  V  P    W+ Y+ +A +A  Q +D +F+RP A TDKL + + +  V ++ HP    E++ +   N+  + LG IGSGR +   D  R +F++++ LLA D E   VLDSI GN   SF L++GIADY DG++   WQ +A+++AA+ +K+VI
Sbjct:   79 RTEQVVMTPRGKTANSTVILIERKLVDEINDRVHVAGGDHTGIIINKDTVAGQKSASKAAALSLEFRVFLVSANTGKHSQESRTLRFWFRDWLTNEEKQAHIAQDFFKELVSPQDFPRDYVGFIKKIMKLLQHG-YSEIQSIEIELRILEETSAPPSRPPRDGYIIYCYGDCNRKFEEALMAQRKTVSLEESQFESPPLTQEKVLELIEQAYPNPVSPEDLA-----KDYGWSEQDVLLVIKSLQERGLIKSMEYNAYTRIHHEDKEIKVVK---QMPTIASNKQPTIAIITAQYCEKLAVDAMLENKETFVRYTTVDSDPNLTNSLRKSKKKRRFGESNVYTLGNIGAHRIVSTKLPSVGSNREAMTATGNTTTRLLGTFQKVDYVFIVGVAGGVPHYTDYKKHVRLGDVVISYVDK--------QRALISNSKEKPYVYLYKSGEDVKTYFPVNDSLQQIAESLQANMQVKRP----WEDYLNQAQQALAQKTDADFNRPDARTDKLFMNIGNNEVIEVAHPIAADEVDGV---NRLRLHLGPIGSGRDLVRSDELRTQFARKYGLLATDVEMSSVLDSIIGNCRESFILVKGIADYKDGTSTRKWQNFAAISAASVVKSVI 678          
BLAST of Expressed conserved protein vs. TrEMBL
Match: H2KV46 (Uncharacterized protein OS=Clonorchis sinensis OX=79923 GN=CLF_111247 PE=4 SV=1)

HSP 1 Score: 593.578 bits (1529), Expect = 0.000e+0
Identity = 316/605 (52.23%), Postives = 428/605 (70.74%), Query Frame = 2
Query:   77 VVMTPTLKGNVKTIKVERINSVDTKNIYFEAQGMNSGLIINKEDKNSKDD--KVPQEMQLEFTCMMRNEINGDTYAENRRIKFWFIEGLKQMDKLDGSYEFFKELINPAQFPKDYPMFVKKVMKQLQMDRFSKLKRVDIDFITLNKQEQDALVPQMRRAGMEEKPIELVVKENLQARLDEAYPNCLSMDDLVRILNVKDN-VIKPQITELLAKDVIEEVIVEGKG---MGFRRKICYHNEDVKVVKETDQMQKIFKKEKPTVAIITNLLCEKLAVDAMMEEKTTFVKFE---GESHVYTIGRIGDKKVISTKVAMVGRELKARISSANTTTRLLGTFQDVQHVLIVGVGGSVPHMYEFDKHSRLGDIVVSYP-----------NDDNS-------------VYIFCERLHINEENNDPNTISFE--IKDFKIKDNTLQNVIDDVLENFVNDPKSCEWQRYMEEAKAEI--QMSDINFSRPSAXXXXXXXXXXXXXXXXMKHPEVPKELEHLYLPNQPAVRLGSIGSGRPVTDVDTFRDRFSKEHFLLAYDSEYDQVLDSIKGNGLGSFALIRGIADYIDGSTGGIWQPYASLAAAAFMKAVIVRL 1780
            V MTP    ++KTI+ ER  SVD   ++  A G +SG+++NK  K +      VP EMQLEFTC+M N+   +T+AENRR+KFWF EG +Q+ +L+ SY FF++L+NP  FP+DY  F+KK++ QL   RF +L+RVD+D +TL+ +EQ+ALVP+      +++P E V++E +Q RL+EAYPN LSM+DLVRIL ++D  ++K Q+  L  +D+I+ V +EGK    +GFRRKI   N++VK VKE D M+++   EKPT+AIITNLLCEKLAVDAM+E+KTTFV+++   GES+VYTIG IG  +VISTK+AMVGREL+A+ISSA+ TTRLLG FQ VQHV +VGVGGSVPH+YEF+KHSRLGD+VVS P           N  +S             VYI+C+ L I  +   P +  F+  +K ++I+D+TL   +D VL+ F +DP +C+W + +      +      +NFSRP  +TDKLKLK+ + V  D+KHPE+P++LE  Y P  PAVRLG  GSGRP+TD D  RD F+KEH LL+YDSEYDQVL+S+ GNGL SF +IRG+ADY++G     WQPYA+LAAA+FMKAVI+ L
Sbjct:    6 VTMTPIHFDSMKTIRFERSTSVDVNLVHHVAGGQHSGIVVNKGIKGTDGMVLDVP-EMQLEFTCIMFNKRTSETHAENRRLKFWFTEGTQQIARLNESYSFFQDLVNPDVFPRDYAGFIKKILDQLHGSRFPRLRRVDLDLVTLDPREQEALVPER-----DKRPPEQVIREAIQMRLEEAYPNVLSMEDLVRILEIEDRALLKLQLEALQERDLIQLVPLEGKNVGQLGFRRKIHLQNQEVKEVKEADHMKRVSTSEKPTIAIITNLLCEKLAVDAMIEQKTTFVRYKTEGGESNVYTIGNIGPHRVISTKLAMVGRELQAKISSASITTRLLGAFQTVQHVFLVGVGGSVPHVYEFEKHSRLGDVVVSAPVRSSNGRSPMGNGTHSPVCPLDVNKPGEPVYIYCDHL-IERDPKTPKSTPFKFVLKRYEIRDSTLLKCVDRVLDRFESDPSNCQWAQILTSCTNAVGEHEGSVNFSRPPPETDKLKLKIDEGVRVDIKHPEIPEDLERFYPPGIPAVRLGCFGSGRPITDNDKLRDFFAKEHQLLSYDSEYDQVLESVLGNGLNSFLIIRGMADYVEGRQDTQWQPYAALAAASFMKAVILEL 603          
BLAST of Expressed conserved protein vs. TrEMBL
Match: A0A4E0RUP8 (Expressed conserved protein OS=Fasciola hepatica OX=6192 GN=D915_004607 PE=4 SV=1)

HSP 1 Score: 588.571 bits (1516), Expect = 0.000e+0
Identity = 317/611 (51.88%), Postives = 428/611 (70.05%), Query Frame = 2
Query:   71 TKVVMTPTLKGNVKTIKVERINSVDTKNIYFEAQGMNSGLIINKEDK-NSKDDKVPQEMQLEFTCMMRNEINGDTYAENRRIKFWFIEGLKQMDKLDGSYEFFKELINPAQFPKDYPMFVKKVMKQLQMDRFSKLKRVDIDFITLNKQEQDALVPQMRRAGMEEKPIELVVKENLQARLDEAYPNCLSMDDLVRILNVKD-NVIKPQITELLAKDVIEEVIVEGK---GMGFRRKICYHNEDVKVVKETDQMQKIFKKEKPTVAIITNLLCEKLAVDAMMEEKTTFVKFE---GESHVYTIGRIGDKKVISTKVAMVGRELKARISSANTTTRLLGTFQDVQHVLIVGVGGSVPHMYEFDKHSRLGDIVVSYP------------------NDDNS-----------VYIFCERLHINEENNDPNT---ISFEIKDFKIKDNTLQNVIDDVLENFVNDPKSCEWQRYMEEAKAEIQMSD-INFSRPSAXXXXXXXXXXXXXXXXMKHPEVPKELEHLYLPNQPAVRLGSIGSGRPVTDVDTFRDRFSKEHFLLAYDSEYDQVLDSIKGNGLGSFALIRGIADYIDGSTGGIWQPYASLAAAAFMKAVIVRL 1780
            T VVMTP    N+KTI+ ER N +D   ++  A G ++G+I+N+E K +S   +VP EMQLEFTC+M N    +T+AENRR+KFWF +  +Q D+LD SY FF+ELINP  FP+DY  F+KKV+KQL    + +L+R+D+D + L+K+ QDAL P+      + +P E VV+E LQ RL+EAYPN LSMDDLVRIL V D N+I+ Q+  L  +D+++ V +EG+    +GFRRKI   N++VK VK  + MQ+I   EKPT+AIITNLLCEKLAVDAM+E+KTTFV+++   GES+VYTIG IG  +VISTK+ MVGREL+A+ISS + TTRLLG FQ VQHV +VGVGGSVPH+YEF+KHSRLGDIVVS P                  N  N+           VYI+C+RL ++  + +P     + + +K + ++D +L +  D VL+ F   P+ CEW + ++ +      ++ ++F+RPS+DTDKLKLK+ + V FD+KHP+VP+ +   Y P  PAVRLG +GSGRP+TD D  RD F+KEH LL +D+EYDQVL+S+ GNGL SF +IRGIADY++G  G  WQPYA+LAAA+FMKAVI+ L
Sbjct:   31 TYVVMTPINFDNMKTIRFERTNQIDQSRVHHVAGGQHAGIIVNQECKSDSMPPEVP-EMQLEFTCVMYNSRTTETHAENRRLKFWFTKCTQQFDRLDESYAFFRELINPDAFPRDYAGFIKKVLKQLHGPNYLRLRRIDLDIVPLDKRAQDALAPE-----QDNRPTEQVVREALQMRLEEAYPNVLSMDDLVRILEVDDRNLIQHQLEALEDRDLVQFVPLEGRYTGQIGFRRKIHLQNQEVKEVKGANHMQQISTSEKPTIAIITNLLCEKLAVDAMIEQKTTFVRYKTEGGESNVYTIGNIGPHRVISTKLPMVGRELQAKISSGSITTRLLGAFQAVQHVFLVGVGGSVPHVYEFEKHSRLGDIVVSAPVKWSTSCRSPSVENKRNGNHGNNVKAAGDMCQDPVYIYCDRL-VDSTDGEPRPAALLKYILKKYAVRDTSLLSCADRVLDRFEEAPERCEWAQILQASMNRFAENEAVDFTRPSSDTDKLKLKIDEGVTFDIKHPDVPEHMVRFYPPGVPAVRLGCLGSGRPITDNDQLRDSFAKEHQLLCFDAEYDQVLESVLGNGLDSFLIIRGIADYVEGRQGTHWQPYAALAAASFMKAVIMEL 634          
BLAST of Expressed conserved protein vs. TrEMBL
Match: A0A4S2LQE1 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_005601 PE=4 SV=1)

HSP 1 Score: 587.8 bits (1514), Expect = 0.000e+0
Identity = 315/605 (52.07%), Postives = 427/605 (70.58%), Query Frame = 2
Query:   77 VVMTPTLKGNVKTIKVERINSVDTKNIYFEAQGMNSGLIINKEDKNSKDD--KVPQEMQLEFTCMMRNEINGDTYAENRRIKFWFIEGLKQMDKLDGSYEFFKELINPAQFPKDYPMFVKKVMKQLQMDRFSKLKRVDIDFITLNKQEQDALVPQMRRAGMEEKPIELVVKENLQARLDEAYPNCLSMDDLVRILNVKDN-VIKPQITELLAKDVIEEVIVEGKG---MGFRRKICYHNEDVKVVKETDQMQKIFKKEKPTVAIITNLLCEKLAVDAMMEEKTTFVKFE---GESHVYTIGRIGDKKVISTKVAMVGRELKARISSANTTTRLLGTFQDVQHVLIVGVGGSVPHMYEFDKHSRLGDIVVSYP-----------NDDNS-------------VYIFCERLHINEENNDPNTISFE--IKDFKIKDNTLQNVIDDVLENFVNDPKSCEWQRYMEEAKAEI--QMSDINFSRPSAXXXXXXXXXXXXXXXXMKHPEVPKELEHLYLPNQPAVRLGSIGSGRPVTDVDTFRDRFSKEHFLLAYDSEYDQVLDSIKGNGLGSFALIRGIADYIDGSTGGIWQPYASLAAAAFMKAVIVRL 1780
            V MTP    ++KTI+ ER +SVD    +  A G +SG+++NK  K +      VP EMQLEFTC+M N+   +T+AENRR+KFWF EG +Q+ +L+ SY FF++L+NP  FP+DY  F+KK++ QL   RF +L+RVD+D +TL+ +EQ+ALVP+      +++P E V++E +Q RL+EAYPN LSM+DLVRIL ++D  ++K Q+  L  +D+I+ V +EGK    +GFRRKI   N++VK VKE D M+++   EKPT+AIITNLLCEKLAVDAM+E+KTTFV+++   GES+VYTIG IG  +VISTK+AMVGREL+A+ISSA+ TTRLLG FQ VQHV +VGVGGSVPH+YEF+KHSRLGD+VVS P           N  +S             VYI+C+ L I  +   P +  F+  +K ++I+D+TL   +D VL+ F +DP +C+W + +      +      +NFSRP  +TDKLKLK+ + V  D+KHPE+P++LE  Y    PAVRLG  GSGRP+TD D  RD F+KEH LL+YDSEYDQVL+S+ GNGL SF +IRG+ADY++G     WQPYA+LAAA+FMKAVI+ L
Sbjct:    6 VTMTPIHFDSMKTIRFERSSSVDVNLAHHVAGGQHSGIVVNKGIKGNDGMVLDVP-EMQLEFTCIMFNKRTSETHAENRRLKFWFTEGTQQIARLNESYSFFQDLVNPDVFPRDYAGFIKKILDQLHGSRFPRLRRVDLDLVTLDPREQEALVPER-----DKRPPEQVIREAIQMRLEEAYPNVLSMEDLVRILEIEDRALLKLQLEALQERDLIQLVPLEGKNVGQLGFRRKIHLQNQEVKEVKEADHMKRVSTSEKPTIAIITNLLCEKLAVDAMIEQKTTFVRYKTEGGESNVYTIGNIGPHRVISTKLAMVGRELQAKISSASITTRLLGAFQTVQHVFLVGVGGSVPHVYEFEKHSRLGDVVVSAPVRSSNGRSPMGNGTHSPVCPLDVNKPGDPVYIYCDHL-IERDPKTPKSTPFKFVLKRYEIRDSTLLKCVDRVLDRFESDPSNCQWAQILTSCTNAVGEHEGSVNFSRPPPETDKLKLKIDEGVRVDIKHPEIPEDLERFYPLGIPAVRLGCFGSGRPITDNDKLRDFFAKEHQLLSYDSEYDQVLESVLGNGLNSFLIIRGMADYVEGRQDTQWQPYAALAAASFMKAVILEL 603          
BLAST of Expressed conserved protein vs. TrEMBL
Match: G4V6P7 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 GN=Smp_068070 PE=4 SV=1)

HSP 1 Score: 582.408 bits (1500), Expect = 0.000e+0
Identity = 315/600 (52.50%), Postives = 422/600 (70.33%), Query Frame = 2
Query:   77 VVMTPTLKGNVKTIKVERINSVDTKNIYFEAQGMNSGLIINKEDKNSKDDKVPQEMQLEFTCMMRNEINGDTYAENRRIKFWFIEGLKQMDKLDGSYEFFKELINPAQFPKDYPMFVKKVMKQLQMDRFSKLKRVDIDFITLNKQEQDALVPQMRRAGMEEKPIELVVKENLQARLDEAYPNCLSMDDLVRILNVKDN-VIKPQITELLAKDVIEEVIVEGKGM---GFRRKICYHNEDVKVVKETDQMQKIFKKEKPTVAIITNLLCEKLAVDAMMEEKTTFVKF--EGESHVYTIGRIGDKKVISTKVAMVGRELKARISSANTTTRLLGTFQDVQHVLIVGVGGSVPHMYEFDKHSRLGDIVVS---------------YPNDD------NSVYIFCERL-HINEENNDPNTISFEIKDFKIKDNTLQNVIDDVLENFVNDPKSCEWQRYMEEAKAEIQMSD--INFSRPSAXXXXXXXXXXXXXXXXMKHPEVPKELEHLYLPNQPAVRLGSIGSGRPVTDVDTFRDRFSKEHFLLAYDSEYDQVLDSIKGNGLGSFALIRGIADYIDGSTGGIWQPYASLAAAAFMKAVIVRLKI 1786
            VVMTP   GN+K I+ ER +++D   ++  A G +SG+I+NKE K   +     EMQL+FTC+M N    +T+AENR +KFWF +  +Q D+LD SY+FF+ELI+P  FP+DY  F+KKV+K +   R+ +L+RVD+D I L+K EQ++LVP+      + KP E V++E+LQ RL+EAYPN LSMDDL+RIL   +  +++ Q+ EL+ +D+I+ V +EGK +   GFRRKI   N  V+ +K  + MQ++   EKPT+AIITNLLCEKLAVDAMME+KTTFV++  EGESHVYTIG IG  KVISTK+ MVGREL+A+ISS + TTRLLG FQ VQHV +VGVGGSVPH+YEF+KHSRLGDIVVS               + N        +S+YI+C+RL    E+  D  T  F ++ +  +D TL N ++ VL+ F   P+ CEW + ++ A   +   D  I+F+RP  DTDKLKLK+++ V FD+KHP+VP+EL   Y P  PAVRLG +GSGRPVTD D     F+KEH LL YD+EYDQVL+S+ GNGL SF LIRGIADY++G  G  WQPYA+LAAA+FMK++I++L +
Sbjct:    6 VVMTPFTLGNMKIIRFERTHNLDESMVHHIAGGQHSGIIVNKECKLKMEPMDVPEMQLQFTCIMFNNRTSETHAENRCLKFWFSKSAQQFDRLDESYDFFRELIDPDAFPRDYVGFLKKVLKLMHGSRYLRLRRVDLDIIPLDKLEQESLVPE-----RDNKPTEQVLRESLQMRLEEAYPNVLSMDDLIRILECDNRALLQVQLNELVDRDLIQLVPLEGKHVGQFGFRRKIHLQNHVVREMKGANHMQQVSTSEKPTIAIITNLLCEKLAVDAMMEQKTTFVRYKSEGESHVYTIGNIGPHKVISTKLPMVGRELQAKISSGSITTRLLGAFQAVQHVFLVGVGGSVPHVYEFEKHSRLGDIVVSAVARSSGLHSSAMNNHTNHSVSNGVGDSIYIYCDRLIEPPEDAVDMKTPRFVLRKYAARDPTLVNCVEKVLDRFEAAPEKCEWDQILKTALTVLGGEDDPIDFARPPPDTDKLKLKINEGVTFDIKHPDVPEELARFYPPGVPAVRLGCMGSGRPVTDNDALMSDFAKEHHLLCYDAEYDQVLESVMGNGLDSFILIRGIADYMEGRQGTQWQPYAALAAASFMKSIILQLPL 600          
BLAST of Expressed conserved protein vs. TrEMBL
Match: A0A5K4EFX3 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 582.022 bits (1499), Expect = 0.000e+0
Identity = 315/600 (52.50%), Postives = 422/600 (70.33%), Query Frame = 2
Query:   77 VVMTPTLKGNVKTIKVERINSVDTKNIYFEAQGMNSGLIINKEDKNSKDDKVPQEMQLEFTCMMRNEINGDTYAENRRIKFWFIEGLKQMDKLDGSYEFFKELINPAQFPKDYPMFVKKVMKQLQMDRFSKLKRVDIDFITLNKQEQDALVPQMRRAGMEEKPIELVVKENLQARLDEAYPNCLSMDDLVRILNVKDN-VIKPQITELLAKDVIEEVIVEGKGM---GFRRKICYHNEDVKVVKETDQMQKIFKKEKPTVAIITNLLCEKLAVDAMMEEKTTFVKF--EGESHVYTIGRIGDKKVISTKVAMVGRELKARISSANTTTRLLGTFQDVQHVLIVGVGGSVPHMYEFDKHSRLGDIVVS---------------YPNDD------NSVYIFCERL-HINEENNDPNTISFEIKDFKIKDNTLQNVIDDVLENFVNDPKSCEWQRYMEEAKAEIQMSD--INFSRPSAXXXXXXXXXXXXXXXXMKHPEVPKELEHLYLPNQPAVRLGSIGSGRPVTDVDTFRDRFSKEHFLLAYDSEYDQVLDSIKGNGLGSFALIRGIADYIDGSTGGIWQPYASLAAAAFMKAVIVRLKI 1786
            VVMTP   GN+K I+ ER +++D   ++  A G +SG+I+NKE K   +     EMQL+FTC+M N    +T+AENR +KFWF +  +Q D+LD SY+FF+ELI+P  FP+DY  F+KKV+K +   R+ +L+RVD+D I L+K EQ++LVP   +   + KP E V++E+LQ RL+EAYPN LSMDDL+RIL   +  +++ Q+ EL+ +D+I+ V +EGK +   GFRRKI   N  V+ +K  + MQ++   EKPT+AIITNLLCEKLAVDAMME+KTTFV++  EGESHVYTIG IG  KVISTK+ MVGREL+A+ISS + TTRLLG FQ VQHV +VGVGGSVPH+YEF+KHSRLGDIVVS               + N        +S+YI+C+RL    E+  D  T  F ++ +  +D TL N ++ VL+ F   P+ CEW + ++ A   +   D  I+F+RP  DTDKLKLK+++ V FD+KHP+VP+EL   Y P  PAVRLG +GSGRPVTD D     F+KEH LL YD+EYDQVL+S+ GNGL SF LIRGIADY++G  G  WQPYA+LAAA+FMK++I++L +
Sbjct:    6 VVMTPFTLGNMKIIRFERTHNLDESMVHHIAGGQHSGIIVNKECKLKMEPMDVPEMQLQFTCIMFNNRTSETHAENRCLKFWFSKSAQQFDRLDESYDFFRELIDPDAFPRDYVGFLKKVLKLMHGSRYLRLRRVDLDIIPLDKLEQESLVPDTYKE-RDNKPTEQVLRESLQMRLEEAYPNVLSMDDLIRILECDNRALLQVQLNELVDRDLIQLVPLEGKHVGQFGFRRKIHLQNHVVREMKGANHMQQVSTSEKPTIAIITNLLCEKLAVDAMMEQKTTFVRYKSEGESHVYTIGNIGPHKVISTKLPMVGRELQAKISSGSITTRLLGAFQAVQHVFLVGVGGSVPHVYEFEKHSRLGDIVVSAVARSSGLHSSAMNNHTNHSVSNGVGDSIYIYCDRLIEPPEDAVDMKTPRFVLRKYAARDPTLVNCVEKVLDRFEAAPEKCEWDQILKTALTVLGGEDDPIDFARPPPDTDKLKLKINEGVTFDIKHPDVPEELARFYPPGVPAVRLGCMGSGRPVTDNDALMSDFAKEHHLLCYDAEYDQVLESVMGNGLDSFILIRGIADYMEGRQGTQWQPYAALAAASFMKSIILQLPL 604          
BLAST of Expressed conserved protein vs. Planmine SMEST
Match: SMESG000056224.1 (SMESG000056224.1)

HSP 1 Score: 1157.13 bits (2992), Expect = 0.000e+0
Identity = 578/578 (100.00%), Postives = 578/578 (100.00%), Query Frame = 2
Query:   56 MTNKNTKVVMTPTLKGNVKTIKVERINSVDTKNIYFEAQGMNSGLIINKEDKNSKDDKVPQEMQLEFTCMMRNEINGDTYAENRRIKFWFIEGLKQMDKLDGSYEFFKELINPAQFPKDYPMFVKKVMKQLQMDRFSKLKRVDIDFITLNKQEQDALVPQMRRAGMEEKPIELVVKENLQARLDEAYPNCLSMDDLVRILNVKDNVIKPQITELLAKDVIEEVIVEGKGMGFRRKICYHNEDVKVVKETDQMQKIFKKEKPTVAIITNLLCEKLAVDAMMEEKTTFVKFEGESHVYTIGRIGDKKVISTKVAMVGRELKARISSANTTTRLLGTFQDVQHVLIVGVGGSVPHMYEFDKHSRLGDIVVSYPNDDNSVYIFCERLHINEENNDPNTISFEIKDFKIKDNTLQNVIDDVLENFVNDPKSCEWQRYMEEAKAEIQMSDINFSRPSAXXXXXXXXXXXXXXXXMKHPEVPKELEHLYLPNQPAVRLGSIGSGRPVTDVDTFRDRFSKEHFLLAYDSEYDQVLDSIKGNGLGSFALIRGIADYIDGSTGGIWQPYASLAAAAFMKAVIVRLKIE 1789
            MTNKNTKVVMTPTLKGNVKTIKVERINSVDTKNIYFEAQGMNSGLIINKEDKNSKDDKVPQEMQLEFTCMMRNEINGDTYAENRRIKFWFIEGLKQMDKLDGSYEFFKELINPAQFPKDYPMFVKKVMKQLQMDRFSKLKRVDIDFITLNKQEQDALVPQMRRAGMEEKPIELVVKENLQARLDEAYPNCLSMDDLVRILNVKDNVIKPQITELLAKDVIEEVIVEGKGMGFRRKICYHNEDVKVVKETDQMQKIFKKEKPTVAIITNLLCEKLAVDAMMEEKTTFVKFEGESHVYTIGRIGDKKVISTKVAMVGRELKARISSANTTTRLLGTFQDVQHVLIVGVGGSVPHMYEFDKHSRLGDIVVSYPNDDNSVYIFCERLHINEENNDPNTISFEIKDFKIKDNTLQNVIDDVLENFVNDPKSCEWQRYMEEAKAEIQMSDINFSRPSADTDKLKLKVSDKVVFDMKHPEVPKELEHLYLPNQPAVRLGSIGSGRPVTDVDTFRDRFSKEHFLLAYDSEYDQVLDSIKGNGLGSFALIRGIADYIDGSTGGIWQPYASLAAAAFMKAVIVRLKIE
Sbjct:    1 MTNKNTKVVMTPTLKGNVKTIKVERINSVDTKNIYFEAQGMNSGLIINKEDKNSKDDKVPQEMQLEFTCMMRNEINGDTYAENRRIKFWFIEGLKQMDKLDGSYEFFKELINPAQFPKDYPMFVKKVMKQLQMDRFSKLKRVDIDFITLNKQEQDALVPQMRRAGMEEKPIELVVKENLQARLDEAYPNCLSMDDLVRILNVKDNVIKPQITELLAKDVIEEVIVEGKGMGFRRKICYHNEDVKVVKETDQMQKIFKKEKPTVAIITNLLCEKLAVDAMMEEKTTFVKFEGESHVYTIGRIGDKKVISTKVAMVGRELKARISSANTTTRLLGTFQDVQHVLIVGVGGSVPHMYEFDKHSRLGDIVVSYPNDDNSVYIFCERLHINEENNDPNTISFEIKDFKIKDNTLQNVIDDVLENFVNDPKSCEWQRYMEEAKAEIQMSDINFSRPSADTDKLKLKVSDKVVFDMKHPEVPKELEHLYLPNQPAVRLGSIGSGRPVTDVDTFRDRFSKEHFLLAYDSEYDQVLDSIKGNGLGSFALIRGIADYIDGSTGGIWQPYASLAAAAFMKAVIVRLKIE 578          
BLAST of Expressed conserved protein vs. Planmine SMEST
Match: SMESG000056224.1 (SMESG000056224.1)

HSP 1 Score: 1151.35 bits (2977), Expect = 0.000e+0
Identity = 578/581 (99.48%), Postives = 578/581 (99.48%), Query Frame = 2
Query:   56 MTNKNTKVVMTPTLKGNVKTIKVERINSVDTKNIYFEAQGMNSGLIINKEDKNSKDDKVPQEMQLEFTCMMRNEINGDTYAENRRIKFWFIEGLKQMDKLDGSYEFFKELINPAQFPK---DYPMFVKKVMKQLQMDRFSKLKRVDIDFITLNKQEQDALVPQMRRAGMEEKPIELVVKENLQARLDEAYPNCLSMDDLVRILNVKDNVIKPQITELLAKDVIEEVIVEGKGMGFRRKICYHNEDVKVVKETDQMQKIFKKEKPTVAIITNLLCEKLAVDAMMEEKTTFVKFEGESHVYTIGRIGDKKVISTKVAMVGRELKARISSANTTTRLLGTFQDVQHVLIVGVGGSVPHMYEFDKHSRLGDIVVSYPNDDNSVYIFCERLHINEENNDPNTISFEIKDFKIKDNTLQNVIDDVLENFVNDPKSCEWQRYMEEAKAEIQMSDINFSRPSAXXXXXXXXXXXXXXXXMKHPEVPKELEHLYLPNQPAVRLGSIGSGRPVTDVDTFRDRFSKEHFLLAYDSEYDQVLDSIKGNGLGSFALIRGIADYIDGSTGGIWQPYASLAAAAFMKAVIVRLKIE 1789
            MTNKNTKVVMTPTLKGNVKTIKVERINSVDTKNIYFEAQGMNSGLIINKEDKNSKDDKVPQEMQLEFTCMMRNEINGDTYAENRRIKFWFIEGLKQMDKLDGSYEFFKELINPAQFPK   DYPMFVKKVMKQLQMDRFSKLKRVDIDFITLNKQEQDALVPQMRRAGMEEKPIELVVKENLQARLDEAYPNCLSMDDLVRILNVKDNVIKPQITELLAKDVIEEVIVEGKGMGFRRKICYHNEDVKVVKETDQMQKIFKKEKPTVAIITNLLCEKLAVDAMMEEKTTFVKFEGESHVYTIGRIGDKKVISTKVAMVGRELKARISSANTTTRLLGTFQDVQHVLIVGVGGSVPHMYEFDKHSRLGDIVVSYPNDDNSVYIFCERLHINEENNDPNTISFEIKDFKIKDNTLQNVIDDVLENFVNDPKSCEWQRYMEEAKAEIQMSDINFSRPSADTDKLKLKVSDKVVFDMKHPEVPKELEHLYLPNQPAVRLGSIGSGRPVTDVDTFRDRFSKEHFLLAYDSEYDQVLDSIKGNGLGSFALIRGIADYIDGSTGGIWQPYASLAAAAFMKAVIVRLKIE
Sbjct:    1 MTNKNTKVVMTPTLKGNVKTIKVERINSVDTKNIYFEAQGMNSGLIINKEDKNSKDDKVPQEMQLEFTCMMRNEINGDTYAENRRIKFWFIEGLKQMDKLDGSYEFFKELINPAQFPKGLNDYPMFVKKVMKQLQMDRFSKLKRVDIDFITLNKQEQDALVPQMRRAGMEEKPIELVVKENLQARLDEAYPNCLSMDDLVRILNVKDNVIKPQITELLAKDVIEEVIVEGKGMGFRRKICYHNEDVKVVKETDQMQKIFKKEKPTVAIITNLLCEKLAVDAMMEEKTTFVKFEGESHVYTIGRIGDKKVISTKVAMVGRELKARISSANTTTRLLGTFQDVQHVLIVGVGGSVPHMYEFDKHSRLGDIVVSYPNDDNSVYIFCERLHINEENNDPNTISFEIKDFKIKDNTLQNVIDDVLENFVNDPKSCEWQRYMEEAKAEIQMSDINFSRPSADTDKLKLKVSDKVVFDMKHPEVPKELEHLYLPNQPAVRLGSIGSGRPVTDVDTFRDRFSKEHFLLAYDSEYDQVLDSIKGNGLGSFALIRGIADYIDGSTGGIWQPYASLAAAAFMKAVIVRLKIE 581          
BLAST of Expressed conserved protein vs. Planmine SMEST
Match: SMESG000056224.1 (SMESG000056224.1)

HSP 1 Score: 1139.41 bits (2946), Expect = 0.000e+0
Identity = 569/569 (100.00%), Postives = 569/569 (100.00%), Query Frame = 2
Query:   83 MTPTLKGNVKTIKVERINSVDTKNIYFEAQGMNSGLIINKEDKNSKDDKVPQEMQLEFTCMMRNEINGDTYAENRRIKFWFIEGLKQMDKLDGSYEFFKELINPAQFPKDYPMFVKKVMKQLQMDRFSKLKRVDIDFITLNKQEQDALVPQMRRAGMEEKPIELVVKENLQARLDEAYPNCLSMDDLVRILNVKDNVIKPQITELLAKDVIEEVIVEGKGMGFRRKICYHNEDVKVVKETDQMQKIFKKEKPTVAIITNLLCEKLAVDAMMEEKTTFVKFEGESHVYTIGRIGDKKVISTKVAMVGRELKARISSANTTTRLLGTFQDVQHVLIVGVGGSVPHMYEFDKHSRLGDIVVSYPNDDNSVYIFCERLHINEENNDPNTISFEIKDFKIKDNTLQNVIDDVLENFVNDPKSCEWQRYMEEAKAEIQMSDINFSRPSAXXXXXXXXXXXXXXXXMKHPEVPKELEHLYLPNQPAVRLGSIGSGRPVTDVDTFRDRFSKEHFLLAYDSEYDQVLDSIKGNGLGSFALIRGIADYIDGSTGGIWQPYASLAAAAFMKAVIVRLKIE 1789
            MTPTLKGNVKTIKVERINSVDTKNIYFEAQGMNSGLIINKEDKNSKDDKVPQEMQLEFTCMMRNEINGDTYAENRRIKFWFIEGLKQMDKLDGSYEFFKELINPAQFPKDYPMFVKKVMKQLQMDRFSKLKRVDIDFITLNKQEQDALVPQMRRAGMEEKPIELVVKENLQARLDEAYPNCLSMDDLVRILNVKDNVIKPQITELLAKDVIEEVIVEGKGMGFRRKICYHNEDVKVVKETDQMQKIFKKEKPTVAIITNLLCEKLAVDAMMEEKTTFVKFEGESHVYTIGRIGDKKVISTKVAMVGRELKARISSANTTTRLLGTFQDVQHVLIVGVGGSVPHMYEFDKHSRLGDIVVSYPNDDNSVYIFCERLHINEENNDPNTISFEIKDFKIKDNTLQNVIDDVLENFVNDPKSCEWQRYMEEAKAEIQMSDINFSRPSADTDKLKLKVSDKVVFDMKHPEVPKELEHLYLPNQPAVRLGSIGSGRPVTDVDTFRDRFSKEHFLLAYDSEYDQVLDSIKGNGLGSFALIRGIADYIDGSTGGIWQPYASLAAAAFMKAVIVRLKIE
Sbjct:    1 MTPTLKGNVKTIKVERINSVDTKNIYFEAQGMNSGLIINKEDKNSKDDKVPQEMQLEFTCMMRNEINGDTYAENRRIKFWFIEGLKQMDKLDGSYEFFKELINPAQFPKDYPMFVKKVMKQLQMDRFSKLKRVDIDFITLNKQEQDALVPQMRRAGMEEKPIELVVKENLQARLDEAYPNCLSMDDLVRILNVKDNVIKPQITELLAKDVIEEVIVEGKGMGFRRKICYHNEDVKVVKETDQMQKIFKKEKPTVAIITNLLCEKLAVDAMMEEKTTFVKFEGESHVYTIGRIGDKKVISTKVAMVGRELKARISSANTTTRLLGTFQDVQHVLIVGVGGSVPHMYEFDKHSRLGDIVVSYPNDDNSVYIFCERLHINEENNDPNTISFEIKDFKIKDNTLQNVIDDVLENFVNDPKSCEWQRYMEEAKAEIQMSDINFSRPSADTDKLKLKVSDKVVFDMKHPEVPKELEHLYLPNQPAVRLGSIGSGRPVTDVDTFRDRFSKEHFLLAYDSEYDQVLDSIKGNGLGSFALIRGIADYIDGSTGGIWQPYASLAAAAFMKAVIVRLKIE 569          
BLAST of Expressed conserved protein vs. Planmine SMEST
Match: SMESG000056224.1 (SMESG000056224.1)

HSP 1 Score: 1137.87 bits (2942), Expect = 0.000e+0
Identity = 572/578 (98.96%), Postives = 573/578 (99.13%), Query Frame = 2
Query:   56 MTNKNTKVVMTPTLKGNVKTIKVERINSVDTKNIYFEAQGMNSGLIINKEDKNSKDDKVPQEMQLEFTCMMRNEINGDTYAENRRIKFWFIEGLKQMDKLDGSYEFFKELINPAQFPKDYPMFVKKVMKQLQMDRFSKLKRVDIDFITLNKQEQDALVPQMRRAGMEEKPIELVVKENLQARLDEAYPNCLSMDDLVRILNVKDNVIKPQITELLAKDVIEEVIVEGKGMGFRRKICYHNEDVKVVKETDQMQKIFKKEKPTVAIITNLLCEKLAVDAMMEEKTTFVKFEGESHVYTIGRIGDKKVISTKVAMVGRELKARISSANTTTRLLGTFQDVQHVLIVGVGGSVPHMYEFDKHSRLGDIVVSYPNDDNSVYIFCERLHINEENNDPNTISFEIKDFKIKDNTLQNVIDDVLENFVNDPKSCEWQRYMEEAKAEIQMSDINFSRPSAXXXXXXXXXXXXXXXXMKHPEVPKELEHLYLPNQPAVRLGSIGSGRPVTDVDTFRDRFSKEHFLLAYDSEYDQVLDSIKGNGLGSFALIRGIADYIDGSTGGIWQPYASLAAAAFMKAVIVRLKIE 1789
            MTNKNTKVVMTPTLKGNVKTIKVERINSVDTKNIYFEAQGMNSGLIINKEDKNSKDDKVPQEMQLEFTCMMRNEINGDTYAENRRIKFWFIEGLKQMDKLDGSYEFFKELINPAQFPKDYPMFVKKVMKQLQMDRFSKLKRVDIDFITLNKQEQDALVP+M     EEKPIELVVKENLQARLDEAYPNCLSMDDLVRILNVKDNVIKPQITELLAKDVIEEVIVEGKGMGFRRKICYHNEDVKVVKETDQMQKIFKKEKPTVAIITNLLCEKLAVDAMMEEKTTFVKFEGESHVYTIGRIGDKKVISTKVAMVGRELKARISSANTTTRLLGTFQDVQHVLIVGVGGSVPHMYEFDKHSRLGDIVVSYPNDDNSVYIFCERLHINEENNDPNTISFEIKDFKIKDNTLQNVIDDVLENFVNDPKSCEWQRYMEEAKAEIQMSDINFSRPSADTDKLKLKVSDKVVFDMKHPEVPKELEHLYLPNQPAVRLGSIGSGRPVTDVDTFRDRFSKEHFLLAYDSEYDQVLDSIKGNGLGSFALIRGIADYIDGSTGGIWQPYASLAAAAFMKAVIVRLKIE
Sbjct:    1 MTNKNTKVVMTPTLKGNVKTIKVERINSVDTKNIYFEAQGMNSGLIINKEDKNSKDDKVPQEMQLEFTCMMRNEINGDTYAENRRIKFWFIEGLKQMDKLDGSYEFFKELINPAQFPKDYPMFVKKVMKQLQMDRFSKLKRVDIDFITLNKQEQDALVPRM-----EEKPIELVVKENLQARLDEAYPNCLSMDDLVRILNVKDNVIKPQITELLAKDVIEEVIVEGKGMGFRRKICYHNEDVKVVKETDQMQKIFKKEKPTVAIITNLLCEKLAVDAMMEEKTTFVKFEGESHVYTIGRIGDKKVISTKVAMVGRELKARISSANTTTRLLGTFQDVQHVLIVGVGGSVPHMYEFDKHSRLGDIVVSYPNDDNSVYIFCERLHINEENNDPNTISFEIKDFKIKDNTLQNVIDDVLENFVNDPKSCEWQRYMEEAKAEIQMSDINFSRPSADTDKLKLKVSDKVVFDMKHPEVPKELEHLYLPNQPAVRLGSIGSGRPVTDVDTFRDRFSKEHFLLAYDSEYDQVLDSIKGNGLGSFALIRGIADYIDGSTGGIWQPYASLAAAAFMKAVIVRLKIE 573          
BLAST of Expressed conserved protein vs. Planmine SMEST
Match: SMESG000056224.1 (SMESG000056224.1)

HSP 1 Score: 1133.24 bits (2930), Expect = 0.000e+0
Identity = 569/572 (99.48%), Postives = 569/572 (99.48%), Query Frame = 2
Query:   83 MTPTLKGNVKTIKVERINSVDTKNIYFEAQGMNSGLIINKEDKNSKDDKVPQEMQLEFTCMMRNEINGDTYAENRRIKFWFIEGLKQMDKLDGSYEFFKELINPAQFPK---DYPMFVKKVMKQLQMDRFSKLKRVDIDFITLNKQEQDALVPQMRRAGMEEKPIELVVKENLQARLDEAYPNCLSMDDLVRILNVKDNVIKPQITELLAKDVIEEVIVEGKGMGFRRKICYHNEDVKVVKETDQMQKIFKKEKPTVAIITNLLCEKLAVDAMMEEKTTFVKFEGESHVYTIGRIGDKKVISTKVAMVGRELKARISSANTTTRLLGTFQDVQHVLIVGVGGSVPHMYEFDKHSRLGDIVVSYPNDDNSVYIFCERLHINEENNDPNTISFEIKDFKIKDNTLQNVIDDVLENFVNDPKSCEWQRYMEEAKAEIQMSDINFSRPSAXXXXXXXXXXXXXXXXMKHPEVPKELEHLYLPNQPAVRLGSIGSGRPVTDVDTFRDRFSKEHFLLAYDSEYDQVLDSIKGNGLGSFALIRGIADYIDGSTGGIWQPYASLAAAAFMKAVIVRLKIE 1789
            MTPTLKGNVKTIKVERINSVDTKNIYFEAQGMNSGLIINKEDKNSKDDKVPQEMQLEFTCMMRNEINGDTYAENRRIKFWFIEGLKQMDKLDGSYEFFKELINPAQFPK   DYPMFVKKVMKQLQMDRFSKLKRVDIDFITLNKQEQDALVPQMRRAGMEEKPIELVVKENLQARLDEAYPNCLSMDDLVRILNVKDNVIKPQITELLAKDVIEEVIVEGKGMGFRRKICYHNEDVKVVKETDQMQKIFKKEKPTVAIITNLLCEKLAVDAMMEEKTTFVKFEGESHVYTIGRIGDKKVISTKVAMVGRELKARISSANTTTRLLGTFQDVQHVLIVGVGGSVPHMYEFDKHSRLGDIVVSYPNDDNSVYIFCERLHINEENNDPNTISFEIKDFKIKDNTLQNVIDDVLENFVNDPKSCEWQRYMEEAKAEIQMSDINFSRPSADTDKLKLKVSDKVVFDMKHPEVPKELEHLYLPNQPAVRLGSIGSGRPVTDVDTFRDRFSKEHFLLAYDSEYDQVLDSIKGNGLGSFALIRGIADYIDGSTGGIWQPYASLAAAAFMKAVIVRLKIE
Sbjct:    1 MTPTLKGNVKTIKVERINSVDTKNIYFEAQGMNSGLIINKEDKNSKDDKVPQEMQLEFTCMMRNEINGDTYAENRRIKFWFIEGLKQMDKLDGSYEFFKELINPAQFPKGLNDYPMFVKKVMKQLQMDRFSKLKRVDIDFITLNKQEQDALVPQMRRAGMEEKPIELVVKENLQARLDEAYPNCLSMDDLVRILNVKDNVIKPQITELLAKDVIEEVIVEGKGMGFRRKICYHNEDVKVVKETDQMQKIFKKEKPTVAIITNLLCEKLAVDAMMEEKTTFVKFEGESHVYTIGRIGDKKVISTKVAMVGRELKARISSANTTTRLLGTFQDVQHVLIVGVGGSVPHMYEFDKHSRLGDIVVSYPNDDNSVYIFCERLHINEENNDPNTISFEIKDFKIKDNTLQNVIDDVLENFVNDPKSCEWQRYMEEAKAEIQMSDINFSRPSADTDKLKLKVSDKVVFDMKHPEVPKELEHLYLPNQPAVRLGSIGSGRPVTDVDTFRDRFSKEHFLLAYDSEYDQVLDSIKGNGLGSFALIRGIADYIDGSTGGIWQPYASLAAAAFMKAVIVRLKIE 572          
The following BLAST results are available for this feature:
BLAST of Expressed conserved protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Expressed conserved protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
H14E04.22.139e-5828.15pep chromosome:WBcel235:III:2376195:2384840:1 gene... [more]
H14E04.22.205e-5828.29pep chromosome:WBcel235:III:2376195:2384840:1 gene... [more]
H14E04.25.575e-5828.36pep chromosome:WBcel235:III:2376193:2384840:1 gene... [more]
H14E04.21.607e-4728.90pep chromosome:WBcel235:III:2376396:2384840:1 gene... [more]
back to top
BLAST of Expressed conserved protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG120651.965e-9635.91gene:FBgn0030052 transcript:FBtr0300750[more]
CG120651.965e-9635.91gene:FBgn0030052 transcript:FBtr0300751[more]
CG120651.965e-9635.91gene:FBgn0030052 transcript:FBtr0071216[more]
CG120651.965e-9635.91gene:FBgn0030052 transcript:FBtr0071217[more]
CG120653.936e-9233.81gene:FBgn0030052 transcript:FBtr0071215[more]
back to top
BLAST of Expressed conserved protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Expressed conserved protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Expressed conserved protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Expressed conserved protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Expressed conserved protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
H2KV460.000e+052.23Uncharacterized protein OS=Clonorchis sinensis OX=... [more]
A0A4E0RUP80.000e+051.88Expressed conserved protein OS=Fasciola hepatica O... [more]
A0A4S2LQE10.000e+052.07Uncharacterized protein OS=Opisthorchis felineus O... [more]
G4V6P70.000e+052.50Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A5K4EFX30.000e+052.50Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
back to top
BLAST of Expressed conserved protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Expressed conserved protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Expressed conserved protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Expressed conserved protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Expressed conserved protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Expressed conserved protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000056224.10.000e+0100.00SMESG000056224.1[more]
SMESG000056224.10.000e+099.48SMESG000056224.1[more]
SMESG000056224.10.000e+0100.00SMESG000056224.1[more]
SMESG000056224.10.000e+098.96SMESG000056224.1[more]
SMESG000056224.10.000e+099.48SMESG000056224.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024625 ID=SMED30024625|Name=Expressed conserved protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1928bp
AAAATTTTTATTTGAACTTCATATTTAAAAAAAATTTGAATAGGAAACAG
AAAGAATGACTAACAAGAATACGAAAGTAGTAATGACACCTACATTGAAA
GGCAATGTAAAAACAATTAAAGTTGAAAGAATTAATTCAGTGGACACGAA
AAATATATATTTTGAAGCTCAAGGAATGAATTCCGGGTTGATTATAAATA
AGGAAGATAAAAATAGTAAAGACGATAAAGTTCCACAAGAAATGCAATTA
GAATTTACTTGTATGATGCGTAATGAAATAAATGGTGACACATACGCTGA
AAATAGACGAATAAAATTTTGGTTCATCGAGGGTCTAAAACAAATGGACA
AATTAGATGGCTCCTATGAATTTTTTAAAGAACTTATTAATCCTGCTCAG
TTTCCTAAAGATTATCCAATGTTTGTAAAAAAAGTTATGAAGCAACTACA
AATGGATCGATTCTCAAAATTAAAGCGAGTTGACATTGACTTCATAACAC
TAAATAAACAGGAACAAGACGCCCTTGTACCTCAGATGCGCAGAGCAGGA
ATGGAAGAGAAACCTATCGAGTTAGTTGTTAAAGAAAATTTGCAAGCTCG
ATTAGACGAAGCCTATCCTAATTGTTTGTCAATGGATGATCTCGTTAGAA
TATTAAATGTGAAGGACAACGTAATCAAACCTCAAATAACGGAATTATTG
GCGAAAGACGTTATTGAAGAAGTTATAGTTGAGGGAAAGGGGATGGGATT
CAGAAGAAAAATCTGCTATCATAATGAAGACGTAAAAGTGGTAAAAGAAA
CCGATCAAATGCAGAAAATCTTCAAAAAAGAGAAGCCTACAGTTGCAATC
ATAACAAATCTATTGTGTGAGAAACTGGCTGTAGATGCGATGATGGAAGA
GAAAACTACATTTGTTAAGTTTGAGGGAGAATCACATGTTTACACTATTG
GTAGAATCGGAGATAAAAAAGTTATCAGTACCAAAGTAGCTATGGTCGGT
CGGGAATTGAAAGCTAGAATTTCGTCGGCAAATACAACCACTCGATTATT
GGGTACTTTCCAAGATGTACAACACGTTTTAATTGTTGGTGTCGGTGGAA
GTGTGCCACATATGTATGAATTTGATAAGCACAGTCGTCTCGGGGATATT
GTTGTTTCTTATCCGAACGATGACAATTCTGTATATATTTTCTGTGAGAG
GCTTCATATTAATGAAGAGAATAACGATCCTAATACGATTTCTTTTGAGA
TTAAAGATTTTAAAATTAAAGACAATACTTTACAAAATGTAATTGATGAT
GTGCTTGAAAATTTTGTCAATGATCCAAAATCTTGTGAATGGCAACGATA
TATGGAAGAAGCCAAAGCCGAAATTCAAATGTCCGATATTAATTTCAGCA
GACCTTCTGCGGATACGGACAAATTAAAATTAAAGGTTTCAGACAAAGTT
GTTTTTGATATGAAGCATCCCGAAGTTCCTAAAGAATTGGAGCATTTATA
TTTACCAAATCAACCAGCTGTACGATTAGGAAGTATTGGATCTGGAAGAC
CAGTTACTGATGTTGACACATTTCGAGATAGGTTTTCAAAGGAACATTTT
CTTTTGGCATATGATTCTGAATATGATCAGGTTTTGGATTCAATCAAGGG
AAACGGGTTAGGCAGTTTTGCTTTGATTAGAGGAATCGCTGATTATATTG
ACGGAAGCACTGGGGGTATCTGGCAACCATATGCTTCCTTGGCTGCCGCT
GCCTTCATGAAAGCTGTTATTGTTCGATTGAAAATTGAATAATTTGTTAT
TTGTGCTCGTAAACGAAATCATGAAGTTACTTTATTGAATAGAAATATAA
CTGATTTTTTGTTTCCTAAACAATAGTTTTTGTTCAATTATTTTGTATAT
GAAATAAAATTTGTTCTTAGAAAAAAAA
back to top

protein sequence of SMED30024625-orf-1

>SMED30024625-orf-1 ID=SMED30024625-orf-1|Name=SMED30024625-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=579bp
MTNKNTKVVMTPTLKGNVKTIKVERINSVDTKNIYFEAQGMNSGLIINKE
DKNSKDDKVPQEMQLEFTCMMRNEINGDTYAENRRIKFWFIEGLKQMDKL
DGSYEFFKELINPAQFPKDYPMFVKKVMKQLQMDRFSKLKRVDIDFITLN
KQEQDALVPQMRRAGMEEKPIELVVKENLQARLDEAYPNCLSMDDLVRIL
NVKDNVIKPQITELLAKDVIEEVIVEGKGMGFRRKICYHNEDVKVVKETD
QMQKIFKKEKPTVAIITNLLCEKLAVDAMMEEKTTFVKFEGESHVYTIGR
IGDKKVISTKVAMVGRELKARISSANTTTRLLGTFQDVQHVLIVGVGGSV
PHMYEFDKHSRLGDIVVSYPNDDNSVYIFCERLHINEENNDPNTISFEIK
DFKIKDNTLQNVIDDVLENFVNDPKSCEWQRYMEEAKAEIQMSDINFSRP
SADTDKLKLKVSDKVVFDMKHPEVPKELEHLYLPNQPAVRLGSIGSGRPV
TDVDTFRDRFSKEHFLLAYDSEYDQVLDSIKGNGLGSFALIRGIADYIDG
STGGIWQPYASLAAAAFMKAVIVRLKIE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000101muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR035994Nucleoside_phosphorylase_sf
IPR000845Nucleoside_phosphorylase_d
Vocabulary: biological process
TermDefinition
GO:0009116nucleoside metabolic process
Vocabulary: molecular function
TermDefinition
GO:0003824catalytic activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR47705FAMILY NOT NAMEDcoord: 2..575
NoneNo IPR availableCDDcd09008MTANcoord: 263..368
e-value: 2.39074E-4
score: 40.5581
IPR035994Nucleoside phosphorylase superfamilySUPERFAMILYSSF53167Purine and uridine phosphorylasescoord: 257..571