Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase

Overview
NameVery-long-chain (3R)-3-hydroxyacyl-CoA dehydratase
Smed IDSMED30024624
Length (bp)769
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase (SMED30024624) t-SNE clustered cells

Violin plots show distribution of expression levels for Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase (SMED30024624) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase (SMED30024624) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase (SMED30024624) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024624

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30024624h1SMcG0022375 Contig2821GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30024624h1SMcG0022375 dd_Smed_v4_1743_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30024624h1SMcG0022375 dd_Smed_v4_1743_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Human
Match: HACD2 (3-hydroxyacyl-CoA dehydratase 2 [Source:HGNC Symbol;Acc:HGNC:9640])

HSP 1 Score: 176.407 bits (446), Expect = 4.363e-54
Identity = 100/212 (47.17%), Postives = 133/212 (62.74%), Query Frame = 1
Query:   52 YLFIYNLTLTCGWAYVLYKEIYALWSTKFNLVETYSIIEKPLKLVQTAAVLEILHSAFGFVKSRVDITTIQVSSRLFLVWGICNIFPKIISETYGIPMFIIAWSIAEIIRYGYYATHLINCVPYPLVWLRYTLFYVLYPMGVTGEVLAILES--FRNAYGTTSFIDLPNSLNIQMRYDFILVLVLVSYFPIFPQLFGHMIVQRKKILGKSHE 681
            YL IYN+ +T GW  +    + A +  K +    Y  IEKPLK  QT A+LEILH A G V S V +T+ QV SR+FL+W + +   ++ SE   + +F+IAW+I EIIRY +Y   L+N +PY + W RYTLF VLYPMGV+GE+L I  +  F    G  S I LPN  N    Y   L+L+++SY PIFPQL+ HMI QR+KIL  + E
Sbjct:   41 YLVIYNVVMTAGWLVIAVGLVRA-YLAKGSYHSLYYSIEKPLKFFQTGALLEILHCAIGIVPSSVVLTSFQVMSRVFLIWAVTHSVKEVQSED-SVLLFVIAWTITEIIRYSFYTFSLLNHLPYLIKWARYTLFIVLYPMGVSGELLTIYAALPFVRQAGLYS-ISLPNKYNFSFDYYAFLILIMISYIPIFPQLYFHMIHQRRKILSHTEE 249          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Human
Match: HACD1 (3-hydroxyacyl-CoA dehydratase 1 [Source:HGNC Symbol;Acc:HGNC:9639])

HSP 1 Score: 145.976 bits (367), Expect = 8.783e-42
Identity = 81/206 (39.32%), Postives = 123/206 (59.71%), Query Frame = 1
Query:   52 YLFIYNLTLTCGWAYVLYKEIYALWSTKFNLVETYSIIEKPLKLVQTAAVLEILHSAFGFVKSRVDITTIQVSSRLFLVWGICNIFPKIISETYGIPMFIIAWSIAEIIRYGYYATHLINCVPYPLVWLRYTLFYVLYPMGVTGEVLAILESFRNAYGTTSF-IDLPNSLNIQMRYDFILVLVLVSYFPIFPQLFGHMIVQRKKIL 666
            +L  Y++ +T GW  VL   +   +  K      Y  I+K LK  QT A+LEI+H   G V + V +T +QVSSR+F+VW I +    I +E   + +F++AW++ EI RY +Y   L++ +PY + W RY  F +LYP+GV GE+L I  +  +   T  F I LPN  N+   Y + L++ + SY P+FPQL+ HM+ QR+K+L
Sbjct:   75 WLTFYDIAMTAGW-LVLAIAMVRFYMEKGTHRGLYKSIQKTLKFFQTFALLEIVHCLIGIVPTSVIVTGVQVSSRIFMVWLITHSIKPIQNEE-SVVLFLVAWTVTEITRYSFYTFSLLDHLPYFIKWARYNFFIILYPVGVAGELLTIYAALPHVKKTGMFSIRLPNKYNVSFDYYYFLLITMASYIPLFPQLYFHMLRQRRKVL 278          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Human
Match: HACD2 (3-hydroxyacyl-CoA dehydratase 2 [Source:HGNC Symbol;Acc:HGNC:9640])

HSP 1 Score: 85.8853 bits (211), Expect = 5.666e-21
Identity = 47/99 (47.47%), Postives = 64/99 (64.65%), Query Frame = 1
Query:  271 SRLFLVWGICNIFPKIISETYGIPMFIIAWSIAEIIRYGYYATHLINCVPYPLVWLRYTLFYVLYPMGVTGEVLAILES--FRNAYGTTSFIDLPNSLN 561
            SR+FL+W + +   ++ SE   + +F+IAW+I EIIRY +Y   L+N +PY + W RYTLF VLYPMGV+GE+L I  +  F    G  S I LPN  N
Sbjct:    2 SRVFLIWAVTHSVKEVQSED-SVLLFVIAWTITEIIRYSFYTFSLLNHLPYLIKWARYTLFIVLYPMGVSGELLTIYAALPFVRQAGLYS-ISLPNKYN 98          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Human
Match: HACD1 (3-hydroxyacyl-CoA dehydratase 1 [Source:HGNC Symbol;Acc:HGNC:9639])

HSP 1 Score: 83.1889 bits (204), Expect = 5.210e-19
Identity = 48/131 (36.64%), Postives = 76/131 (58.02%), Query Frame = 1
Query:   52 YLFIYNLTLTCGWAYVLYKEIYALWSTKFNLVETYSIIEKPLKLVQTAAVLEILHSAFGFVKSRVDITTIQVSSRLFLVWGICNIFPKIISETYGIPMFIIAWSIAEIIRYGYYATHLINCVPYPLVWLRY 444
            +L  Y++ +T GW  VL   +   +  K      Y  I+K LK  QT A+LEI+H   G V + V +T +QVSSR+F+VW I +    I +E   + +F++AW++ EI RY +Y   L++ +PY + W R+
Sbjct:   41 WLTFYDIAMTAGW-LVLAIAMVRFYMEKGTHRGLYKSIQKTLKFFQTFALLEIVHCLIGIVPTSVIVTGVQVSSRIFMVWLITHSIKPIQNEE-SVVLFLVAWTVTEITRYSFYTFSLLDHLPYFIKWARW 169          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Human
Match: HACD3 (3-hydroxyacyl-CoA dehydratase 3 [Source:HGNC Symbol;Acc:HGNC:24175])

HSP 1 Score: 76.6406 bits (187), Expect = 4.846e-16
Identity = 61/214 (28.50%), Postives = 107/214 (50.00%), Query Frame = 1
Query:   52 YLFIYNLTLTCGWAYVLYK-EIYALWSTKFNLVETYSIIEKPLKLVQTAAVLEILHSAFGFVKSRVDITTIQVSSRLFLVWGICNIFPKIISETYGIPMFIIAWSIAEIIRYGYYATHLINCVPYPLVWLRYTLFYVLYPMGVTGEVLAILESFR--NAYGTTSFIDLPNSLNIQMRYDFILVLVLVSYFPIFPQLFGHMIVQRKKILGKSHES 684
            YLF+YNL    G++++     +      K +  +T+  +   +   Q  AV+E +++A G   S V  + IQ+  R F+++ I     ++ ++     +F + WS  EI RY +Y    I+     L WLRYTL+  LYP+G   E +++++S    N  G  SF  LP  + I++R+ F L + L+  F      F H+  QR++  G+  + 
Sbjct:   32 YLFMYNLVQFLGFSWIFVNLTVRFCILGKESFYDTFHTVADMMYFCQMLAVVETINAAIGVTTSPVLPSLIQLLGRNFILFIIFGTMEEMQNKAVVFFVFYL-WSAIEIFRYSFYMLTCIDMDWKVLTWLRYTLWIPLYPLGCLAEAVSVIQSIPIFNETGRFSF-TLPYPVKIKVRFSFFLQIYLIMIFLGLYINFRHLYKQRRRRYGQKKKK 243          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Celegans
Match: hpo-8 (Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase hpo-8 [Source:UniProtKB/Swiss-Prot;Acc:O17040])

HSP 1 Score: 160.614 bits (405), Expect = 1.052e-48
Identity = 87/216 (40.28%), Postives = 135/216 (62.50%), Query Frame = 1
Query:   43 VPKYLFIYNLTLTCGWAYVLYKEIYALWSTKFNLVETYSIIEKPLKLVQTAAVLEILHSAFGFVKSRVDITTIQVSSRLFLVWGICNIFPKIISETYGIPMFIIAWSIAEIIRYGYYATHLINC-VPYPLVWLRYTLFYVLYPMGVTGEVLAILESFRNAYGTTSF-IDLPNSLNIQMRYDFILVLVLVSYFPIFPQLFGHMIVQRKKILGKSHES 684
            V  YL  YN+    GW+ +L K +  L +      + Y  +E  LK+ QTAA+LE++H+  G V+S V  T +QV+SR+ LVW I ++       + G+P+ ++AWS+ E+IRY +YA  ++   +PY L++LRYTLFYVLYPMGV+GE+L +  S           +++PN LN+ + + ++L++  +SY P FPQL+ +MI QRKKILG   + 
Sbjct:    3 VQTYLVAYNVLQILGWSAILVKTVLGL-ANGLTWPQLYESVEFELKIFQTAAILEVIHAIVGLVRSPVGTTAMQVTSRVVLVWPILHLC-STARFSIGVPLLLVAWSVTEVIRYSFYALSVLKQPIPYFLLYLRYTLFYVLYPMGVSGELLTLFASLNEVDEKKILTLEMPNRLNMGISFWWVLIIAALSYIPGFPQLYFYMIGQRKKILGGGSKK 216          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Celegans
Match: hpo-8 (Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase hpo-8 [Source:UniProtKB/Swiss-Prot;Acc:O17040])

HSP 1 Score: 160.614 bits (405), Expect = 1.052e-48
Identity = 87/216 (40.28%), Postives = 135/216 (62.50%), Query Frame = 1
Query:   43 VPKYLFIYNLTLTCGWAYVLYKEIYALWSTKFNLVETYSIIEKPLKLVQTAAVLEILHSAFGFVKSRVDITTIQVSSRLFLVWGICNIFPKIISETYGIPMFIIAWSIAEIIRYGYYATHLINC-VPYPLVWLRYTLFYVLYPMGVTGEVLAILESFRNAYGTTSF-IDLPNSLNIQMRYDFILVLVLVSYFPIFPQLFGHMIVQRKKILGKSHES 684
            V  YL  YN+    GW+ +L K +  L +      + Y  +E  LK+ QTAA+LE++H+  G V+S V  T +QV+SR+ LVW I ++       + G+P+ ++AWS+ E+IRY +YA  ++   +PY L++LRYTLFYVLYPMGV+GE+L +  S           +++PN LN+ + + ++L++  +SY P FPQL+ +MI QRKKILG   + 
Sbjct:    3 VQTYLVAYNVLQILGWSAILVKTVLGL-ANGLTWPQLYESVEFELKIFQTAAILEVIHAIVGLVRSPVGTTAMQVTSRVVLVWPILHLC-STARFSIGVPLLLVAWSVTEVIRYSFYALSVLKQPIPYFLLYLRYTLFYVLYPMGVSGELLTLFASLNEVDEKKILTLEMPNRLNMGISFWWVLIIAALSYIPGFPQLYFYMIGQRKKILGGGSKK 216          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Celegans
Match: R10E4.9 (Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase [Source:UniProtKB/TrEMBL;Acc:Q21905])

HSP 1 Score: 51.2174 bits (121), Expect = 1.209e-7
Identity = 58/209 (27.75%), Postives = 90/209 (43.06%), Query Frame = 1
Query:   55 LFIYNLTLTCGWAYVLYKEIYALWSTKFNLVETYSIIEKPLKLVQTAAVLEILHSAFGFVKSRVDITTIQVSSRLFLVWGICNIFPKIISETYGIPMFIIAWSIAEIIRYGYYATHLINCVPYPLVWLRYTLFYVLYPMGVTGEVLAILESFRNAYGTTSFIDLPNSLNIQMRYDFILVLVLVSYFPIFPQLFGHM---IVQRKKILGK 672
            LFIY L L     Y      +A ++++F     Y  I   L  + +   L+I  S F   KS      +QVS RL ++W    +   ++S  Y     +  + ++E+ R  YY ++ +      L WLRY  F VLYP+G T E L  +  F        F+     ++I+ RY    +L  V +  I   L+  M     Q+ K L K
Sbjct:    9 LFIYTLVLFILHGYGFLYIFHAEYTSEFK----YPEIMWFLLFITSLQYLDIPFSFF-LTKSNPVAVFVQVSGRLLVLW----VASHMVSWKYAAFSLVAVYLLSELCRGPYYLSNCLGTPNRSLTWLRYNAFKVLYPVGFTCEALVFINVF--------FVSGKIPIDIKDRYFQYSLLFTVFFLTIVTFLYRSMSRKAAQKNKTLAK 200          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Fly
Match: Hacd1 (gene:FBgn0032394 transcript:FBtr0080313)

HSP 1 Score: 135.191 bits (339), Expect = 1.509e-38
Identity = 87/216 (40.28%), Postives = 127/216 (58.80%), Query Frame = 1
Query:   52 YLFIYNLTLTCGWAYVLYKEI--YALWSTKFNL-VETYSIIEKPLKLVQTAAVLEILHSAFGFVKSRVDITTIQVSSRLFLVWGICNIFPKIISETYGIPMFIIAWSIAEIIRYGYYATHLINCVPYPLVWLRYTLFYVLYPMGVTGEVLAI--LESFRNAYGTTSFIDLPNSLNIQMRYDFILVLVLVSYFPIFPQLFGHMIVQRKKILGKSHES 684
            YLF YN     GW+Y+L++ +  Y L   +F   V  +      + + Q AA +EIL+++FG VKS   +T  QV SR+ +V G+    P     + G+P+ ++AW+I EIIRYGYYA +++  VP+ +V+LRYT F VLYP+GVTGE+L     +S+       S + +PN  N    Y   L +V++ Y PIFPQL+ HM  QR+KILG     
Sbjct:   25 YLFAYNAGQVVGWSYILWQLVNYYILQGPEFRAQVTLWEYTRLAVIIFQNAAFVEILNASFGLVKSNPVVTGFQVFSRMMVVVGVVMATP-TGKVSPGLPIALLAWAITEIIRYGYYALNIVKVVPHFVVFLRYTTFIVLYPIGVTGELLCFWWAQSYARENSVWSVV-MPNKWNATFSYFGFLWIVMLGYIPIFPQLYLHMFAQRRKILGGGSSG 238          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Fly
Match: Hacd2 (gene:FBgn0032524 transcript:FBtr0080519)

HSP 1 Score: 88.9669 bits (219), Expect = 3.881e-20
Identity = 64/214 (29.91%), Postives = 108/214 (50.47%), Query Frame = 1
Query:   52 YLFIYNLTLTCGWAYVLYKEIYALWSTKFNLV-ETYSIIEKPLKLVQTAAVLEILHSAFGFVKSRVDITTIQVSSRLFLVWGICNIFPKIISETYGIPMFIIAWSIAEIIRYGYYATHLINCVPYPLVWLRYTLFYVLYPMGVTGEVLAILESFRNAYGTTSF-IDLPNSLNIQMRYDFILVLVLVSYFPIFPQ---LFGHMIVQRKKILGKSH 678
            Y+  YNL +  G+ Y++       +    + + +TY+ +    K +Q    LE++H  FG+ K    +   QVS R F+++ + ++ P++ ++     +FII WS+ E++RY YY   L+      L WLRYT++  LYPMG+  E + +L +      T  F +++PN  NI   +D +L L +     I P    +  HM   R K LGK  
Sbjct:  151 YMIFYNLAMFVGYLYIMVVMGVLYYRDGVDSIGKTYANVGNAFKFIQLLQYLEVMHPMFGYTKGSPVVPFFQVSGRNFILFLMIDMEPRMYAKPVVFYVFII-WSLVELVRYPYYLAQLLGREVGLLTWLRYTIWIPLYPMGILCEGIIVLRNIPYIEETKRFTVEMPNPWNIT--FDMVLFLKIYLMLLIIPGSYLVMSHMAKLRSKKLGKGR 361          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Zebrafish
Match: hacd2 (3-hydroxyacyl-CoA dehydratase 2 [Source:ZFIN;Acc:ZDB-GENE-030131-6053])

HSP 1 Score: 168.318 bits (425), Expect = 3.192e-51
Identity = 95/217 (43.78%), Postives = 129/217 (59.45%), Query Frame = 1
Query:   37 TFVPKYLFIYNLTLTCGWAYVLYKEIYALWSTKFNLVETYSIIEKPLKLVQTAAVLEILHSAFGFVKSRVDITTIQVSSRLFLVWGICNIFPKIISETYGIPMFIIAWSIAEIIRYGYYATHLINCVPYPLVWLRYTLFYVLYPMGVTGEVLAILES--FRNAYGTTSFIDLPNSLNIQMRYDFILVLVLVSYFPIFPQLFGHMIVQRKKILGKSHE 681
            T    YL IYN+ +T GW  +    + A +  + +    Y  IEKPLK  QT A+LEILH A G V S V +T  QV SR+FL W + +   ++ SE   + +F++AW++ EIIRY +Y   L+N +PY + W RYT F VLYPMGV GE+L I  +  +    G  S I LPN  N    Y   L+ V++SY P+FPQL+ HM+ QRKK+LG   E
Sbjct:   26 TLATAYLVIYNVIMTAGWLVIAVGLVRA-YLARGSYHGLYYSIEKPLKFFQTGALLEILHCAVGIVPSSVVLTGFQVMSRVFLTWAVTHSVREVQSED-SVLLFVVAWTVTEIIRYSFYTFSLLNHLPYLIKWARYTFFIVLYPMGVMGELLTIYAALPYVQKAGLYS-ITLPNKYNFSFDYHTFLIFVMISYIPLFPQLYFHMMRQRKKVLGHVEE 239          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Zebrafish
Match: hacd1 (3-hydroxyacyl-CoA dehydratase 1 [Source:ZFIN;Acc:ZDB-GENE-170413-2])

HSP 1 Score: 147.902 bits (372), Expect = 2.443e-43
Identity = 82/214 (38.32%), Postives = 128/214 (59.81%), Query Frame = 1
Query:   31 KMTFVPKYLFIYNLTLTCGWAYVLYKEIYALWSTKFNLVETYSIIEKPLKLVQTAAVLEILHSAFGFVKSRVDITTIQVSSRLFLVWGICNIFPKIISETYGIPMFIIAWSIAEIIRYGYYATHLINCVPYPLVWLRYTLFYVLYPMGVTGEVLAILES--FRNAYGTTSFIDLPNSLNIQMRYDFILVLVLVSYFPIFPQLFGHMIVQRKKIL 666
            K   V  +L  YN+ +T GW  VL   +   +  K      Y  I + LK  QT A+LE+ H A G V++ V +T +QV SR+F+VW I N   +I +E   + +F++ W++ EI RY +Y  +L+N +PY + W RY +F V+YP+GV GE+L I  +  +    G  S + LPN  N+   Y + L++V++SY P+FPQL+ HM+ QR+++L
Sbjct:   22 KGAIVTAWLTFYNIAMTAGWL-VLTVAMVKYYLQKGTHKGLYRNIARTLKFFQTFALLEVGHCAIGIVRTSVIVTGVQVCSRIFMVWFITNSIRQIQNEE-SVILFVVVWTVTEITRYSFYTFNLLNHLPYFIKWARYNMFIVMYPLGVVGELLTIHAALPYVRRSGMYS-LRLPNKYNVSFDYYYFLIIVMLSYIPLFPQLYFHMLRQRRRVL 232          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Zebrafish
Match: hacd2 (3-hydroxyacyl-CoA dehydratase 2 [Source:ZFIN;Acc:ZDB-GENE-030131-6053])

HSP 1 Score: 139.043 bits (349), Expect = 3.941e-40
Identity = 82/195 (42.05%), Postives = 112/195 (57.44%), Query Frame = 1
Query:   37 TFVPKYLFIYNLTLTCGWAYVLYKEIYALWSTKFNLVETYSIIEKPLKLVQTAAVLEILHSAFGFVKSRVDITTIQVSSRLFLVWGICNIFPKIISETYGIPMFIIAWSIAEIIRYGYYATHLINCVPYPLVWLRYTLFYVLYPMGVTGEVLAILES--FRNAYGTTSFIDLPNSLNIQMRYDFILVLVLVSYFP 615
            T    YL IYN+ +T GW  +    + A +  + +    Y  IEKPLK  QT A+LEILH A G V S V +T  QV SR+FL W + +   ++ SE   + +F++AW++ EIIRY +Y   L+N +PY + W RYT F VLYPMGV GE+L I  +  +    G  S I LPN  N    Y   L+ V++SY P
Sbjct:   22 TLATAYLVIYNVIMTAGWLVIAVGLVRA-YLARGSYHGLYYSIEKPLKFFQTGALLEILHCAVGIVPSSVVLTGFQVMSRVFLTWAVTHSVREVQSED-SVLLFVVAWTVTEIIRYSFYTFSLLNHLPYLIKWARYTFFIVLYPMGVMGELLTIYAALPYVQKAGLYS-ITLPNKYNFSFDYHTFLIFVMISYIP 213          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Zebrafish
Match: hacd2 (3-hydroxyacyl-CoA dehydratase 2 [Source:ZFIN;Acc:ZDB-GENE-030131-6053])

HSP 1 Score: 131.339 bits (329), Expect = 8.676e-38
Identity = 75/170 (44.12%), Postives = 100/170 (58.82%), Query Frame = 1
Query:  208 ILHSAFGFVKSRVDITTIQVSSRLFLVW----------GICNIFPKIISETYGIPMFIIAWSIAEIIRYGYYATHLINCVPYPLVWLRYTLFYVLYPMGVTGEVLAILES--FRNAYGTTSFIDLPNSLNIQMRYDFILVLVLVSYFPIFPQLFGHMIVQRKKILGKSHE 681
            ILH A G V S V +T  QV SR+FL W          G  N+  ++ SE   + +F++AW++ EIIRY +Y   L+N +PY + W RYT F VLYPMGV GE+L I  +  +    G  S I LPN  N    Y   L+ V++SY P+FPQL+ HM+ QRKK+LG   E
Sbjct:    1 ILHCAVGIVPSSVVLTGFQVMSRVFLTWAVTHSVRESLGDLNLSFQVQSED-SVLLFVVAWTVTEIIRYSFYTFSLLNHLPYLIKWARYTFFIVLYPMGVMGELLTIYAALPYVQKAGLYS-ITLPNKYNFSFDYHTFLIFVMISYIPLFPQLYFHMMRQRKKVLGHVEE 168          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Zebrafish
Match: hacd3 (3-hydroxyacyl-CoA dehydratase 3 [Source:NCBI gene;Acc:393441])

HSP 1 Score: 71.633 bits (174), Expect = 5.844e-14
Identity = 57/192 (29.69%), Postives = 97/192 (50.52%), Query Frame = 1
Query:   52 YLFIYNLTLTCGWAYVLYK---EIYALWSTKFNLVETYSIIEKPLKLVQTAAVLEILHSAFGFVKSRVDITTIQVSSRLFLVWGICNIFPKIISETYGIPMFIIAWSIAEIIRYGYYATHLINCVPYPLVWLRYTLFYVLYPMGVTGEVLAILESFRNAYGTTSF--IDLPNSLNIQMRYDFILVLVLVSYF 612
            +LF+YNL    G++++       ++ L    F   +T+  I   +   Q  A++E+++ A G VK+ V    IQV  R F+++ I      + ++     +F + WS  EI RY +Y    I+     L WLRYT++  LYP+GV  E +A+++S    +  T    I LP +  + + + +IL L LV  F
Sbjct:  152 FLFMYNLVQFLGYSWIFVNMTVRLFILGQDSF--YDTFHTIADVMYFCQMLAIMEVINPAVGLVKTGVMPAFIQVMGRNFILFVIFGSLEDMQNKPVVFFVFYL-WSTIEIFRYPFYMLACIDTEWKLLTWLRYTIWMPLYPLGVLAEAVAVIQSI-PIFDETKLLSIPLPKATGLSLSFSYILQLYLVVMF 339          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Xenopus
Match: kif2a (kinesin heavy chain member 2A [Source:Xenbase;Acc:XB-GENE-951755])

HSP 1 Score: 168.318 bits (425), Expect = 5.349e-51
Identity = 94/212 (44.34%), Postives = 129/212 (60.85%), Query Frame = 1
Query:   52 YLFIYNLTLTCGWAYVLYKEIYALWSTKFNLVETYSIIEKPLKLVQTAAVLEILHSAFGFVKSRVDITTIQVSSRLFLVWGICNIFPKIISETYGIPMFIIAWSIAEIIRYGYYATHLINCVPYPLVWLRYTLFYVLYPMGVTGEVLAILESFRNAYGTTSF-IDLPNSLNIQMRYDFILVLVLVSYFPIFPQLFGHMIVQRKKILGKSHES 684
            YL IYN+ +T GW  V+   +   + TK +    Y  IE+PLK  QT A+LEI H A G V S V +T  QV SR+FL W + +   ++ +E   + +F++AW+I EIIRY +Y   L+N +PY + W RYTLF VLYPMGVTGE+L I  +      T  + I LPN  N    Y   L+LV++SY PIFPQL+ HM  QR+K++   H+ 
Sbjct:   36 YLVIYNVVMTAGWL-VIAVGLVRTYLTKGSYHNLYYSIERPLKFFQTGALLEIGHCAVGIVPSSVVLTAFQVMSRVFLTWAVTHSVREVQNED-SVLLFVVAWTITEIIRYSFYTFSLLNHLPYIIKWARYTLFIVLYPMGVTGELLTIYAALPTVKKTGLYSISLPNKYNFSFDYYTFLILVMMSYIPIFPQLYFHMFHQRRKVITAEHKK 245          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Xenopus
Match: HACD1 (3-hydroxyacyl-CoA dehydratase 1 [Source:NCBI gene;Acc:100145048])

HSP 1 Score: 155.992 bits (393), Expect = 2.545e-46
Identity = 82/206 (39.81%), Postives = 128/206 (62.14%), Query Frame = 1
Query:   52 YLFIYNLTLTCGWAYVLYKEIYALWSTKFNLVETYSIIEKPLKLVQTAAVLEILHSAFGFVKSRVDITTIQVSSRLFLVWGICNIFPKIISETYGIPMFIIAWSIAEIIRYGYYATHLINCVPYPLVWLRYTLFYVLYPMGVTGEVLAILESFRNAYGTTSF-IDLPNSLNIQMRYDFILVLVLVSYFPIFPQLFGHMIVQRKKIL 666
            +L  YN+ +T GW  VL   +   ++ K      Y  I+K LK  QT A+LE++H A G V + V +T +QVSSR+F+VW I +   ++ SE +G+ +F++ W++ EI RY YY   L+N +PY + W RY LF VLYP+GV GE+L I  +  +   +  + + LPN  N+   Y + L++ + SY P+FPQL+ HM+ QR+++L
Sbjct:   27 WLTFYNIAMTAGWL-VLAIAMIRFYAEKGTHKGLYRNIQKTLKFFQTFALLELVHCALGIVHTSVLVTGVQVSSRIFMVWFITSSIKQVQSE-HGVLIFLVVWTVTEITRYSYYTFKLLNHLPYFIKWARYNLFIVLYPVGVVGELLTIYAALPHVRKSAMYSLRLPNKYNVSFDYYYFLIIAMCSYIPLFPQLYFHMLRQRRRVL 230          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Xenopus
Match: lrp12 (LDL receptor related protein 12 [Source:Xenbase;Acc:XB-GENE-980112])

HSP 1 Score: 64.6994 bits (156), Expect = 1.846e-11
Identity = 48/156 (30.77%), Postives = 81/156 (51.92%), Query Frame = 1
Query:   52 YLFIYNLTLTCGWAYVLYK---EIYALWSTKFNLVETYSIIEKPLKLVQTAAVLEILHSAFGFVKSRVDITTIQVSSRLFLVWGICNIFPKIISETYGIPMFII-AWSIAEIIRYGYYATHLINCVPYPLVWLRYTLFYVLYPMGVTGEVLAILES 507
            YLF+YNL    G++++       ++ L    F   +T++ +   +   QT A+LEI++   G VK+ V    IQV  R F+++ I     ++  +T  I  FI   WS  EI RY +Y    ++     L W+RYT++  LYP+G   E  +I+++
Sbjct:  141 YLFMYNLVQFLGFSWIFVNMTVRLFILGQDSF--YDTFNSMGDMMYFCQTLALLEIINPLIGLVKTGVAPALIQVLGRNFILFFILGQLDEM--QTKAIVFFIFYLWSSIEIFRYPFYMLACLDTEWKLLTWIRYTIWIPLYPLGALAEAASIIQA 292          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Xenopus
Match: lrp12 (LDL receptor related protein 12 [Source:Xenbase;Acc:XB-GENE-980112])

HSP 1 Score: 64.3142 bits (155), Expect = 2.603e-11
Identity = 48/156 (30.77%), Postives = 81/156 (51.92%), Query Frame = 1
Query:   52 YLFIYNLTLTCGWAYVLYK---EIYALWSTKFNLVETYSIIEKPLKLVQTAAVLEILHSAFGFVKSRVDITTIQVSSRLFLVWGICNIFPKIISETYGIPMFII-AWSIAEIIRYGYYATHLINCVPYPLVWLRYTLFYVLYPMGVTGEVLAILES 507
            YLF+YNL    G++++       ++ L    F   +T++ +   +   QT A+LEI++   G VK+ V    IQV  R F+++ I     ++  +T  I  FI   WS  EI RY +Y    ++     L W+RYT++  LYP+G   E  +I+++
Sbjct:  170 YLFMYNLVQFLGFSWIFVNMTVRLFILGQDSF--YDTFNSMGDMMYFCQTLALLEIINPLIGLVKTGVAPALIQVLGRNFILFFILGQLDEM--QTKAIVFFIFYLWSSIEIFRYPFYMLACLDTEWKLLTWIRYTIWIPLYPLGALAEAASIIQA 321          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Xenopus
Match: lrp12 (LDL receptor related protein 12 [Source:Xenbase;Acc:XB-GENE-980112])

HSP 1 Score: 59.6918 bits (143), Expect = 7.656e-10
Identity = 47/149 (31.54%), Postives = 76/149 (51.01%), Query Frame = 1
Query:   52 YLFIYNLTLTCGWAYVLYK---EIYALWSTKFNLVETYSIIEKPLKLVQTAAVLEILHSAFGFVKSRVDITTIQVSSRLFLVWGICNIFPKIISETYGIPMFII-AWSIAEIIRYGYYATHLINCVPYPLVWLRYTLFYVLYPMGVTGE 486
            YLF+YNL    G++++       ++ L    F   +T++ +   +   QT A+LEI++   G VK+ V    IQV  R F+++ I     ++  +T  I  FI   WS  EI RY +Y    ++     L W+RYT++  LYP+G   E
Sbjct:  151 YLFMYNLVQFLGFSWIFVNMTVRLFILGQDSF--YDTFNSMGDMMYFCQTLALLEIINPLIGLVKTGVAPALIQVLGRNFILFFILGQLDEM--QTKAIVFFIFYLWSSIEIFRYPFYMLACLDTEWKLLTWIRYTIWIPLYPLGALAE 295          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Mouse
Match: Hacd2 (3-hydroxyacyl-CoA dehydratase 2 [Source:MGI Symbol;Acc:MGI:1918007])

HSP 1 Score: 176.407 bits (446), Expect = 2.995e-54
Identity = 98/212 (46.23%), Postives = 133/212 (62.74%), Query Frame = 1
Query:   52 YLFIYNLTLTCGWAYVLYKEIYALWSTKFNLVETYSIIEKPLKLVQTAAVLEILHSAFGFVKSRVDITTIQVSSRLFLVWGICNIFPKIISETYGIPMFIIAWSIAEIIRYGYYATHLINCVPYPLVWLRYTLFYVLYPMGVTGEVLAILES--FRNAYGTTSFIDLPNSLNIQMRYDFILVLVLVSYFPIFPQLFGHMIVQRKKILGKSHE 681
            YL IYN+ +T GW  +    + A +  K +    Y  IE+PLK  QT A+LEILH A G V S V +T+ QV SR+FL+W + +   ++ SE   + +F+IAW+I EIIRY +Y   L+N +PY + W RYTLF VLYPMGVTGE+L I  +  F    G  S I LPN  N    Y   L+L+++SY P+FPQL+ HMI QR+K+L  + E
Sbjct:   41 YLVIYNVVMTAGWLVIAVGLVRA-YLAKGSYHSLYYSIERPLKFFQTGALLEILHCAIGIVPSSVVLTSFQVMSRVFLIWAVTHSVKEVQSED-SVLLFVIAWTITEIIRYSFYTFSLLNHLPYIIKWARYTLFIVLYPMGVTGELLTIYAALPFVRQAGLYS-ISLPNKYNFSFDYHAFLILIMISYIPLFPQLYFHMIHQRRKVLSHTEE 249          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Mouse
Match: Hacd1 (3-hydroxyacyl-CoA dehydratase 1 [Source:MGI Symbol;Acc:MGI:1353592])

HSP 1 Score: 143.28 bits (360), Expect = 1.792e-41
Identity = 78/206 (37.86%), Postives = 123/206 (59.71%), Query Frame = 1
Query:   52 YLFIYNLTLTCGWAYVLYKEIYALWSTKFNLVETYSIIEKPLKLVQTAAVLEILHSAFGFVKSRVDITTIQVSSRLFLVWGICNIFPKIISETYGIPMFIIAWSIAEIIRYGYYATHLINCVPYPLVWLRYTLFYVLYPMGVTGEVLAILESFRNAYGTTSF-IDLPNSLNIQMRYDFILVLVLVSYFPIFPQLFGHMIVQRKKIL 666
            +L  YN+ +T GW  VL   +   +  K      Y  I+K LK  QT A+LE++H   G V + V +T +QVSSR+F+VW I +    I +E   + +F+++W++ EI RY +Y   L++ +P+ + W RY LF +LYP+GV GE+L I  +      +  F + LPN  N+   Y + L++ + SY P+FPQL+ HM+ QR+K+L
Sbjct:   35 WLTFYNIAMTAGW-LVLAIAMVRFYMEKGTHRGLYKSIQKTLKFFQTFALLEVVHCLIGIVPTSVLVTGVQVSSRIFMVWLITHSIKPIQNEE-SVVLFLVSWTVTEITRYSFYTFSLLDHLPHFIKWARYNLFIILYPVGVAGELLTIYAALPYVKKSGMFSVRLPNKYNVSFDYYYFLLITMASYIPLFPQLYFHMLRQRRKVL 238          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Mouse
Match: Hacd1 (3-hydroxyacyl-CoA dehydratase 1 [Source:MGI Symbol;Acc:MGI:1353592])

HSP 1 Score: 143.28 bits (360), Expect = 1.792e-41
Identity = 78/206 (37.86%), Postives = 123/206 (59.71%), Query Frame = 1
Query:   52 YLFIYNLTLTCGWAYVLYKEIYALWSTKFNLVETYSIIEKPLKLVQTAAVLEILHSAFGFVKSRVDITTIQVSSRLFLVWGICNIFPKIISETYGIPMFIIAWSIAEIIRYGYYATHLINCVPYPLVWLRYTLFYVLYPMGVTGEVLAILESFRNAYGTTSF-IDLPNSLNIQMRYDFILVLVLVSYFPIFPQLFGHMIVQRKKIL 666
            +L  YN+ +T GW  VL   +   +  K      Y  I+K LK  QT A+LE++H   G V + V +T +QVSSR+F+VW I +    I +E   + +F+++W++ EI RY +Y   L++ +P+ + W RY LF +LYP+GV GE+L I  +      +  F + LPN  N+   Y + L++ + SY P+FPQL+ HM+ QR+K+L
Sbjct:   35 WLTFYNIAMTAGW-LVLAIAMVRFYMEKGTHRGLYKSIQKTLKFFQTFALLEVVHCLIGIVPTSVLVTGVQVSSRIFMVWLITHSIKPIQNEE-SVVLFLVSWTVTEITRYSFYTFSLLDHLPHFIKWARYNLFIILYPVGVAGELLTIYAALPYVKKSGMFSVRLPNKYNVSFDYYYFLLITMASYIPLFPQLYFHMLRQRRKVL 238          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Mouse
Match: Hacd3 (3-hydroxyacyl-CoA dehydratase 3 [Source:MGI Symbol;Acc:MGI:1889341])

HSP 1 Score: 73.1738 bits (178), Expect = 1.759e-14
Identity = 65/220 (29.55%), Postives = 105/220 (47.73%), Query Frame = 1
Query:   52 YLFIYNLTLTCGWAYV---LYKEIYALWSTKFNLVETYSIIEKPLKLVQTAAVLEILHSAFGFVKSRVDITTIQVSSR---LFLVWGICNIFPKIISETYGIPMFII-AWSIAEIIRYGYYATHLINCVPYPLVWLRYTLFYVLYPMGVTGEVLAILESFR--NAYGTTSFIDLPNSLNIQMRYDFILVLVLVSYFPIFPQLFGHMIVQRKKILGKSHES 684
            YLF+YNL    G++++   L    + L    F   +T+  +   +   Q  A++E L++A G   + V    IQ   R   LFLV+G          +   +  F+  +WS  EI RY +Y    I+     L WLRYT++  LYP+G   E +A+++S    N  G  SF  LP  + +++R+ F L + LV  F      F H+  QR++  G+  + 
Sbjct:  149 YLFMYNLVQLLGFSWIFVNLTVRFFILGKESF--YDTFHNVADMMYFCQMLALVETLNAAIGVTSTPVLPALIQFLGRNFILFLVFGTMEEM-----QNKAVVFFVFYSWSAIEIFRYPFYMLSCIDMDWKVLTWLRYTMWIPLYPLGCLSEAVAVIQSIPVFNESGRFSFT-LPYPVKMKVRFSFFLQVYLVMLFLGLYINFRHLYKQRRRRYGQKKKK 360          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Mouse
Match: Hacd4 (3-hydroxyacyl-CoA dehydratase 4 [Source:MGI Symbol;Acc:MGI:1914025])

HSP 1 Score: 65.855 bits (159), Expect = 1.792e-12
Identity = 53/208 (25.48%), Postives = 107/208 (51.44%), Query Frame = 1
Query:   52 YLFIYNLTLTCGWAYVLYKEIYALWS-TKFNLVETYSIIEKPLKLVQTAAVLEILHSAFGFVKSRVDITTIQVSSRLFLVWGICNIFPKIISETYGIPMFIIAWSIAEIIRYGYYATHLINCVPYPLVWLRYTLFYVLYPMGVTGEVLAILES--FRNAYGTTSFIDLPNSLNIQMRYDFILVLVLVSYFPIFPQLFGHMIVQRKKIL 666
            YLFIY L   CG +++L       +S  K ++ +T+  I   +++ Q+ ++LE+LH   G   +++    +Q++ R+ +++G+     ++  +     +FI+ W++ +++RY Y    +I      L WL  TL+  +YP+ V  E   I +S  +  ++GT S + LP   ++   + ++L L L+  F      + H+  +RK  L
Sbjct:   19 YLFIYYLIQFCGHSWILANMTVRFFSFGKDSMADTFYAIGLVMRVCQSISLLELLHIYIGIESNQLFPRFLQLTERVIILFGVITSQEEVQEKCVVCVLFIL-WNLLDMVRYTYSMLSVIGTSYAALTWLSQTLWMPIYPLCVLAEAFTIYQSLPYFESFGTNSTV-LP--FDLSTCFPYVLKLYLMMLFIGMYFTYSHLYTERKDFL 222          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. UniProt/SwissProt
Match: sp|Q2KIP8|HACD2_BOVIN (Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 2 OS=Bos taurus OX=9913 GN=HACD2 PE=2 SV=2)

HSP 1 Score: 177.563 bits (449), Expect = 8.728e-54
Identity = 100/212 (47.17%), Postives = 134/212 (63.21%), Query Frame = 1
Query:   52 YLFIYNLTLTCGWAYVLYKEIYALWSTKFNLVETYSIIEKPLKLVQTAAVLEILHSAFGFVKSRVDITTIQVSSRLFLVWGICNIFPKIISETYGIPMFIIAWSIAEIIRYGYYATHLINCVPYPLVWLRYTLFYVLYPMGVTGEVLAILES--FRNAYGTTSFIDLPNSLNIQMRYDFILVLVLVSYFPIFPQLFGHMIVQRKKILGKSHE 681
            YL IYN+ +T GW  +    + A +  K +    Y  IEKPLK  QT A+LEILH A G V S V +T+IQV SR+FL+W + +   ++ SE   + +F+IAW+I EIIRY +Y   L+N +PY + W RYTLF VLYPMGV+GE+L I  +  F    G  S I LPN  N    Y   L+L+++SY P+FPQL+ HMI QR+KIL  + E
Sbjct:   41 YLVIYNVVMTAGWLVIAVGLVRA-YLAKGSYHSLYYSIEKPLKFFQTGALLEILHCAIGIVPSSVVLTSIQVMSRVFLIWAVTHSVKEVQSED-SVLLFVIAWTITEIIRYSFYTFSLLNHLPYLIKWARYTLFIVLYPMGVSGELLTIYAALPFVRQAGLYS-ISLPNKYNFSFDYYAFLILIMISYIPLFPQLYFHMIHQRRKILSHTEE 249          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. UniProt/SwissProt
Match: sp|Q9D3B1|HACD2_MOUSE (Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 2 OS=Mus musculus OX=10090 GN=Hacd2 PE=1 SV=1)

HSP 1 Score: 176.407 bits (446), Expect = 2.095e-53
Identity = 98/212 (46.23%), Postives = 133/212 (62.74%), Query Frame = 1
Query:   52 YLFIYNLTLTCGWAYVLYKEIYALWSTKFNLVETYSIIEKPLKLVQTAAVLEILHSAFGFVKSRVDITTIQVSSRLFLVWGICNIFPKIISETYGIPMFIIAWSIAEIIRYGYYATHLINCVPYPLVWLRYTLFYVLYPMGVTGEVLAILES--FRNAYGTTSFIDLPNSLNIQMRYDFILVLVLVSYFPIFPQLFGHMIVQRKKILGKSHE 681
            YL IYN+ +T GW  +    + A +  K +    Y  IE+PLK  QT A+LEILH A G V S V +T+ QV SR+FL+W + +   ++ SE   + +F+IAW+I EIIRY +Y   L+N +PY + W RYTLF VLYPMGVTGE+L I  +  F    G  S I LPN  N    Y   L+L+++SY P+FPQL+ HMI QR+K+L  + E
Sbjct:   41 YLVIYNVVMTAGWLVIAVGLVRA-YLAKGSYHSLYYSIERPLKFFQTGALLEILHCAIGIVPSSVVLTSFQVMSRVFLIWAVTHSVKEVQSED-SVLLFVIAWTITEIIRYSFYTFSLLNHLPYIIKWARYTLFIVLYPMGVTGELLTIYAALPFVRQAGLYS-ISLPNKYNFSFDYHAFLILIMISYIPLFPQLYFHMIHQRRKVLSHTEE 249          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. UniProt/SwissProt
Match: sp|Q6Y1H2|HACD2_HUMAN (Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 2 OS=Homo sapiens OX=9606 GN=HACD2 PE=1 SV=1)

HSP 1 Score: 176.407 bits (446), Expect = 2.095e-53
Identity = 100/212 (47.17%), Postives = 133/212 (62.74%), Query Frame = 1
Query:   52 YLFIYNLTLTCGWAYVLYKEIYALWSTKFNLVETYSIIEKPLKLVQTAAVLEILHSAFGFVKSRVDITTIQVSSRLFLVWGICNIFPKIISETYGIPMFIIAWSIAEIIRYGYYATHLINCVPYPLVWLRYTLFYVLYPMGVTGEVLAILES--FRNAYGTTSFIDLPNSLNIQMRYDFILVLVLVSYFPIFPQLFGHMIVQRKKILGKSHE 681
            YL IYN+ +T GW  +    + A +  K +    Y  IEKPLK  QT A+LEILH A G V S V +T+ QV SR+FL+W + +   ++ SE   + +F+IAW+I EIIRY +Y   L+N +PY + W RYTLF VLYPMGV+GE+L I  +  F    G  S I LPN  N    Y   L+L+++SY PIFPQL+ HMI QR+KIL  + E
Sbjct:   41 YLVIYNVVMTAGWLVIAVGLVRA-YLAKGSYHSLYYSIEKPLKFFQTGALLEILHCAIGIVPSSVVLTSFQVMSRVFLIWAVTHSVKEVQSED-SVLLFVIAWTITEIIRYSFYTFSLLNHLPYLIKWARYTLFIVLYPMGVSGELLTIYAALPFVRQAGLYS-ISLPNKYNFSFDYYAFLILIMISYIPIFPQLYFHMIHQRRKILSHTEE 249          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. UniProt/SwissProt
Match: sp|Q5RBK3|HACD2_PONAB (Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 2 OS=Pongo abelii OX=9601 GN=HACD2 PE=2 SV=1)

HSP 1 Score: 176.407 bits (446), Expect = 2.157e-53
Identity = 100/212 (47.17%), Postives = 133/212 (62.74%), Query Frame = 1
Query:   52 YLFIYNLTLTCGWAYVLYKEIYALWSTKFNLVETYSIIEKPLKLVQTAAVLEILHSAFGFVKSRVDITTIQVSSRLFLVWGICNIFPKIISETYGIPMFIIAWSIAEIIRYGYYATHLINCVPYPLVWLRYTLFYVLYPMGVTGEVLAILES--FRNAYGTTSFIDLPNSLNIQMRYDFILVLVLVSYFPIFPQLFGHMIVQRKKILGKSHE 681
            YL IYN+ +T GW  +    + A +  K +    Y  IEKPLK  QT A+LEILH A G V S V +T+ QV SR+FL+W + +   ++ SE   + +F+IAW+I EIIRY +Y   L+N +PY + W RYTLF VLYPMGV+GE+L I  +  F    G  S I LPN  N    Y   L+L+++SY PIFPQL+ HMI QR+KIL  + E
Sbjct:   42 YLVIYNVVMTAGWLVIAVGLVRA-YLAKGSYHSLYYSIEKPLKFFQTGALLEILHCAIGIVPSSVVLTSFQVMSRVFLIWAVTHSVKEVQSED-SVLLFVIAWTITEIIRYSFYTFSLLNHLPYLIKWARYTLFIVLYPMGVSGELLTIYAALPFVRQAGLYS-ISLPNKYNFSFDYYAFLILIMISYIPIFPQLYFHMIHQRRKILSHTEE 250          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. UniProt/SwissProt
Match: sp|O17040|HACD_CAEEL (Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase hpo-8 OS=Caenorhabditis elegans OX=6239 GN=hpo-8 PE=3 SV=2)

HSP 1 Score: 160.614 bits (405), Expect = 1.338e-47
Identity = 87/216 (40.28%), Postives = 135/216 (62.50%), Query Frame = 1
Query:   43 VPKYLFIYNLTLTCGWAYVLYKEIYALWSTKFNLVETYSIIEKPLKLVQTAAVLEILHSAFGFVKSRVDITTIQVSSRLFLVWGICNIFPKIISETYGIPMFIIAWSIAEIIRYGYYATHLINC-VPYPLVWLRYTLFYVLYPMGVTGEVLAILESFRNAYGTTSF-IDLPNSLNIQMRYDFILVLVLVSYFPIFPQLFGHMIVQRKKILGKSHES 684
            V  YL  YN+    GW+ +L K +  L +      + Y  +E  LK+ QTAA+LE++H+  G V+S V  T +QV+SR+ LVW I ++       + G+P+ ++AWS+ E+IRY +YA  ++   +PY L++LRYTLFYVLYPMGV+GE+L +  S           +++PN LN+ + + ++L++  +SY P FPQL+ +MI QRKKILG   + 
Sbjct:    3 VQTYLVAYNVLQILGWSAILVKTVLGL-ANGLTWPQLYESVEFELKIFQTAAILEVIHAIVGLVRSPVGTTAMQVTSRVVLVWPILHLC-STARFSIGVPLLLVAWSVTEVIRYSFYALSVLKQPIPYFLLYLRYTLFYVLYPMGVSGELLTLFASLNEVDEKKILTLEMPNRLNMGISFWWVLIIAALSYIPGFPQLYFYMIGQRKKILGGGSKK 216          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. TrEMBL
Match: A0A2B4RGH7 (Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase OS=Stylophora pistillata OX=50429 GN=Ptplb PE=3 SV=1)

HSP 1 Score: 183.341 bits (464), Expect = 9.768e-54
Identity = 97/208 (46.63%), Postives = 134/208 (64.42%), Query Frame = 1
Query:   52 YLFIYNLTLTCGWAYVLYKEIYALWSTKFNLVETYSIIEKPLKLVQTAAVLEILHSAFGFVKSRVDITTIQVSSRLFLVWGICNIFPKIISETYGIPMFIIAWSIAEIIRYGYYATHLINCVPYPLVWLRYTLFYVLYPMGVTGEVLAILES--FRNAYGTTSFIDLPNSLNIQMRYDFILVLVLVSYFPIFPQLFGHMIVQRKKILG 669
            YL +YN+ LT GW  +L   +  L   K N +  Y+ +E PLK+ Q+AA+LE+LH A G V S V IT  QV+SRLFL W + +  P++  +  G+  FI AWSI E+IRY +YA  L++ +PY L W RYT FY LYP+GVTGE++ I  S  + +  G  S + +PN LN    +   L++V+ SY PIFPQL+ HMI QRKK++G
Sbjct:    8 YLVLYNVVLTLGWGVILVLSVKHLTEKKTN-IGLYNSVETPLKIFQSAAILEVLHCAVGLVPSSVVITAFQVASRLFLTWAVAHSVPQV-HDNAGVAGFIFAWSITEVIRYSFYAFSLLDKLPYILQWCRYTFFYFLYPIGVTGELVTIYSSLGYVSKSGLYS-VSMPNRLNFSFDFHLFLMVVMFSYIPIFPQLYFHMIRQRKKVIG 212          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. TrEMBL
Match: A0A226E3T9 (Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase OS=Folsomia candida OX=158441 GN=Fcan01_13434 PE=3 SV=1)

HSP 1 Score: 177.563 bits (449), Expect = 7.081e-52
Identity = 97/209 (46.41%), Postives = 135/209 (64.59%), Query Frame = 1
Query:   52 YLFIYNLTLTCGWAYVLYKEIYALWSTKFNLVETYSIIEKPLKLVQTAAVLEILHSAFGFVKSRVDITTIQVSSRLFLVWGICNIFPKIISETYGIPMFIIAWSIAEIIRYGYYATHLINCVPYPLVWLRYTLFYVLYPMGVTGEVLAILESFRNAYGTTSFI-DLPNSLNIQMRYDFILVLVLVSYFPIFPQLFGHMIVQRKKILGKS 675
            YL  YNL LT GW YVLY      +  + +  + +  +E PLK+ QTAA++E++H+A G VKS V +T  QV SR+FL+W +  + P   + + G+P+ +IAW I EIIRYGYY  +LI  +   LVW RYTLF  LYP+G+TGE++ I  S         +   +PN+LN+   Y + L+LV++SY PIFPQL+ HM  QRKKILGK+
Sbjct:    6 YLIFYNLALTLGWGYVLYLA----FEKRNDHTKMWKHVEIPLKIFQTAALMEVVHAAVGIVKSNVFLTFFQVMSRVFLLWCVLEVSPPA-TTSIGVPICMIAWDITEIIRYGYYFLNLIG-LSQLLVWFRYTLFIFLYPIGITGELICIYYSLDFVKQKKMWTYSMPNALNVTFDYQYALILVMLSYIPIFPQLYFHMFAQRKKILGKN 208          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. TrEMBL
Match: I3NGS7 (Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase OS=Ictidomys tridecemlineatus OX=43179 GN=HACD2 PE=3 SV=1)

HSP 1 Score: 178.333 bits (451), Expect = 1.101e-51
Identity = 101/212 (47.64%), Postives = 133/212 (62.74%), Query Frame = 1
Query:   52 YLFIYNLTLTCGWAYVLYKEIYALWSTKFNLVETYSIIEKPLKLVQTAAVLEILHSAFGFVKSRVDITTIQVSSRLFLVWGICNIFPKIISETYGIPMFIIAWSIAEIIRYGYYATHLINCVPYPLVWLRYTLFYVLYPMGVTGEVLAILES--FRNAYGTTSFIDLPNSLNIQMRYDFILVLVLVSYFPIFPQLFGHMIVQRKKILGKSHE 681
            YL IYN+ +T GW  +    + A +  K +    Y  IEKPLK  QT A+LEILH A G V S V +T+ QV SR+FL+W + +   ++ SE   + +F+IAW+I EIIRY +Y   L+N +PY + W RYTLF VLYPMGV+GE+L I  +  F    G  S I LPN  N    Y   L+LV++SY PIFPQL+ HMI QR+KIL  + E
Sbjct:   41 YLVIYNVVMTAGWLVIAVGLVRA-YLAKGSYHSLYYSIEKPLKFFQTGALLEILHCAIGIVPSSVVLTSFQVMSRVFLIWAVTHSVKEVQSED-SVLLFVIAWTITEIIRYSFYTFSLLNHLPYLIKWARYTLFIVLYPMGVSGELLTIYAALPFVRQAGLYS-ISLPNKYNFSFDYHAFLILVMISYIPIFPQLYFHMIHQRRKILSHTEE 249          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. TrEMBL
Match: A0A2K6BBG8 (Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase OS=Macaca nemestrina OX=9545 GN=HACD2 PE=3 SV=1)

HSP 1 Score: 177.948 bits (450), Expect = 1.753e-51
Identity = 100/212 (47.17%), Postives = 133/212 (62.74%), Query Frame = 1
Query:   52 YLFIYNLTLTCGWAYVLYKEIYALWSTKFNLVETYSIIEKPLKLVQTAAVLEILHSAFGFVKSRVDITTIQVSSRLFLVWGICNIFPKIISETYGIPMFIIAWSIAEIIRYGYYATHLINCVPYPLVWLRYTLFYVLYPMGVTGEVLAILES--FRNAYGTTSFIDLPNSLNIQMRYDFILVLVLVSYFPIFPQLFGHMIVQRKKILGKSHE 681
            YL IYN+ +T GW  +    + A +  K +    Y  IEKPLK  QT A+LEILH A G V S V +T+ QV SR+FL+W + +   ++ SE   + +F+IAW+I EIIRY +Y   L+N +PY + W RYTLF VLYPMGV+GE+L I  +  F    G  S I LPN  N    Y   L+L+++SY PIFPQL+ HMI QR+KIL  + E
Sbjct:   41 YLVIYNVVMTAGWLVIAVGLVRA-YLAKGSYHSLYYSIEKPLKFFQTGALLEILHCAIGIVPSSVVLTSFQVMSRVFLIWAVTHSVKEVQSED-SVLLFVIAWTITEIIRYSFYTFSLLNHLPYLIKWARYTLFIVLYPMGVSGELLTIYAALPFVRQAGLYS-ISLPNKYNFSFDYHAFLILIMISYIPIFPQLYFHMIHQRRKILSHTEE 249          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. TrEMBL
Match: A0A2K6LMD8 (Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase OS=Rhinopithecus bieti OX=61621 GN=HACD2 PE=3 SV=1)

HSP 1 Score: 177.948 bits (450), Expect = 1.753e-51
Identity = 100/212 (47.17%), Postives = 133/212 (62.74%), Query Frame = 1
Query:   52 YLFIYNLTLTCGWAYVLYKEIYALWSTKFNLVETYSIIEKPLKLVQTAAVLEILHSAFGFVKSRVDITTIQVSSRLFLVWGICNIFPKIISETYGIPMFIIAWSIAEIIRYGYYATHLINCVPYPLVWLRYTLFYVLYPMGVTGEVLAILES--FRNAYGTTSFIDLPNSLNIQMRYDFILVLVLVSYFPIFPQLFGHMIVQRKKILGKSHE 681
            YL IYN+ +T GW  +    + A +  K +    Y  IEKPLK  QT A+LEILH A G V S V +T+ QV SR+FL+W + +   ++ SE   + +F+IAW+I EIIRY +Y   L+N +PY + W RYTLF VLYPMGV+GE+L I  +  F    G  S I LPN  N    Y   L+L+++SY PIFPQL+ HMI QR+KIL  + E
Sbjct:   41 YLVIYNVVMTAGWLVIAVGLVRA-YLAKGSYHSLYYSIEKPLKFFQTGALLEILHCAIGIVPSSVVLTSFQVMSRVFLIWAVTHSVKEVQSED-SVLLFVIAWTITEIIRYSFYTFSLLNHLPYLIKWARYTLFIVLYPMGVSGELLTIYAALPFVRQAGLYS-ISLPNKYNFSFDYHAFLILIMISYIPIFPQLYFHMIHQRRKILSHTEE 249          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Cavefish
Match: hacd2 (3-hydroxyacyl-CoA dehydratase 2 [Source:NCBI gene;Acc:103030449])

HSP 1 Score: 172.94 bits (437), Expect = 4.407e-53
Identity = 97/216 (44.91%), Postives = 130/216 (60.19%), Query Frame = 1
Query:   37 TFVPKYLFIYNLTLTCGWAYVLYKEIYALWSTKFNLVETYSIIEKPLKLVQTAAVLEILHSAFGFVKSRVDITTIQVSSRLFLVWGICNIFPKIISETYGIPMFIIAWSIAEIIRYGYYATHLINCVPYPLVWLRYTLFYVLYPMGVTGEVLAILESFRNAYGTTSF-IDLPNSLNIQMRYDFILVLVLVSYFPIFPQLFGHMIVQRKKILGKSHE 681
            T    YL IYN+ +T GW  +    + A + T+ +    Y  IEKPLK  QT A+LEILH A G V S V +T  QV SR+FL W + +   ++ SE   + +F++AW+I EIIRY +Y   L+N +PY + W RYT F VLYPMGVTGE+L I  +      T  + + LPN  N    Y   L+L +VSY P+FPQL+ HM+ QRKK+LG   E
Sbjct:   26 TLATAYLVIYNVVMTAGWLVIAVGLVRA-YLTRGSYHGLYYSIEKPLKFFQTGALLEILHCAVGIVPSSVVLTGFQVLSRVFLTWAVTHSVREVQSED-SVLLFVVAWTITEIIRYSFYTFSLLNHLPYLIKWARYTFFIVLYPMGVTGELLTIYAALPYVQKTGLYSVTLPNKYNFSFDYYTFLILTMVSYIPLFPQLYFHMLRQRKKVLGHMEE 239          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Cavefish
Match: hacd1 (3-hydroxyacyl-CoA dehydratase 1 [Source:NCBI gene;Acc:103025300])

HSP 1 Score: 143.28 bits (360), Expect = 1.245e-41
Identity = 74/206 (35.92%), Postives = 127/206 (61.65%), Query Frame = 1
Query:   52 YLFIYNLTLTCGWAYVLYKEIYALWSTKFNLVETYSIIEKPLKLVQTAAVLEILHSAFGFVKSRVDITTIQVSSRLFLVWGICNIFPKIISETYGIPMFIIAWSIAEIIRYGYYATHLINCVPYPLVWLRYTLFYVLYPMGVTGEVLAILESFRNAYGTTSF-IDLPNSLNIQMRYDFILVLVLVSYFPIFPQLFGHMIVQRKKIL 666
            +L +YN+ +T GW  VL   +   +  K      Y  I + LK  QT A+LE+ H A G V++ V +T +QV SR+F+VW I +   ++ ++   + +F++ W++ EI RY +Y  +L+N +PY + W RY +F V+YP+GV GE++ I  +      +  + + LPN+ N+   Y + L++V++SY P+FPQL+ HM+ QR+++L
Sbjct:   30 WLTVYNIAMTAGWL-VLAVAMIRFYLQKGTHRGLYRSIARTLKFFQTFALLEVGHCAIGIVRTSVIVTGVQVCSRIFMVWFIASSIRQVQNQE-SVILFLVVWTVTEITRYSFYTFNLLNHLPYFIKWARYNMFIVMYPLGVIGELMTIYAALPYVRRSGMYSLRLPNTYNVSFDYYYFLIIVMLSYIPLFPQLYFHMLRQRRRVL 233          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Cavefish
Match: hacd1 (3-hydroxyacyl-CoA dehydratase 1 [Source:NCBI gene;Acc:103025300])

HSP 1 Score: 120.168 bits (300), Expect = 1.414e-32
Identity = 65/189 (34.39%), Postives = 112/189 (59.26%), Query Frame = 1
Query:   52 YLFIYNLTLTCGWAYVLYKEIYALWSTKFNLVETYSIIEKPLKLVQTAAVLEILHSAFGFVKSRVDITTIQVSSRLFLVWGICNIFPKIISETYGIPMFIIAWSIAEIIRYGYYATHLINCVPYPLVWLRYTLFYVLYPMGVTGEVLAILESFRNAYGTTSF-IDLPNSLNIQMRYDFILVLVLVSYFP 615
            +L +YN+ +T GW  VL   +   +  K      Y  I + LK  QT A+LE+ H A G V++ V +T +QV SR+F+VW I +   ++ ++   + +F++ W++ EI RY +Y  +L+N +PY + W RY +F V+YP+GV GE++ I  +      +  + + LPN+ N+   Y + L++V++SY P
Sbjct:   30 WLTVYNIAMTAGWL-VLAVAMIRFYLQKGTHRGLYRSIARTLKFFQTFALLEVGHCAIGIVRTSVIVTGVQVCSRIFMVWFIASSIRQVQNQE-SVILFLVVWTVTEITRYSFYTFNLLNHLPYFIKWARYNMFIVMYPLGVIGELMTIYAALPYVRRSGMYSLRLPNTYNVSFDYYYFLIIVMLSYIP 216          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Cavefish
Match: hacd3 (3-hydroxyacyl-CoA dehydratase 3 [Source:NCBI gene;Acc:103030450])

HSP 1 Score: 70.8626 bits (172), Expect = 8.708e-14
Identity = 60/198 (30.30%), Postives = 96/198 (48.48%), Query Frame = 1
Query:   52 YLFIYNLTLTCGWAYVLYK---EIYALWSTKFNLVETYSIIEKPLKLVQTAAVLEILHSAFGFVKSRVDITTIQVSSR---LFLVWGICNIFPKIISETYGIPMFIIA---WSIAEIIRYGYYATHLINCVPYPLVWLRYTLFYVLYPMGVTGEVLAILESFRNAYGTTSF--IDLPNSLNIQMRYDFILVLVLVSYF 612
            YLF+YNL    G++++       ++ L    F   +T+  I   +   Q  A++E+++ A G VKS V    IQV  R   LF+++G        + E    P+       WS  EI RY +Y    I+     L WLRYT++  LYP+GV  E +++++S    +  T F  I LP +L   + + +IL   L+  F
Sbjct:  146 YLFMYNLVQFLGFSWIFVNMTVRLFILGQDSF--YDTFHTIADVMYFCQMLAIIEVINPALGLVKSGVIPAFIQVMGRNVILFVIFGS-------LEEMQNKPVVFFVFYLWSAIEIFRYPFYMLACIDTEWKMLTWLRYTIWMPLYPLGVLAEAVSVIQSI-PIFDETKFLSIPLPAALGSSISFSYILRFYLLIMF 333          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Cavefish
Match: si:ch73-41h24.1 (3-hydroxyacyl-CoA dehydratase 4 [Source:HGNC Symbol;Acc:HGNC:20920])

HSP 1 Score: 50.0618 bits (118), Expect = 2.159e-7
Identity = 44/148 (29.73%), Postives = 74/148 (50.00%), Query Frame = 1
Query:   49 KYLFIYNLTLTCGWAYVLYKEIYALWSTKF------NLVETYSIIEKPLKLVQTAAVLEILHSAFGFVKSRVDITTIQVSSRLFLVWGICNIFPKIISETYGIPMFIIAWSIAEIIRYGYYATHLINCVPYPLVWLRYTLF---YVLY 465
             YLF YNL   CG  +      +A  S +F       L  T+  +   +   Q  ++LE+ H A G  +SR+    +QV  R FL++ I +   +  S+T    +F + W++ ++IRY Y    LI+   + ++W+R+T F   Y+LY
Sbjct:    6 AYLFSYNLLQFCGHTWT-----FANMSARFLSFGGDALAGTFYFVGVMMCGCQLLSILELFHIADGLEESRLLPRFVQVMQRNFLLFLIISQ-EEFQSQTVVCVLFYL-WNMLDLIRYPYKLLRLISTPTFNMLWVRHTFFIPVYILY 146          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Sea Lamprey
Match: hacd1 (3-hydroxyacyl-CoA dehydratase 1 [Source:ZFIN;Acc:ZDB-GENE-170413-2])

HSP 1 Score: 167.933 bits (424), Expect = 1.209e-51
Identity = 92/219 (42.01%), Postives = 136/219 (62.10%), Query Frame = 1
Query:   52 YLFIYNLTLTCGWAYVLYKEIYALWSTKFNLVET-----YSIIEKPLKLVQTAAVLEILHSAFGFVKSRVDITTIQVSSRLFLVWGICNIFPKIISETYGIPMFIIAWSIAEIIRYGYYATHLINCVPYPLVWLRYTLFYVLYPMGVTGEVLAILESFRNAYGTTSFI-DLPNSLNIQMRYDFILVLVLVSYFPIFPQLFGHMIVQRKKILG--KSHES 684
            +L +YN  +T GW       + A+   ++ L +      Y  IEK LK+ QT A+LE++H A G V S   +T  QVSSR+FLVW + +    + +E Y + +++ AW++ EI+RY +Y   L+  +P  + W RYTLF VLYP+GVTGE+L I  +  + Y +  F   LPN+LNI   Y + L++V++SY PIFPQL+ HM+ QRKK+LG  K+ ES
Sbjct:   44 WLILYNTVMTAGWL------VLAVSMARYGLAKGSNRGLYRSIEKTLKIFQTGALLEVVHCATGIVPSSAVLTAFQVSSRVFLVWAVTDSVKPVQNE-YSVLIYLSAWTLTEIVRYSFYTFSLLKYLPRAIKWARYTLFIVLYPLGVTGELLTIYHALPHVYRSKLFAYPLPNALNISFDYYYFLIIVMISYVPIFPQLYFHMMSQRKKVLGEPKAKES 255          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Sea Lamprey
Match: si:ch73-41h24.1 (3-hydroxyacyl-CoA dehydratase 4 [Source:HGNC Symbol;Acc:HGNC:20920])

HSP 1 Score: 60.077 bits (144), Expect = 3.300e-11
Identity = 52/205 (25.37%), Postives = 103/205 (50.24%), Query Frame = 1
Query:   52 YLFIYNLTLTCGWAYVLYK-EIYALWSTKFNLVETYSIIEKPLKLVQTAAVLEILHSAFGFVKSRVDITTIQVSSRLFLVWGICNIFPKIISETYGIPMFIIAWSIAEIIRYGYYATHLINCVPYPLVWLRYTLFYVLYPMGVTGEVLAILESFRN-AYGTTSFIDLPNSLNIQMRYDFILVLVLVSYFPIFPQLFGHMIVQRKK 660
            YLFIY+L    G ++V     +  L   + ++++T+  I + +   Q  ++LE+++S  G  KS +  T +QV SR  L++ +     ++ +      +F + WS  EI RY YY    ++     L WLRY+ +  L P+ +  EV+ +L+S  +  +    F++    LNI   + ++L   L+   P+   +  H + ++++
Sbjct:   17 YLFIYSLMQFLGHSWVFVNMTVRMLHFGEDSMIDTFYAIGEVMSYCQALSLLEVINSLLGLSKSALIPTILQVLSRNLLLFVVIWNQEELQNTVVVFAVFYL-WSSIEIFRYPYYMLASLSMEWELLTWLRYSFWLPLCPLVLFAEVICVLQSLEHFEHSGEVFLNFQEPLNISALFPYVLYTYLLLILPLRFIVNSHYLYKQRQ 220          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Yeast
Match: PHS1 (Essential 3-hydroxyacyl-CoA dehydratase of the ER membrane; involved in elongation of very long-chain fatty acids; evolutionarily conserved, similar to mammalian PTPLA and PTPLB; involved in sphingolipid biosynthesis and protein trafficking [Source:SGD;Acc:S000003633])

HSP 1 Score: 112.849 bits (281), Expect = 4.757e-31
Identity = 84/227 (37.00%), Postives = 120/227 (52.86%), Query Frame = 1
Query:   34 MTFVPKYLFIYNLTLTCGWAYVLYKEIYALWSTKFNLVETYSIIEKPLKLVQTAAVLEILHSAFGFVKSRVDITTIQVSSRLFLVWGICNIFPKIISETYGIP-----MFIIAWSIAEIIRYGYYATHLI--NCVPYPLVWLRYTLFYVLYPMGVTGEVLAILESFRNAYGTTSFIDLPNSLNIQMRYDFILVLVLVSYFPIFPQLFGHMIVQRKKILGKSHES*FG 693
            ++F+P    +YNL    GW+Y+LY  I +L+  K      +   +    LVQ  A++EI++S  G V+S +  T  QVSSRL +V GI  + P     T G+        ++AWSI EI+RY YY   L+  N  P  L+ LRY LF++LYP GV  E+  I  +   A    S +           Y  IL+  +++Y P FP LF HM+ QRKK++ KS  S FG
Sbjct:    9 LSFLP----LYNLLSAVGWSYLLYLVI-SLY-PKVGQPAFFYQTKNVATLVQCGAIIEIINSFLGVVRSPLLTTVAQVSSRLLVVLGIFQLLP----NTSGVQSVVYISLLLAWSITEIVRYLYYFFMLVFKNGAPKILILLRYNLFWILYPTGVASELRIIYCALNAAESQYSLL-----------YKRILIAAMLAYIPGFPMLFLHMVAQRKKVM-KSLRSSFG 213          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Nematostella
Match: EDO30588 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T0D0])

HSP 1 Score: 166.007 bits (419), Expect = 3.828e-51
Identity = 95/210 (45.24%), Postives = 129/210 (61.43%), Query Frame = 1
Query:   52 YLFIYNLTLTCGWAYVLYKEIYALWSTKFNLVETYSIIEKPLKLVQTAAVLEILHSAFGFVKSRVDITTIQVSSRLFLVWGICNIFPKIISETYGIPMFIIAWSIAEIIRYGYYATHLINCVPYPLVWLRYTLFYVLYPMGVTGEVLAILES--FRNAYGTTSFIDLPNSLNIQMRYDFILVLVLVSYFPIFPQLFGHMIVQRKKILGKS 675
            YL +YN  L  GW+ VL       W      V  +S I  PL + QTAA++E+ H A GFV+S V +T  QV+SRLFLVW I    P++  ++ G+   + AWS+ E+IRY +Y   L++ +PY L W RYT F+ LYP+GVTGE++AI  S  F    G  S + LPN LN+   Y F L+ V++SY PIFPQL+ HMI QR+K+L   
Sbjct:    3 YLVLYNAVLCLGWSIVLVLGSLH-WLRHGTHVGLFSAISIPLYIFQTAAIMEVFHCAVGFVRSSVFLTGFQVASRLFLVWAILYSVPEV-QDSIGVAAAVAAWSVTEVIRYLFYVCSLVSVLPYALQWCRYTFFFFLYPIGVTGELVAIYASLPFVQKSGIYS-VALPNPLNVGFSYYFFLIAVMLSYIPIFPQLYFHMIGQRRKVLSSE 209          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Nematostella
Match: EDO32410 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SV55])

HSP 1 Score: 67.781 bits (164), Expect = 3.130e-13
Identity = 58/186 (31.18%), Postives = 89/186 (47.85%), Query Frame = 1
Query:   52 YLFIYNLTLTCGWAYVLYKEIYA-LWSTKFNLVETYSIIEKPLKLVQTAAVLEILHSAFGFVKSRVDITTIQVSSRLFLVWGICNIFPKIISETYGIPMFIIAWSIAEIIRYGYYATHLINCVPYPLVWLRYTLFYVLYPMGVTGEVLAILESFRNAYGTTSF-IDLPNSLNIQMRYDFILVLVLV 603
            YL  YN      + Y++ K I   +   K +L   Y  +   +   Q AA LE+L+ A G VK+ V     QV  R  +++ +    P + ++     +F   WS+ EIIRY +Y   +I     PL+WLRYT +  LYP+G+  EV+ I ++      T  F I LPN+ N    +   L   L+
Sbjct:  165 YLVTYNGIQFILFLYIVAKIISRFIMEGKDSLAGNYDAVSDIIASCQLAAFLEVLNPAIGIVKTGVFAPFAQVFGRNLVLFMVVVPHPTLHADPVVSALFF-TWSVIEIIRYPFYIVQIIGIPFEPLIWLRYTAWIPLYPVGMITEVILIWKALPLLDQTQRFSIILPNAFNFSFSFAMFLRFYLI 349          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Medaka
Match: hacd2 (3-hydroxyacyl-CoA dehydratase 2 [Source:NCBI gene;Acc:101174470])

HSP 1 Score: 169.088 bits (427), Expect = 1.406e-51
Identity = 91/211 (43.13%), Postives = 130/211 (61.61%), Query Frame = 1
Query:   52 YLFIYNLTLTCGWAYVLYKEIYALWSTKFNLVETYSIIEKPLKLVQTAAVLEILHSAFGFVKSRVDITTIQVSSRLFLVWGICNIFPKIISETYGIPMFIIAWSIAEIIRYGYYATHLINCVPYPLVWLRYTLFYVLYPMGVTGEVLAILESFRNAYGTTSF-IDLPNSLNIQMRYDFILVLVLVSYFPIFPQLFGHMIVQRKKILGKSHE 681
            YL IYN+ +T GW  +    + A +  + +    Y  IEKPLK  QT A+LEILH A G V S V +T  QV SR+FL W + +   ++ SE   + +F+ AW++ EIIRY +Y   L+N +PY + W RYT F +LYPMGVTGE+L I  +      T  + + LPN  N    Y   L+L+++SY P+FPQL+ HM+ QRKK+LG++ +
Sbjct:   31 YLVIYNVVMTAGWLVIAVGLVRA-YVARGSYHGLYYSIEKPLKFFQTGALLEILHCAVGIVPSSVVLTGFQVLSRVFLTWAVTHSVREVQSED-SVLLFVTAWTVTEIIRYSFYTFSLLNHLPYLIKWARYTFFILLYPMGVTGELLTIYAALPYVQKTGLYSVTLPNKYNFSFDYYTFLILIMISYIPLFPQLYFHMLRQRKKVLGRTED 239          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Medaka
Match: hacd2 (3-hydroxyacyl-CoA dehydratase 2 [Source:NCBI gene;Acc:101174470])

HSP 1 Score: 144.05 bits (362), Expect = 3.806e-42
Identity = 81/211 (38.39%), Postives = 120/211 (56.87%), Query Frame = 1
Query:   52 YLFIYNLTLTCGWAYVLYKEIYALWSTKFNLVETYSIIEKPLKLVQTAAVLEILHSAFGFVKSRVDITTIQVSSRLFLVWGICNIFPKIISETYGIPMFIIAWSIAEIIRYGYYATHLINCVPYPLVWLRYTLFYVLYPMGVTGEVLAILESFRNAYGTTSF-IDLPNSLNIQMRYDFILVLVLVSYFPIFPQLFGHMIVQRKKILGKSHE 681
            YL IYN+ +T GW  +    + A +  + +    Y  IEKPLK  QT A+LE+L                   SR+FL W + +   ++ SE   + +F+ AW++ EIIRY +Y   L+N +PY + W RYT F +LYPMGVTGE+L I  +      T  + + LPN  N    Y   L+L+++SY P+FPQL+ HM+ QRKK+LG++ +
Sbjct:   31 YLVIYNVVMTAGWLVIAVGLVRA-YVARGSYHGLYYSIEKPLKFFQTGALLEVL-------------------SRVFLTWAVTHSVREVQSED-SVLLFVTAWTVTEIIRYSFYTFSLLNHLPYLIKWARYTFFILLYPMGVTGELLTIYAALPYVQKTGLYSVTLPNKYNFSFDYYTFLILIMISYIPLFPQLYFHMLRQRKKVLGRTED 220          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Medaka
Match: hacd1 (3-hydroxyacyl-CoA dehydratase 1 [Source:NCBI gene;Acc:101162008])

HSP 1 Score: 124.79 bits (312), Expect = 2.601e-34
Identity = 78/228 (34.21%), Postives = 123/228 (53.95%), Query Frame = 1
Query:   31 KMTFVPKYLFIYNLTLTCGWAYVLYKEIYALWSTKFNLVETYSIIEKPLKLVQTAAVLEILHSA---FGFVKSRVDITTIQVSSRLFLVWGICNIFPKIISETYGIPMFIIAWSIAEIIRYGYYATHLINCVPYPLVWLRYTLFYVLYPMGVTGEVLAILES--FRNAYGTTSFIDLPNSLNIQMRYDFILVLVLVSYFP-----------IFPQLFGHMIVQRKKIL 666
            K      +L  YN+ +T GW  VL   +   +  K      Y  I + LK  QT A+L   +      G V++ V +T +QV SR+F+VW + +   +I +E   + +F++ W++ EI RY YY   L+N +PY + W RY  F VLYP+GV GE+L+I  +  F    G  S + LPN  N+   Y + L+++ V++FP           +FPQL+ HM+ QR+++L
Sbjct:   22 KSALTTAWLTFYNIAMTAGWL-VLAMAMLRFYIKKGTHKGLYRSIARTLKFFQTFALLSPAYRVICLLGIVRTSVIVTGVQVCSRIFMVWLVASSIRQIQNEE-SVILFLVVWTVTEITRYSYYTFKLLNHLPYFVKWARYNFFIVLYPLGVIGELLSIYAALPFVRRSGMYS-MRLPNKYNVSFDYYYCLIIINVTFFPLNFSWIFVLLAVFPQLYFHMLRQRRRVL 246          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Medaka
Match: hacd1 (3-hydroxyacyl-CoA dehydratase 1 [Source:NCBI gene;Acc:101162008])

HSP 1 Score: 122.479 bits (306), Expect = 4.266e-33
Identity = 72/197 (36.55%), Postives = 111/197 (56.35%), Query Frame = 1
Query:   31 KMTFVPKYLFIYNLTLTCGWAYVLYKEIYALWSTKFNLVETYSIIEKPLKLVQTAAVLEILHSAFGFVKSRVDITTIQVSSRLFLVWGICNIFPKIISETYGIPMFIIAWSIAEIIRYGYYATHLINCVPYPLVWLRYTLFYVLYPMGVTGEVLAILES--FRNAYGTTSFIDLPNSLNIQMRYDFILVLVLVSYFP 615
            K      +L  YN+ +T GW  VL   +   +  K      Y  I + LK  QT A++E+ H A G V++ V +T +QV SR+F+VW + +   +I +E   + +F++ W++ EI RY YY   L+N +PY + W RY  F VLYP+GV GE+L+I  +  F    G  S + LPN  N+   Y + L++V++SY P
Sbjct:   22 KSALTTAWLTFYNIAMTAGW-LVLAMAMLRFYIKKGTHKGLYRSIARTLKFFQTFALVEVGHCAIGIVRTSVIVTGVQVCSRIFMVWLVASSIRQIQNEE-SVILFLVVWTVTEITRYSYYTFKLLNHLPYFVKWARYNFFIVLYPLGVIGELLSIYAALPFVRRSGMYS-MRLPNKYNVSFDYYYCLIIVMLSYIP 215          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Medaka
Match: hacd3 (3-hydroxyacyl-CoA dehydratase 3 [Source:NCBI gene;Acc:101163569])

HSP 1 Score: 74.3294 bits (181), Expect = 4.855e-15
Identity = 58/187 (31.02%), Postives = 94/187 (50.27%), Query Frame = 1
Query:   52 YLFIYNLTLTCGWAYVLYKEIYALW-STKFNLVETYSIIEKPLKLVQTAAVLEILHSAFGFVKSRVDITTIQVSSR---LFLVWGICNIFPKIISETYGIPMFIIA---WSIAEIIRYGYYATHLINCVPYPLVWLRYTLFYVLYPMGVTGEVLAILESFRNAYGTTSF-IDLPNSLNIQMRYDFIL 588
            +LF YNL    G++++       L+   K +L +T+  I   +   QT A +E+L++AFG V++ V  T IQV  R   LF+++G        + E +  P+       WS  EI RY +Y     N     L WLRYT++  LYP+GV  E +A+L++         F I LP ++   + + ++L
Sbjct:  156 FLFAYNLVQFLGFSWIFVNMTVRLFIFGKDSLYDTFHTISDVMFFCQTLAAVEVLNAAFGVVRTGVVPTFIQVIGRNFILFIIFGS-------LDEMHNRPVVFFVFYLWSAIEIFRYPFYMLGCFNTEWKTLTWLRYTVWIPLYPLGVLAEAVAVLQAIPIFDKNKLFSIPLPKAIGGSLSFSYVL 335          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Planmine SMEST
Match: SMESG000023255.1 (SMESG000023255.1)

HSP 1 Score: 438.728 bits (1127), Expect = 1.993e-158
Identity = 216/217 (99.54%), Postives = 216/217 (99.54%), Query Frame = 1
Query:   34 MTFVPKYLFIYNLTLTCGWAYVLYKEIYALWSTKFNLVETYSIIEKPLKLVQTAAVLEILHSAFGFVKSRVDITTIQVSSRLFLVWGICNIFPKIISETYGIPMFIIAWSIAEIIRYGYYATHLINCVPYPLVWLRYTLFYVLYPMGVTGEVLAILESFRNAYGTTSFIDLPNSLNIQMRYDFILVLVLVSYFPIFPQLFGHMIVQRKKILGKSHES 684
            MTFVPKYLFIYNLTLTCGWAYVLYKEIYALWSTKFNLVETYSIIEKPLKLVQTAAVLEILHSAFGFVKSRVDITTIQVSSRLFLVWGICNIFPKIISETYGIPMFIIAWSIAEIIRYGYYA HLINCVPYPLVWLRYTLFYVLYPMGVTGEVLAILESFRNAYGTTSFIDLPNSLNIQMRYDFILVLVLVSYFPIFPQLFGHMIVQRKKILGKSHES
Sbjct:    1 MTFVPKYLFIYNLTLTCGWAYVLYKEIYALWSTKFNLVETYSIIEKPLKLVQTAAVLEILHSAFGFVKSRVDITTIQVSSRLFLVWGICNIFPKIISETYGIPMFIIAWSIAEIIRYGYYANHLINCVPYPLVWLRYTLFYVLYPMGVTGEVLAILESFRNAYGTTSFIDLPNSLNIQMRYDFILVLVLVSYFPIFPQLFGHMIVQRKKILGKSHES 217          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Planmine SMEST
Match: SMESG000034959.1 (SMESG000034959.1)

HSP 1 Score: 70.8626 bits (172), Expect = 6.884e-14
Identity = 64/178 (35.96%), Postives = 93/178 (52.25%), Query Frame = 1
Query:  154 YSIIEKPLKLVQTAAVLEILHSAFGFVKSRVDITTIQVSSRLFLVWGICNIFPKIISETYGIPMFIIA-WSIAEIIRYGYYATHLINCVPYPLVWLRYTLFYVLYPMGVTGEVLAILESFRNAYGTTSF-IDLPNSLNIQMRYDFILVLVLVSYFPI----FPQLFGHMIVQRKKILG 669
            Y  I   L  VQ  +VLEILH+  G+VKS   +  +QV  R  +++  C + P    +T     ++ A WS  EI+RY YY   L+      L WLRY+++  LYP+G   E   IL++      +  F I LPN+ NIQ  +DF++ L+L  Y P+    F  L   M  QRK+ +G
Sbjct:  193 YPYIRDQLITVQLVSVLEILHAYMGWVKSSPAMVFMQVFGRNLVLF--CIVVPHSNLQTDPEIFWLAATWSCVEIVRYPYYLLILLKENIAFLTWLRYSIWVPLYPIGFMTEGKLILKAMPLLQESKQFSIFLPNAFNIQ--FDFVIFLLL--YIPLATIGFYYLMMRMYGQRKQKIG 364          
The following BLAST results are available for this feature:
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HACD24.363e-5447.173-hydroxyacyl-CoA dehydratase 2 [Source:HGNC Symbo... [more]
HACD18.783e-4239.323-hydroxyacyl-CoA dehydratase 1 [Source:HGNC Symbo... [more]
HACD25.666e-2147.473-hydroxyacyl-CoA dehydratase 2 [Source:HGNC Symbo... [more]
HACD15.210e-1936.643-hydroxyacyl-CoA dehydratase 1 [Source:HGNC Symbo... [more]
HACD34.846e-1628.503-hydroxyacyl-CoA dehydratase 3 [Source:HGNC Symbo... [more]
back to top
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
hpo-81.052e-4840.28Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase... [more]
hpo-81.052e-4840.28Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase... [more]
R10E4.91.209e-727.75Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase... [more]
back to top
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Hacd11.509e-3840.28gene:FBgn0032394 transcript:FBtr0080313[more]
Hacd23.881e-2029.91gene:FBgn0032524 transcript:FBtr0080519[more]
back to top
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hacd23.192e-5143.783-hydroxyacyl-CoA dehydratase 2 [Source:ZFIN;Acc:Z... [more]
hacd12.443e-4338.323-hydroxyacyl-CoA dehydratase 1 [Source:ZFIN;Acc:Z... [more]
hacd23.941e-4042.053-hydroxyacyl-CoA dehydratase 2 [Source:ZFIN;Acc:Z... [more]
hacd28.676e-3844.123-hydroxyacyl-CoA dehydratase 2 [Source:ZFIN;Acc:Z... [more]
hacd35.844e-1429.693-hydroxyacyl-CoA dehydratase 3 [Source:NCBI gene;... [more]
back to top
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kif2a5.349e-5144.34kinesin heavy chain member 2A [Source:Xenbase;Acc:... [more]
HACD12.545e-4639.813-hydroxyacyl-CoA dehydratase 1 [Source:NCBI gene;... [more]
lrp121.846e-1130.77LDL receptor related protein 12 [Source:Xenbase;Ac... [more]
lrp122.603e-1130.77LDL receptor related protein 12 [Source:Xenbase;Ac... [more]
lrp127.656e-1031.54LDL receptor related protein 12 [Source:Xenbase;Ac... [more]
back to top
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hacd22.995e-5446.233-hydroxyacyl-CoA dehydratase 2 [Source:MGI Symbol... [more]
Hacd11.792e-4137.863-hydroxyacyl-CoA dehydratase 1 [Source:MGI Symbol... [more]
Hacd11.792e-4137.863-hydroxyacyl-CoA dehydratase 1 [Source:MGI Symbol... [more]
Hacd31.759e-1429.553-hydroxyacyl-CoA dehydratase 3 [Source:MGI Symbol... [more]
Hacd41.792e-1225.483-hydroxyacyl-CoA dehydratase 4 [Source:MGI Symbol... [more]
back to top
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q2KIP8|HACD2_BOVIN8.728e-5447.17Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase... [more]
sp|Q9D3B1|HACD2_MOUSE2.095e-5346.23Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase... [more]
sp|Q6Y1H2|HACD2_HUMAN2.095e-5347.17Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase... [more]
sp|Q5RBK3|HACD2_PONAB2.157e-5347.17Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase... [more]
sp|O17040|HACD_CAEEL1.338e-4740.28Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase... [more]
back to top
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2B4RGH79.768e-5446.63Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase... [more]
A0A226E3T97.081e-5246.41Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase... [more]
I3NGS71.101e-5147.64Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase... [more]
A0A2K6BBG81.753e-5147.17Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase... [more]
A0A2K6LMD81.753e-5147.17Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase... [more]
back to top
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hacd24.407e-5344.913-hydroxyacyl-CoA dehydratase 2 [Source:NCBI gene;... [more]
hacd11.245e-4135.923-hydroxyacyl-CoA dehydratase 1 [Source:NCBI gene;... [more]
hacd11.414e-3234.393-hydroxyacyl-CoA dehydratase 1 [Source:NCBI gene;... [more]
hacd38.708e-1430.303-hydroxyacyl-CoA dehydratase 3 [Source:NCBI gene;... [more]
si:ch73-41h24.12.159e-729.733-hydroxyacyl-CoA dehydratase 4 [Source:HGNC Symbo... [more]
back to top
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
hacd11.209e-5142.013-hydroxyacyl-CoA dehydratase 1 [Source:ZFIN;Acc:Z... [more]
si:ch73-41h24.13.300e-1125.373-hydroxyacyl-CoA dehydratase 4 [Source:HGNC Symbo... [more]
back to top
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
PHS14.757e-3137.00Essential 3-hydroxyacyl-CoA dehydratase of the ER ... [more]
back to top
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO305883.828e-5145.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO324103.130e-1331.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hacd21.406e-5143.133-hydroxyacyl-CoA dehydratase 2 [Source:NCBI gene;... [more]
hacd23.806e-4238.393-hydroxyacyl-CoA dehydratase 2 [Source:NCBI gene;... [more]
hacd12.601e-3434.213-hydroxyacyl-CoA dehydratase 1 [Source:NCBI gene;... [more]
hacd14.266e-3336.553-hydroxyacyl-CoA dehydratase 1 [Source:NCBI gene;... [more]
hacd34.855e-1531.023-hydroxyacyl-CoA dehydratase 3 [Source:NCBI gene;... [more]
back to top
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000023255.11.993e-15899.54SMESG000023255.1[more]
SMESG000034959.16.884e-1435.96SMESG000034959.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024624 ID=SMED30024624|Name=Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase|organism=Schmidtea mediterranea sexual|type=transcript|length=769bp
TTTGAATTAAGTTAATTGTAGTTAAATTTAAAAATGACTTTTGTTCCAAA
ATATTTATTTATTTATAATTTAACACTAACATGTGGGTGGGCTTACGTAT
TATATAAAGAAATCTATGCTCTTTGGTCAACTAAATTTAATTTAGTTGAA
ACTTATTCCATTATTGAGAAACCTTTGAAGTTAGTTCAAACTGCAGCCGT
ATTAGAAATTTTACACAGTGCCTTTGGTTTTGTTAAATCACGTGTCGATA
TAACAACTATTCAAGTTTCATCTAGATTGTTTTTAGTATGGGGAATTTGT
AATATTTTCCCCAAAATCATCAGTGAAACTTATGGCATTCCAATGTTCAT
TATAGCATGGTCTATAGCTGAAATTATACGATATGGGTATTATGCAACTC
ACTTGATAAATTGTGTTCCTTATCCTTTGGTTTGGCTCAGATATACATTG
TTTTACGTCCTTTATCCTATGGGAGTCACGGGAGAGGTTTTAGCTATTTT
AGAATCGTTTCGCAATGCGTATGGCACAACGAGTTTCATTGATTTGCCAA
ATTCTTTGAATATTCAAATGAGATATGACTTTATTTTGGTTTTGGTTCTT
GTTTCGTACTTTCCAATCTTCCCGCAATTATTTGGTCATATGATTGTTCA
GAGAAAGAAAATCCTAGGAAAATCACATGAATCTTGATTTGGTTTTTTTT
ACTTAGAAATAAATTTTCGGTTTTTTTAAATTTAAGAAAAATATCGAAAT
AAATTAATTTTAATTGAAA
back to top

protein sequence of SMED30024624-orf-1

>SMED30024624-orf-1 ID=SMED30024624-orf-1|Name=SMED30024624-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=218bp
MTFVPKYLFIYNLTLTCGWAYVLYKEIYALWSTKFNLVETYSIIEKPLKL
VQTAAVLEILHSAFGFVKSRVDITTIQVSSRLFLVWGICNIFPKIISETY
GIPMFIIAWSIAEIIRYGYYATHLINCVPYPLVWLRYTLFYVLYPMGVTG
EVLAILESFRNAYGTTSFIDLPNSLNIQMRYDFILVLVLVSYFPIFPQLF
GHMIVQRKKILGKSHES*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR007482Tyr_Pase-like_PTPLA
Vocabulary: cellular component
TermDefinition
GO:0005783endoplasmic reticulum
GO:0005789endoplasmic reticulum membrane
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0006629lipid metabolic process
GO:0006631fatty acid metabolic process
GO:0006633fatty acid biosynthetic process
GO:0030148sphingolipid biosynthetic process
GO:0030497fatty acid elongation
GO:0042761very long-chain fatty acid biosynthetic process
Vocabulary: molecular function
TermDefinition
GO:0016829lyase activity
GO:00188123-hydroxyacyl-CoA dehydratase activity
GO:0019899enzyme binding
GO:01023443-hydroxy-behenoyl-CoA dehydratase activity
GO:01023453-hydroxy-lignoceroyl-CoA dehydratase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR007482Protein-tyrosine phosphatase-like, PTPLAPFAMPF04387PTPLAcoord: 52..213
e-value: 1.3E-55
score: 187.7
IPR007482Protein-tyrosine phosphatase-like, PTPLAPANTHERPTHR11035PTPLA DOMAIN PROTEINcoord: 6..214
NoneNo IPR availableTMHMMTMhelixcoord: 183..205
NoneNo IPR availableTMHMMTMhelixcoord: 7..24
NoneNo IPR availableTMHMMTMhelixcoord: 101..120
NoneNo IPR availableTMHMMTMhelixcoord: 133..155