Terminal nucleotidyltransferase 5C

Overview
NameTerminal nucleotidyltransferase 5C
Smed IDSMED30024611
Length (bp)8177
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Terminal nucleotidyltransferase 5C (SMED30024611) t-SNE clustered cells

Violin plots show distribution of expression levels for Terminal nucleotidyltransferase 5C (SMED30024611) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Terminal nucleotidyltransferase 5C (SMED30024611) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Terminal nucleotidyltransferase 5C (SMED30024611) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024611

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 15

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neuronSMED30024611SMESG000016756.1 dd_Smed_v4_3449_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30024611SMESG000016756.1 dd_Smed_v4_3449_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
lateral region of the whole animalSMED30024611SMESG000016756.1 dd_Smed_v4_3449_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30024611SMESG000016756.1 dd_Smed_v4_3449_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30024611SMESG000052359.1 dd_Smed_v4_4154_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30024611SMESG000052359.1 dd_Smed_v4_4154_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30024611SMESG000052359.1 dd_Smed_v4_4154_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
pharynxSMED30024611SMESG000079542.1 dd_Smed_v4_78314_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30024611SMESG000052359.1 dd_Smed_v6_4154_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30024611SMESG000016756.1 OX_Smed_1.0.21486ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30024611SMESG000079542.1 SMESG000071441.1 SMESG000059599.1 SMESG000047025.1 SMESG000047024.1 SMESG000046893.1 SMESG000041246.1 SMESG000029087.1 SMESG000013749.1 SMESG000010825.1 SMESG000008086.1 SMESG000077611.1 SMESG000073729.1 SMESG000055578.1 SMESG000055415.1 SMESG000052110.1 SMESG000050492.1 SMESG000039167.1 SMESG000036922.1 SMESG000033763.1 SMESG000027381.1 SMESG000070487.1 SMESG000018675.1 SMESG000018320.1 SMESG000011196.1 SMESG000008519.1 Contig44875uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30024611SMESG000079542.1 SMESG000071441.1 SMESG000059599.1 SMESG000047025.1 SMESG000047024.1 SMESG000046893.1 SMESG000041246.1 SMESG000029087.1 SMESG000013749.1 SMESG000010825.1 SMESG000008086.1 SMESG000077611.1 SMESG000073729.1 SMESG000055578.1 SMESG000055415.1 SMESG000052110.1 SMESG000050492.1 SMESG000039167.1 SMESG000036922.1 SMESG000033763.1 SMESG000027381.1 SMESG000070487.1 SMESG000018675.1 SMESG000018320.1 SMESG000011196.1 SMESG000008519.1 Contig44875newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30024611SMESG000079542.1 SMESG000077227.1 SMESG000077225.1 SMESG000071441.1 SMESG000064845.1 SMESG000059570.1 SMESG000053255.1 SMESG000047025.1 SMESG000046893.1 SMESG000030741.1 SMESG000022456.1 SMESG000022362.1 SMESG000021111.1 SMESG000008969.1 SMESG000008086.1 SMESG000000957.1 SMESG000020914.1 Contig37318uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30024611SMESG000079542.1 SMESG000077227.1 SMESG000077225.1 SMESG000071441.1 SMESG000064845.1 SMESG000059570.1 SMESG000053255.1 SMESG000047025.1 SMESG000046893.1 SMESG000030741.1 SMESG000022456.1 SMESG000022362.1 SMESG000021111.1 SMESG000008969.1 SMESG000008086.1 SMESG000000957.1 SMESG000020914.1 Contig37318newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
muscle cellSMED30024611SMESG000052359.1 dd_Smed_v4_4154_0_1dd_Smed_v4PMID:30962434
Cote et al., 2019
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Human
Match: TENT5C (terminal nucleotidyltransferase 5C [Source:HGNC Symbol;Acc:HGNC:24712])

HSP 1 Score: 239.195 bits (609), Expect = 1.161e-68
Identity = 143/354 (40.40%), Postives = 224/354 (63.28%), Query Frame = 3
Query: 5817 FQVLSYEQVKRLHRVIEKPLKLKPVSHSVLPVIEVSLRALLGEIKRKLKEVDVVIKDVRLDGTAAGCILNLNPNDDFRELNVIFTVSLHDMTSMQKIKNTIFSLLIDLLKKTLNSKPESLKHNFLINEELIKDNYIQKMTRVLCNQESNSDCWSLISLGTLEIGNETVELKFIDKMKRQYEFTIDSFQIVLDTMLAFYTVSKCSSITPNLFPTVVAESVSGSFQEAFKHLKENIISTKNPEEIXXXXXXXXXXXXAVGFQQNSAMDIRATEKYMCSRFFIDYPDINVQRQKLESFLDSLVDSNYEIKINLLNVLYEVVSHSTVCLMTHERRQTLQMINSLSQNILSEIEIKKST 6878
            F VL+++QV RLH V+ + + +        P +E++L+ ++  ++ +L+E  + + DVRL+G+AAG +L  +     ++L++IF V+L      Q +++ +   L++ L + +N     LK    I+   +K+ Y+QK+ +V     +++D WSLISL      N  VELKF+D ++RQ+EF++DSFQI+LD++L FY  S  + I+ +  PTV+ ES+ G F+EAF HL+  +I+TKNPEEI GGGLLKY  LL   F+     +I+  E+YMCSRFFID+PDI  Q++KLE++L +        K + L +L  VV+ STVCLM HERRQTL +I+ L+  +L+E  I  S 
Sbjct:   14 FSVLNWDQVSRLHEVLTEVVPIH--GRGNFPTLEITLKDIVQTVRSRLEEAGIKVHDVRLNGSAAGHVLVKDNGLGCKDLDLIFHVALPTEAEFQLVRDVVLCSLLNFLPEGVNK----LK----ISPVTLKEAYVQKLVKVC----TDTDRWSLISLSNKNGKN--VELKFVDSIRRQFEFSVDSFQIILDSLLFFYDCSN-NPISEHFHPTVIGESMYGDFEEAFDHLQNRLIATKNPEEIRGGGLLKYSNLLVRDFRPTDQEEIKTLERYMCSRFFIDFPDILEQQRKLETYLQNHFAEEERSKYDYLMILRRVVNESTVCLMGHERRQTLNLISLLALRVLAEQNIIPSA 350          
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Human
Match: TENT5A (terminal nucleotidyltransferase 5A [Source:HGNC Symbol;Acc:HGNC:18345])

HSP 1 Score: 234.572 bits (597), Expect = 2.477e-66
Identity = 142/345 (41.16%), Postives = 216/345 (62.61%), Query Frame = 3
Query: 5823 VLSYEQVKRLHRVIEKPLKLKPVSHSVLPVIEVSLRALLGEIKRKLKEVDVVIKDVRLDGTAAGCILNLNPNDDFRELNVIFTVSLHDMTSMQKIKNTIFSLLIDLLKKTLNSKPESLKHNFLINEELIKDNYIQKMTRVLCNQESNSDCWSLISLGTLEIGNETVELKFIDKMKRQYEFTIDSFQIVLDTMLAFYTVSKCSSITPNLFPTVVAESVSGSFQEAFKHLKENIISTKNPEEIXXXXXXXXXXXXAVGFQQNSAMDIRATEKYMCSRFFIDYPDINVQRQKLESFLDSLVDSNYEIKINLLNVLYEVVSHSTVCLMTHERRQTLQMINSLSQNILSE 6857
            VL++EQV+RL  ++ + + +        P +E+    ++  ++R+L E  + ++DVRL+G+AA  +L+ +    +++L++IF   L      Q +K+ +   L+D L + +N +         I    +K+ Y+QKM +V CN   +SD WSLISL       + VELKF+D ++RQ+EF++DSFQI LD++L FY  S+ + +T    PT++ ESV G FQEAF HL   II+T+NPEEI GGGLLKYC LL  GF+  S  +I+  ++YMCSRFFID+ DI  Q++KLES+L +      + K   L  L+ VV+ STVCLM HERRQTL +I  L+  +L++
Sbjct:   65 VLNWEQVQRLDGILSETIPIH--GRGNFPTLELQPSLIVKVVRRRLAEKRIGVRDVRLNGSAASHVLHQDSGLGYKDLDLIFCADLRGEGEFQTVKDVVLDCLLDFLPEGVNKEK--------ITPLTLKEAYVQKMVKV-CN---DSDRWSLISLSN--NSGKNVELKFVDSLRRQFEFSVDSFQIKLDSLLLFYECSE-NPMTETFHPTIIGESVYGDFQEAFDHLCNKIIATRNPEEIRGGGLLKYCNLLVRGFRPASD-EIKTLQRYMCSRFFIDFSDIGEQQRKLESYLQNHFVGLEDRKYEYLMTLHGVVNESTVCLMGHERRQTLNLITMLAIRVLAD 391          
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Human
Match: TENT5A (terminal nucleotidyltransferase 5A [Source:HGNC Symbol;Acc:HGNC:18345])

HSP 1 Score: 234.958 bits (598), Expect = 3.125e-66
Identity = 142/345 (41.16%), Postives = 216/345 (62.61%), Query Frame = 3
Query: 5823 VLSYEQVKRLHRVIEKPLKLKPVSHSVLPVIEVSLRALLGEIKRKLKEVDVVIKDVRLDGTAAGCILNLNPNDDFRELNVIFTVSLHDMTSMQKIKNTIFSLLIDLLKKTLNSKPESLKHNFLINEELIKDNYIQKMTRVLCNQESNSDCWSLISLGTLEIGNETVELKFIDKMKRQYEFTIDSFQIVLDTMLAFYTVSKCSSITPNLFPTVVAESVSGSFQEAFKHLKENIISTKNPEEIXXXXXXXXXXXXAVGFQQNSAMDIRATEKYMCSRFFIDYPDINVQRQKLESFLDSLVDSNYEIKINLLNVLYEVVSHSTVCLMTHERRQTLQMINSLSQNILSE 6857
            VL++EQV+RL  ++ + + +        P +E+    ++  ++R+L E  + ++DVRL+G+AA  +L+ +    +++L++IF   L      Q +K+ +   L+D L + +N +         I    +K+ Y+QKM +V CN   +SD WSLISL       + VELKF+D ++RQ+EF++DSFQI LD++L FY  S+ + +T    PT++ ESV G FQEAF HL   II+T+NPEEI GGGLLKYC LL  GF+  S  +I+  ++YMCSRFFID+ DI  Q++KLES+L +      + K   L  L+ VV+ STVCLM HERRQTL +I  L+  +L++
Sbjct:   84 VLNWEQVQRLDGILSETIPIH--GRGNFPTLELQPSLIVKVVRRRLAEKRIGVRDVRLNGSAASHVLHQDSGLGYKDLDLIFCADLRGEGEFQTVKDVVLDCLLDFLPEGVNKEK--------ITPLTLKEAYVQKMVKV-CN---DSDRWSLISLSN--NSGKNVELKFVDSLRRQFEFSVDSFQIKLDSLLLFYECSE-NPMTETFHPTIIGESVYGDFQEAFDHLCNKIIATRNPEEIRGGGLLKYCNLLVRGFRPASD-EIKTLQRYMCSRFFIDFSDIGEQQRKLESYLQNHFVGLEDRKYEYLMTLHGVVNESTVCLMGHERRQTLNLITMLAIRVLAD 410          
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Human
Match: TENT5A (terminal nucleotidyltransferase 5A [Source:HGNC Symbol;Acc:HGNC:18345])

HSP 1 Score: 235.343 bits (599), Expect = 9.438e-66
Identity = 146/349 (41.83%), Postives = 217/349 (62.18%), Query Frame = 3
Query: 5823 VLSYEQVKRLHRVIEKPLKLKPVSHSVLPVIEVSLRALLGEIKRKLKEVDVVIKDVRLDGTAAGCILNLNPNDDFRELNVIFTVSLHDMTSMQKIKNTIFSLLIDLLKKTLNSKPESLKHNFLINEELIKDNYIQKMTRVLCNQESNSDCWSLISLGTLEIGNETVELKFIDKMKRQYEFTIDSFQIVLDTMLAFYTVSKCSSITPNLFPTVVAESVSGSFQEAFKHLKENIISTKNPEEIXXXXXXXXXXXXAVGFQQNSAMDIRATEKYMCSRFFIDYPDINVQRQKLESFLD----SLVDSNYEIKINLLNVLYEVVSHSTVCLMTHERRQTLQMINSLSQNILSE 6857
            VL++EQV+RL  ++ + + +        P +E+    ++  ++R+L E  + ++DVRL+G+AA  +L+ +    +++L++IF   L      Q +K+ +   L+D L + +N +         I    +K+ Y+QKM +V CN   +SD WSLISL      N  VELKF+D ++RQ+EF++DSFQI LD++L FY  S+ + +T    PT++ ESV G FQEAF HL   II+T+NPEEI GGGLLKYC LL  GF+  S  +I+  ++YMCSRFFID+ DI  Q++KLES+L      L D  YE     L  L+ VV+ STVCLM HERRQTL +I  L+  +L++
Sbjct:  146 VLNWEQVQRLDGILSETIPIH--GRGNFPTLELQPSLIVKVVRRRLAEKRIGVRDVRLNGSAASHVLHQDSGLGYKDLDLIFCADLRGEGEFQTVKDVVLDCLLDFLPEGVNKEK--------ITPLTLKEAYVQKMVKV-CN---DSDRWSLISLSNNSGKN--VELKFVDSLRRQFEFSVDSFQIKLDSLLLFYECSE-NPMTETFHPTIIGESVYGDFQEAFDHLCNKIIATRNPEEIRGGGLLKYCNLLVRGFRPASD-EIKTLQRYMCSRFFIDFSDIGEQQRKLESYLQNHFVGLEDRKYE----YLMTLHGVVNESTVCLMGHERRQTLNLITMLAIRVLAD 472          
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Human
Match: TENT5D (terminal nucleotidyltransferase 5D [Source:HGNC Symbol;Acc:HGNC:28399])

HSP 1 Score: 230.72 bits (587), Expect = 1.036e-65
Identity = 143/355 (40.28%), Postives = 217/355 (61.13%), Query Frame = 3
Query: 5814 RFQVLSYEQVKRLHRVIEKPLKLKPVSHSVLPVIEVSLRALLGEIKRKLKEVDVVIKDVRLDGTAAGCILNLNPNDDFRELNVIFTVSLHDMTSMQKIKNTIFSLLIDLLKKTLNSKPESLKHNFLINEELIKDNYIQKMTRVLCNQESNSDCWSLISLGTLEIGNETVELKFIDKMKRQYEFTIDSFQIVLDTMLAFYTVSKCSSITPNLFPTVVAESVSGSFQEAFKHLKENIISTKNPEEIXXXXXXXXXXXXAVGFQQNSAMDIRATEKYMCSRFFIDYPDINVQRQKLESFLDSLVDSNYEIKINLLNVLYEVVSHSTVCLMTHERRQTLQMINSLSQNILSEIEIKKST 6878
            RF  L+++QV  L +V+++ + +        P +EV  + ++  +K +L    +++KD RL+G+ A  IL  +    +++L+VIF V L      Q +K+ +   L+D L K  + K E L      + +++KD Y+QK+ +V CN     DCWSLISL       + +ELKF+  ++RQ+EF++DSFQIVLD ML FY+  K + +T   +P VVAES+ G FQEA  HL+  +I T+ PEEI GGGLLKYC LL  GF+     +I+  E+YMCSRFFID+P I  Q++K+ES+L +        K + L  L+ VV+ STVCLM++ERRQ L +I  ++  +L E+ I  +T
Sbjct:    5 RFTNLTWDQVITLDQVLDEVIPIH--GKGNFPTMEVKPKDIIHVVKDQLIGQGIIVKDARLNGSVASYILASHNGISYKDLDVIFGVELPGNEEFQVVKDAVLDCLLDFLPK--DVKKEKL------SPDIMKDAYVQKLVKV-CN---GHDCWSLISLSNNT--GKNLELKFVSSLRRQFEFSVDSFQIVLDPMLDFYS-DKNAKLTKESYPVVVAESMYGDFQEAMTHLQHKLICTRKPEEIRGGGLLKYCSLLVHGFKPACMSEIKNLERYMCSRFFIDFPHIEEQQKKIESYLHNHFIGEGMTKYDYLMTLHGVVNESTVCLMSYERRQILHLITMMALKVLGELNILPNT 342          
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Celegans
Match: pqn-44 (Prion-like-(Q/N-rich)-domain-bearing protein [Source:UniProtKB/TrEMBL;Acc:Q86NJ5])

HSP 1 Score: 171.785 bits (434), Expect = 3.091e-45
Identity = 131/380 (34.47%), Postives = 205/380 (53.95%), Query Frame = 3
Query: 5811 NRFQVLSYEQVKRLHRVIEKPLKLKPVSHSVLPVIEVSLRALLGEIKRKLKEVDVVIKDVRLDGTAAGCILNLNPNDDFR--ELNVIFTVSLHDMTSMQKIKNTIFSLLIDLLKKTLNS-KPESL-KHNFLINEELIKDNYIQKMTRVLCNQESNSDCWSLISLGTLEIGNETVELKFIDKMKRQYEFTIDSFQIVLDTMLAFYTVSKCSSITPNLFPTVVAESVSGSFQEAFKHLKENIISTKNPEEIXXXXXXXXXXXXAVGFQQNSAMDIRATEKYMCSRFFIDYPDINVQRQKLESFLDSLVDSNY---------------------------------EIKINLLNVLYEVVSHSTVCLMTHERRQTLQMINSLS 6839
            +R  +L+  Q+KRL  V+E+ +++        P I   L  L+  +++ +  V V  +DVRL+G AA  + +   +DDF   +L++IF + + D  S + ++  IF  + D +  T+    P+++ K  F  + E +KD YI+KM +V     +++D WSL SL   E G   +ELKF++KM+RQ+EF++DSFQI LD +L    + +C          +  ES+ G  Q+A  HL E +I T  PEEI GGGLLKYC L+  G++     + R  E+YMCSRFFID+PD+  Q  KL ++LDS   +++                                 + K + L +LY V+  STVCLM HER  +L MI+ ++
Sbjct:   45 SRTMILAKGQMKRLRAVLEERVEIH--GRGNFPTISTKLINLIRCLRQHMGSVQVEARDVRLNGGAASFVAS---SDDFSYADLDLIFPIQI-DEESDENVEKQIFDAIRDSVFMTIRELMPDNIGKEKF--DFETLKDVYIRKMIKV----STDNDKWSLFSLNN-EYG-RCIELKFVNKMRRQFEFSVDSFQIHLDPLLN--ELDECEQ------KKITIESMYGDVQQAMTHLHERLIDTVKPEEIRGGGLLKYCHLIIRGYKAAKPWNCRKLERYMCSRFFIDFPDLISQENKLRNYLDSHFGTSFNGATYDQWSSSGSDTDSEASTSQATTSSLLVTGQAKYDFLMLLYRVIDESTVCLMAHERNMSLNMIDRVA 402          
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Celegans
Match: pqn-44 (Prion-like-(Q/N-rich)-domain-bearing protein [Source:UniProtKB/TrEMBL;Acc:Q86NJ5])

HSP 1 Score: 171.785 bits (434), Expect = 3.091e-45
Identity = 131/380 (34.47%), Postives = 205/380 (53.95%), Query Frame = 3
Query: 5811 NRFQVLSYEQVKRLHRVIEKPLKLKPVSHSVLPVIEVSLRALLGEIKRKLKEVDVVIKDVRLDGTAAGCILNLNPNDDFR--ELNVIFTVSLHDMTSMQKIKNTIFSLLIDLLKKTLNS-KPESL-KHNFLINEELIKDNYIQKMTRVLCNQESNSDCWSLISLGTLEIGNETVELKFIDKMKRQYEFTIDSFQIVLDTMLAFYTVSKCSSITPNLFPTVVAESVSGSFQEAFKHLKENIISTKNPEEIXXXXXXXXXXXXAVGFQQNSAMDIRATEKYMCSRFFIDYPDINVQRQKLESFLDSLVDSNY---------------------------------EIKINLLNVLYEVVSHSTVCLMTHERRQTLQMINSLS 6839
            +R  +L+  Q+KRL  V+E+ +++        P I   L  L+  +++ +  V V  +DVRL+G AA  + +   +DDF   +L++IF + + D  S + ++  IF  + D +  T+    P+++ K  F  + E +KD YI+KM +V     +++D WSL SL   E G   +ELKF++KM+RQ+EF++DSFQI LD +L    + +C          +  ES+ G  Q+A  HL E +I T  PEEI GGGLLKYC L+  G++     + R  E+YMCSRFFID+PD+  Q  KL ++LDS   +++                                 + K + L +LY V+  STVCLM HER  +L MI+ ++
Sbjct:   45 SRTMILAKGQMKRLRAVLEERVEIH--GRGNFPTISTKLINLIRCLRQHMGSVQVEARDVRLNGGAASFVAS---SDDFSYADLDLIFPIQI-DEESDENVEKQIFDAIRDSVFMTIRELMPDNIGKEKF--DFETLKDVYIRKMIKV----STDNDKWSLFSLNN-EYG-RCIELKFVNKMRRQFEFSVDSFQIHLDPLLN--ELDECEQ------KKITIESMYGDVQQAMTHLHERLIDTVKPEEIRGGGLLKYCHLIIRGYKAAKPWNCRKLERYMCSRFFIDFPDLISQENKLRNYLDSHFGTSFNGATYDQWSSSGSDTDSEASTSQATTSSLLVTGQAKYDFLMLLYRVIDESTVCLMAHERNMSLNMIDRVA 402          
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Celegans
Match: pqn-44 (Prion-like-(Q/N-rich)-domain-bearing protein [Source:UniProtKB/TrEMBL;Acc:Q86NJ5])

HSP 1 Score: 171.785 bits (434), Expect = 3.828e-45
Identity = 131/380 (34.47%), Postives = 205/380 (53.95%), Query Frame = 3
Query: 5811 NRFQVLSYEQVKRLHRVIEKPLKLKPVSHSVLPVIEVSLRALLGEIKRKLKEVDVVIKDVRLDGTAAGCILNLNPNDDFR--ELNVIFTVSLHDMTSMQKIKNTIFSLLIDLLKKTLNS-KPESL-KHNFLINEELIKDNYIQKMTRVLCNQESNSDCWSLISLGTLEIGNETVELKFIDKMKRQYEFTIDSFQIVLDTMLAFYTVSKCSSITPNLFPTVVAESVSGSFQEAFKHLKENIISTKNPEEIXXXXXXXXXXXXAVGFQQNSAMDIRATEKYMCSRFFIDYPDINVQRQKLESFLDSLVDSNY---------------------------------EIKINLLNVLYEVVSHSTVCLMTHERRQTLQMINSLS 6839
            +R  +L+  Q+KRL  V+E+ +++        P I   L  L+  +++ +  V V  +DVRL+G AA  + +   +DDF   +L++IF + + D  S + ++  IF  + D +  T+    P+++ K  F  + E +KD YI+KM +V     +++D WSL SL   E G   +ELKF++KM+RQ+EF++DSFQI LD +L    + +C          +  ES+ G  Q+A  HL E +I T  PEEI GGGLLKYC L+  G++     + R  E+YMCSRFFID+PD+  Q  KL ++LDS   +++                                 + K + L +LY V+  STVCLM HER  +L MI+ ++
Sbjct:   61 SRTMILAKGQMKRLRAVLEERVEIH--GRGNFPTISTKLINLIRCLRQHMGSVQVEARDVRLNGGAASFVAS---SDDFSYADLDLIFPIQI-DEESDENVEKQIFDAIRDSVFMTIRELMPDNIGKEKF--DFETLKDVYIRKMIKV----STDNDKWSLFSLNN-EYG-RCIELKFVNKMRRQFEFSVDSFQIHLDPLLN--ELDECEQ------KKITIESMYGDVQQAMTHLHERLIDTVKPEEIRGGGLLKYCHLIIRGYKAAKPWNCRKLERYMCSRFFIDFPDLISQENKLRNYLDSHFGTSFNGATYDQWSSSGSDTDSEASTSQATTSSLLVTGQAKYDFLMLLYRVIDESTVCLMAHERNMSLNMIDRVA 418          
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Celegans
Match: pqn-44 (Prion-like-(Q/N-rich)-domain-bearing protein [Source:UniProtKB/TrEMBL;Acc:Q86NJ5])

HSP 1 Score: 171.785 bits (434), Expect = 3.898e-45
Identity = 131/380 (34.47%), Postives = 205/380 (53.95%), Query Frame = 3
Query: 5811 NRFQVLSYEQVKRLHRVIEKPLKLKPVSHSVLPVIEVSLRALLGEIKRKLKEVDVVIKDVRLDGTAAGCILNLNPNDDFR--ELNVIFTVSLHDMTSMQKIKNTIFSLLIDLLKKTLNS-KPESL-KHNFLINEELIKDNYIQKMTRVLCNQESNSDCWSLISLGTLEIGNETVELKFIDKMKRQYEFTIDSFQIVLDTMLAFYTVSKCSSITPNLFPTVVAESVSGSFQEAFKHLKENIISTKNPEEIXXXXXXXXXXXXAVGFQQNSAMDIRATEKYMCSRFFIDYPDINVQRQKLESFLDSLVDSNY---------------------------------EIKINLLNVLYEVVSHSTVCLMTHERRQTLQMINSLS 6839
            +R  +L+  Q+KRL  V+E+ +++        P I   L  L+  +++ +  V V  +DVRL+G AA  + +   +DDF   +L++IF + + D  S + ++  IF  + D +  T+    P+++ K  F  + E +KD YI+KM +V     +++D WSL SL   E G   +ELKF++KM+RQ+EF++DSFQI LD +L    + +C          +  ES+ G  Q+A  HL E +I T  PEEI GGGLLKYC L+  G++     + R  E+YMCSRFFID+PD+  Q  KL ++LDS   +++                                 + K + L +LY V+  STVCLM HER  +L MI+ ++
Sbjct:   69 SRTMILAKGQMKRLRAVLEERVEIH--GRGNFPTISTKLINLIRCLRQHMGSVQVEARDVRLNGGAASFVAS---SDDFSYADLDLIFPIQI-DEESDENVEKQIFDAIRDSVFMTIRELMPDNIGKEKF--DFETLKDVYIRKMIKV----STDNDKWSLFSLNN-EYG-RCIELKFVNKMRRQFEFSVDSFQIHLDPLLN--ELDECEQ------KKITIESMYGDVQQAMTHLHERLIDTVKPEEIRGGGLLKYCHLIIRGYKAAKPWNCRKLERYMCSRFFIDFPDLISQENKLRNYLDSHFGTSFNGATYDQWSSSGSDTDSEASTSQATTSSLLVTGQAKYDFLMLLYRVIDESTVCLMAHERNMSLNMIDRVA 426          
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Celegans
Match: pqn-44 (Prion-like-(Q/N-rich)-domain-bearing protein [Source:UniProtKB/TrEMBL;Acc:Q86NJ5])

HSP 1 Score: 171.4 bits (433), Expect = 5.789e-45
Identity = 131/380 (34.47%), Postives = 205/380 (53.95%), Query Frame = 3
Query: 5811 NRFQVLSYEQVKRLHRVIEKPLKLKPVSHSVLPVIEVSLRALLGEIKRKLKEVDVVIKDVRLDGTAAGCILNLNPNDDFR--ELNVIFTVSLHDMTSMQKIKNTIFSLLIDLLKKTLNS-KPESL-KHNFLINEELIKDNYIQKMTRVLCNQESNSDCWSLISLGTLEIGNETVELKFIDKMKRQYEFTIDSFQIVLDTMLAFYTVSKCSSITPNLFPTVVAESVSGSFQEAFKHLKENIISTKNPEEIXXXXXXXXXXXXAVGFQQNSAMDIRATEKYMCSRFFIDYPDINVQRQKLESFLDSLVDSNY---------------------------------EIKINLLNVLYEVVSHSTVCLMTHERRQTLQMINSLS 6839
            +R  +L+  Q+KRL  V+E+ +++        P I   L  L+  +++ +  V V  +DVRL+G AA  + +   +DDF   +L++IF + + D  S + ++  IF  + D +  T+    P+++ K  F  + E +KD YI+KM +V     +++D WSL SL   E G   +ELKF++KM+RQ+EF++DSFQI LD +L    + +C          +  ES+ G  Q+A  HL E +I T  PEEI GGGLLKYC L+  G++     + R  E+YMCSRFFID+PD+  Q  KL ++LDS   +++                                 + K + L +LY V+  STVCLM HER  +L MI+ ++
Sbjct:   74 SRTMILAKGQMKRLRAVLEERVEIH--GRGNFPTISTKLINLIRCLRQHMGSVQVEARDVRLNGGAASFVAS---SDDFSYADLDLIFPIQI-DEESDENVEKQIFDAIRDSVFMTIRELMPDNIGKEKF--DFETLKDVYIRKMIKV----STDNDKWSLFSLNN-EYG-RCIELKFVNKMRRQFEFSVDSFQIHLDPLLN--ELDECEQ------KKITIESMYGDVQQAMTHLHERLIDTVKPEEIRGGGLLKYCHLIIRGYKAAKPWNCRKLERYMCSRFFIDFPDLISQENKLRNYLDSHFGTSFNGATYDQWSSSGSDTDSEASTSQATTSSLLVTGQAKYDFLMLLYRVIDESTVCLMAHERNMSLNMIDRVA 431          
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Fly
Match: CG46385 (gene:FBgn0286778 transcript:FBtr0474227)

HSP 1 Score: 246.514 bits (628), Expect = 8.252e-70
Identity = 153/367 (41.69%), Postives = 226/367 (61.58%), Query Frame = 3
Query: 5778 STVSKIDSVGPNRFQVLSYEQVKRLHRVIEKPLKLKPVSHSVLPVIEVSLRALLGEIKRKLKE------VDVVIKDVRLDGTAAGCILNLNPNDDFRELNVIFTVSLHDMTSMQKIKNTIFSLLIDLLKKTLNSKPESLKHNFLINEELIKDNYIQKMTRVLCNQESNSDCWSLISLGTLEIGNETVELKFIDKMKRQYEFTIDSFQIVLDTMLAFYTVSKCSSITPNLFPTVVAESVSGSFQEAFKHLKENIISTKNPEEIXXXXXXXXXXXXAVGFQQNSAMDIRATEKYMCSRFFIDYPDINVQRQKLESFLDSL---VDSNYEIKINLLNVLYEVVSHSTVCLMTHERRQTLQMINSLSQNIL 6851
             ++  +D+ G  R  VLS+EQV +LH V+++ + +        P +EV L+ L+  ++RKL+         V++KD+RL+G AA  +L  + +  + +L++IF + L       ++K  + + L+DL+       PE +    +    L K+ Y+ KM +V  N  ++ D WSLISLG    G++ VELKF+D M+RQ+EF++DSFQIVLD++L FY  +    I+ N +PTVV ESV G FQEA  HL++ +IST+ PEEI GGGLLKYC LL   ++   +  I+  E+YMCSRFFID+PDIN Q  KLE++L +    VD    ++   L  L EVV  STVCLM HERRQ+L +I SL+  +L
Sbjct:   36 GSLESVDTGGTQRLAVLSFEQVSKLHDVMDEKVAIH--GRGNFPTLEVKLKDLVNLVRRKLEAEVNAGGAGVLVKDIRLNGGAASHVLA-SEDQPYNDLDLIFAIELSSPRVFDRVKVAVLNTLLDLM-------PEGVCKRRIYTCSL-KEAYVGKMVKV--NNNNDGDRWSLISLGN-SPGHKNVELKFVDTMRRQFEFSVDSFQIVLDSLLLFYDCAAL-PISENFYPTVVGESVYGDFQEALYHLQKKLISTRQPEEIRGGGLLKYCNLLVRNYKAVDSQLIKTLERYMCSRFFIDFPDINTQTTKLEAYLRNHFWGVDEE-PLQYQYLMHLREVVEMSTVCLMGHERRQSLHLIQSLAAQVL 386          
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Fly
Match: CG46385 (gene:FBgn0286778 transcript:FBtr0474226)

HSP 1 Score: 246.514 bits (628), Expect = 8.252e-70
Identity = 153/367 (41.69%), Postives = 226/367 (61.58%), Query Frame = 3
Query: 5778 STVSKIDSVGPNRFQVLSYEQVKRLHRVIEKPLKLKPVSHSVLPVIEVSLRALLGEIKRKLKE------VDVVIKDVRLDGTAAGCILNLNPNDDFRELNVIFTVSLHDMTSMQKIKNTIFSLLIDLLKKTLNSKPESLKHNFLINEELIKDNYIQKMTRVLCNQESNSDCWSLISLGTLEIGNETVELKFIDKMKRQYEFTIDSFQIVLDTMLAFYTVSKCSSITPNLFPTVVAESVSGSFQEAFKHLKENIISTKNPEEIXXXXXXXXXXXXAVGFQQNSAMDIRATEKYMCSRFFIDYPDINVQRQKLESFLDSL---VDSNYEIKINLLNVLYEVVSHSTVCLMTHERRQTLQMINSLSQNIL 6851
             ++  +D+ G  R  VLS+EQV +LH V+++ + +        P +EV L+ L+  ++RKL+         V++KD+RL+G AA  +L  + +  + +L++IF + L       ++K  + + L+DL+       PE +    +    L K+ Y+ KM +V  N  ++ D WSLISLG    G++ VELKF+D M+RQ+EF++DSFQIVLD++L FY  +    I+ N +PTVV ESV G FQEA  HL++ +IST+ PEEI GGGLLKYC LL   ++   +  I+  E+YMCSRFFID+PDIN Q  KLE++L +    VD    ++   L  L EVV  STVCLM HERRQ+L +I SL+  +L
Sbjct:   36 GSLESVDTGGTQRLAVLSFEQVSKLHDVMDEKVAIH--GRGNFPTLEVKLKDLVNLVRRKLEAEVNAGGAGVLVKDIRLNGGAASHVLA-SEDQPYNDLDLIFAIELSSPRVFDRVKVAVLNTLLDLM-------PEGVCKRRIYTCSL-KEAYVGKMVKV--NNNNDGDRWSLISLGN-SPGHKNVELKFVDTMRRQFEFSVDSFQIVLDSLLLFYDCAAL-PISENFYPTVVGESVYGDFQEALYHLQKKLISTRQPEEIRGGGLLKYCNLLVRNYKAVDSQLIKTLERYMCSRFFIDFPDINTQTTKLEAYLRNHFWGVDEE-PLQYQYLMHLREVVEMSTVCLMGHERRQSLHLIQSLAAQVL 386          
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Fly
Match: CG46385 (gene:FBgn0286778 transcript:FBtr0474225)

HSP 1 Score: 246.514 bits (628), Expect = 1.718e-69
Identity = 153/367 (41.69%), Postives = 226/367 (61.58%), Query Frame = 3
Query: 5778 STVSKIDSVGPNRFQVLSYEQVKRLHRVIEKPLKLKPVSHSVLPVIEVSLRALLGEIKRKLKE------VDVVIKDVRLDGTAAGCILNLNPNDDFRELNVIFTVSLHDMTSMQKIKNTIFSLLIDLLKKTLNSKPESLKHNFLINEELIKDNYIQKMTRVLCNQESNSDCWSLISLGTLEIGNETVELKFIDKMKRQYEFTIDSFQIVLDTMLAFYTVSKCSSITPNLFPTVVAESVSGSFQEAFKHLKENIISTKNPEEIXXXXXXXXXXXXAVGFQQNSAMDIRATEKYMCSRFFIDYPDINVQRQKLESFLDSL---VDSNYEIKINLLNVLYEVVSHSTVCLMTHERRQTLQMINSLSQNIL 6851
             ++  +D+ G  R  VLS+EQV +LH V+++ + +        P +EV L+ L+  ++RKL+         V++KD+RL+G AA  +L  + +  + +L++IF + L       ++K  + + L+DL+       PE +    +    L K+ Y+ KM +V  N  ++ D WSLISLG    G++ VELKF+D M+RQ+EF++DSFQIVLD++L FY  +    I+ N +PTVV ESV G FQEA  HL++ +IST+ PEEI GGGLLKYC LL   ++   +  I+  E+YMCSRFFID+PDIN Q  KLE++L +    VD    ++   L  L EVV  STVCLM HERRQ+L +I SL+  +L
Sbjct:   67 GSLESVDTGGTQRLAVLSFEQVSKLHDVMDEKVAIH--GRGNFPTLEVKLKDLVNLVRRKLEAEVNAGGAGVLVKDIRLNGGAASHVL-ASEDQPYNDLDLIFAIELSSPRVFDRVKVAVLNTLLDLM-------PEGVCKRRIYTCSL-KEAYVGKMVKV--NNNNDGDRWSLISLGN-SPGHKNVELKFVDTMRRQFEFSVDSFQIVLDSLLLFYDCAAL-PISENFYPTVVGESVYGDFQEALYHLQKKLISTRQPEEIRGGGLLKYCNLLVRNYKAVDSQLIKTLERYMCSRFFIDFPDINTQTTKLEAYLRNHFWGVDEE-PLQYQYLMHLREVVEMSTVCLMGHERRQSLHLIQSLAAQVL 417          
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Fly
Match: CG46385 (gene:FBgn0286778 transcript:FBtr0474229)

HSP 1 Score: 247.669 bits (631), Expect = 7.027e-68
Identity = 154/369 (41.73%), Postives = 228/369 (61.79%), Query Frame = 3
Query: 5778 STVSKIDSVGPNRFQVLSYEQVKRLHRVIEKPLKLKPVSHSVLPVIEVSLRALLGEIKRKLKE------VDVVIKDVRLDGTAAGCILNLNPNDDFRELNVIFTVSLHDMTSMQKIKNTIFSLLIDLLKKTLNSKPESLKHNFLINEELIKDNYIQKMTRVLCNQESNSDCWSLISLGTLEIGNETVELKFIDKMKRQYEFTIDSFQIVLDTMLAFYTVSKCSS--ITPNLFPTVVAESVSGSFQEAFKHLKENIISTKNPEEIXXXXXXXXXXXXAVGFQQNSAMDIRATEKYMCSRFFIDYPDINVQRQKLESFLDSL---VDSNYEIKINLLNVLYEVVSHSTVCLMTHERRQTLQMINSLSQNIL 6851
             ++  +D+ G  R  VLS+EQV +LH V+++ + +        P +EV L+ L+  ++RKL+         V++KD+RL+G AA  +L  + +  + +L++IF + L       ++K  + + L+DL+       PE +    +    L K+ Y+ KM +V  N  ++ D WSLISLG    G++ VELKF+D M+RQ+EF++DSFQIVLD++L FY    C++  I+ N +PTVV ESV G FQEA  HL++ +IST+ PEEI GGGLLKYC LL   ++   +  I+  E+YMCSRFFID+PDIN Q  KLE++L +    VD    ++   L  L EVV  STVCLM HERRQ+L +I SL+  +L
Sbjct:   67 GSLESVDTGGTQRLAVLSFEQVSKLHDVMDEKVAIH--GRGNFPTLEVKLKDLVNLVRRKLEAEVNAGGAGVLVKDIRLNGGAASHVL-ASEDQPYNDLDLIFAIELSSPRVFDRVKVAVLNTLLDLM-------PEGVCKRRIYTCSL-KEAYVGKMVKV--NNNNDGDRWSLISLGN-SPGHKNVELKFVDTMRRQFEFSVDSFQIVLDSLLLFY---DCAALPISENFYPTVVGESVYGDFQEALYHLQKKLISTRQPEEIRGGGLLKYCNLLVRNYKAVDSQLIKTLERYMCSRFFIDFPDINTQTTKLEAYLRNHFWGVDEE-PLQYQYLMHLREVVEMSTVCLMGHERRQSLHLIQSLAAQVL 417          
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Fly
Match: CG46385 (gene:FBgn0286778 transcript:FBtr0474224)

HSP 1 Score: 248.054 bits (632), Expect = 2.501e-67
Identity = 154/369 (41.73%), Postives = 228/369 (61.79%), Query Frame = 3
Query: 5778 STVSKIDSVGPNRFQVLSYEQVKRLHRVIEKPLKLKPVSHSVLPVIEVSLRALLGEIKRKLKE------VDVVIKDVRLDGTAAGCILNLNPNDDFRELNVIFTVSLHDMTSMQKIKNTIFSLLIDLLKKTLNSKPESLKHNFLINEELIKDNYIQKMTRVLCNQESNSDCWSLISLGTLEIGNETVELKFIDKMKRQYEFTIDSFQIVLDTMLAFYTVSKCSS--ITPNLFPTVVAESVSGSFQEAFKHLKENIISTKNPEEIXXXXXXXXXXXXAVGFQQNSAMDIRATEKYMCSRFFIDYPDINVQRQKLESFLDSL---VDSNYEIKINLLNVLYEVVSHSTVCLMTHERRQTLQMINSLSQNIL 6851
             ++  +D+ G  R  VLS+EQV +LH V+++ + +        P +EV L+ L+  ++RKL+         V++KD+RL+G AA  +L  + +  + +L++IF + L       ++K  + + L+DL+       PE +    +    L K+ Y+ KM +V  N  ++ D WSLISLG    G++ VELKF+D M+RQ+EF++DSFQIVLD++L FY    C++  I+ N +PTVV ESV G FQEA  HL++ +IST+ PEEI GGGLLKYC LL   ++   +  I+  E+YMCSRFFID+PDIN Q  KLE++L +    VD    ++   L  L EVV  STVCLM HERRQ+L +I SL+  +L
Sbjct:  384 GSLESVDTGGTQRLAVLSFEQVSKLHDVMDEKVAIH--GRGNFPTLEVKLKDLVNLVRRKLEAEVNAGGAGVLVKDIRLNGGAASHVL-ASEDQPYNDLDLIFAIELSSPRVFDRVKVAVLNTLLDLM-------PEGVCKRRIYTCSL-KEAYVGKMVKV--NNNNDGDRWSLISLGN-SPGHKNVELKFVDTMRRQFEFSVDSFQIVLDSLLLFY---DCAALPISENFYPTVVGESVYGDFQEALYHLQKKLISTRQPEEIRGGGLLKYCNLLVRNYKAVDSQLIKTLERYMCSRFFIDFPDINTQTTKLEAYLRNHFWGVDEE-PLQYQYLMHLREVVEMSTVCLMGHERRQSLHLIQSLAAQVL 734          
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Zebrafish
Match: TENT5A (terminal nucleotidyltransferase 5Aa [Source:NCBI gene;Acc:100330676])

HSP 1 Score: 243.047 bits (619), Expect = 3.783e-70
Identity = 143/347 (41.21%), Postives = 219/347 (63.11%), Query Frame = 3
Query: 5817 FQVLSYEQVKRLHRVIEKPLKLKPVSHSVLPVIEVSLRALLGEIKRKLKEVDVVIKDVRLDGTAAGCILNLNPNDDFRELNVIFTVSLHDMTSMQKIKNTIFSLLIDLLKKTLNSKPESLKHNFLINEELIKDNYIQKMTRVLCNQESNSDCWSLISLGTLEIGNETVELKFIDKMKRQYEFTIDSFQIVLDTMLAFYTVSKCSSITPNLFPTVVAESVSGSFQEAFKHLKENIISTKNPEEIXXXXXXXXXXXXAVGFQQNSAMDIRATEKYMCSRFFIDYPDINVQRQKLESFLDSLVDSNYEIKINLLNVLYEVVSHSTVCLMTHERRQTLQMINSLSQNILSE 6857
            F VLS+EQV+RL  ++ + + +        P +++  R ++  ++R+++E  + ++DVRL+G+AA  +L+ +    +++L++IF V L   T  Q +KN +   L+D L   +N +         I    +K+ Y+QKM +V CN   +SD WSLISL      N  VELKF+D ++RQ+EF++DSFQI LD++L FY  S+ + +     PT++ ESV G F  A  HL+  II T+NPEEI GGGLLKYC LL  GF+  S  ++++ ++YMCSRFFID+ DI+ Q++KLES+L +      + K + L  L+ VV+ STVCLM HERRQTL +I  L+  +L+E
Sbjct:   13 FSVLSWEQVQRLDLILTETIPIH--GRGNFPTLQMKPRQIVTAVRRRMREKSIHVRDVRLNGSAASHVLHGDSGLGYKDLDLIFRVELKGETEFQIVKNIVLDCLLDFLPDGVNKEK--------ITPLTLKEAYVQKMVKV-CN---DSDRWSLISLSNNRGKN--VELKFVDSLRRQFEFSVDSFQIKLDSLLLFYECSE-NPMAKTFHPTIIGESVYGDFAAALDHLRNKIICTRNPEEIRGGGLLKYCHLLVRGFRAASESEMKSLQRYMCSRFFIDFSDISEQQRKLESYLQNHFVGLEDRKYDYLTTLHSVVNESTVCLMGHERRQTLGLIAMLAVRVLAE 342          
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Zebrafish
Match: tent5ba (terminal nucleotidyltransferase 5ba [Source:ZFIN;Acc:ZDB-GENE-061110-129])

HSP 1 Score: 239.58 bits (610), Expect = 7.602e-69
Identity = 143/348 (41.09%), Postives = 224/348 (64.37%), Query Frame = 3
Query: 5814 RFQVLSYEQVKRLHRVIEKPLKLKPVSHSVLPVIEVSLRALLGEIKRKLKEVDVVIKDVRLDGTAAGCILNLNPNDDFRELNVIFTVSLHDMTSMQKIKNTIFSLLIDLLKKTLNSKPESLKHNFLINEELIKDNYIQKMTRVLCNQESNSDCWSLISLGTLEIGNETVELKFIDKMKRQYEFTIDSFQIVLDTMLAFYTVSKCSSITPNLFPTVVAESVSGSFQEAFKHLKENIISTKNPEEIXXXXXXXXXXXXAVGFQQNSAMDIRATEKYMCSRFFIDYPDINVQRQKLESFLDSLVDSNYEIKINLLNVLYEVVSHSTVCLMTHERRQTLQMINSLSQNILSE 6857
            RF VLS+EQV+RL  ++ + + +        P + V  R ++  ++ +L+E  + ++DVRL+G+AA  +L+ +    +++L++IF VSL D  + + +K+ +   L+D L       PE +     I+   +K+ Y+QK+ +V CN   ++D WSLISL      N  VELKF+D ++RQ+EF++DSFQIVLD++L F   S+ + ++    PTV+ ES+ G+F+EA  HL    I+T+NPEEI GGGLLKYC LL  GF+  S  ++++ ++YMCSRFFID+PDI  Q++KLE++L +        + + L  LY VV+ STVCLM HERRQTL +I+ L+  +L+E
Sbjct:   12 RFCVLSWEQVQRLDSILGETVPVH--GRGNFPTLSVQPRQIVQVVRARLEERGITVRDVRLNGSAASHVLHQDTGLGYKDLDLIFGVSLSDDQAFRVVKDVVLDSLLDFL-------PEGVSKE-RISALTLKEAYVQKLVKV-CN---DTDRWSLISLSNNTGKN--VELKFVDSLRRQFEFSVDSFQIVLDSLLLFDRCSE-TPMSECFHPTVLGESMYGNFEEALGHLCNKAIATRNPEEIRGGGLLKYCHLLVRGFRPTSESEMKSLQRYMCSRFFIDFPDIGEQQRKLEAYLQNHFAGMEHKRYDCLVTLYHVVNESTVCLMGHERRQTLNLISMLALRVLAE 342          
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Zebrafish
Match: tent5ab (terminal nucleotidyltransferase 5Ab [Source:ZFIN;Acc:ZDB-GENE-071004-35])

HSP 1 Score: 227.639 bits (579), Expect = 7.804e-65
Identity = 138/349 (39.54%), Postives = 213/349 (61.03%), Query Frame = 3
Query: 5811 NRFQVLSYEQVKRLHRVIEKPLKLKPVSHSVLPVIEVSLRALLGEIKRKLKEVDVVIKDVRLDGTAAGCILNLNPNDDFRELNVIFTVSLHDMTSMQKIKNTIFSLLIDLLKKTLNSKPESLKHNFLINEELIKDNYIQKMTRVLCNQESNSDCWSLISLGTLEIGNETVELKFIDKMKRQYEFTIDSFQIVLDTMLAFYTVSKCSSITPNLFPTVVAESVSGSFQEAFKHLKENIISTKNPEEIXXXXXXXXXXXXAVGFQQNSAMDIRATEKYMCSRFFIDYPDINVQRQKLESFLDSLVDSNYEIKINLLNVLYEVVSHSTVCLMTHERRQTLQMINSLSQNILSE 6857
            N   VL++EQVKRL  ++ + + +        P +E+  R ++  ++ +++E  + +++VRL+G+AA  +L+ +    +++L++IF   L      Q +K+ +   L+D L + +N +         I    +K+ Y+QKM +V CN   +SD WSLISL       + VELKF+D ++RQ+EF++DSFQI LD++L FY  S+ + +     P++V ESV G F  A  HL+  +I T+NPEEI GGGLLKYC LL  GF+  S  +++  E+YMCSRFFID+ D+  QR+KLES+L +        K   L  L+ VV+ STVCLM HERRQTL +I  L+  +L+E
Sbjct:    6 NNLCVLNWEQVKRLDAILTESIPIH--GKWNFPTLEMKPRDIVKVVRCRMEERKIHVREVRLNGSAASHVLHEDSGLGYKDLDLIFCADLKGEVEFQTVKDIVLDSLLDFLPEGVNKEK--------ITPVTLKEAYVQKMVKV-CN---DSDRWSLISLSN--NSGKNVELKFVDSLRRQFEFSVDSFQIRLDSLLLFYECSE-NPMAETFHPSIVGESVYGDFSVALDHLQRKLICTRNPEEIRGGGLLKYCHLLVRGFRAASEAEMKLLERYMCSRFFIDFSDVAEQRRKLESYLQNHFVGLENRKYEYLTTLHSVVNESTVCLMGHERRQTLSLITMLAVRVLAE 337          
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Zebrafish
Match: tent5ab (terminal nucleotidyltransferase 5Ab [Source:ZFIN;Acc:ZDB-GENE-071004-35])

HSP 1 Score: 227.639 bits (579), Expect = 7.804e-65
Identity = 138/349 (39.54%), Postives = 213/349 (61.03%), Query Frame = 3
Query: 5811 NRFQVLSYEQVKRLHRVIEKPLKLKPVSHSVLPVIEVSLRALLGEIKRKLKEVDVVIKDVRLDGTAAGCILNLNPNDDFRELNVIFTVSLHDMTSMQKIKNTIFSLLIDLLKKTLNSKPESLKHNFLINEELIKDNYIQKMTRVLCNQESNSDCWSLISLGTLEIGNETVELKFIDKMKRQYEFTIDSFQIVLDTMLAFYTVSKCSSITPNLFPTVVAESVSGSFQEAFKHLKENIISTKNPEEIXXXXXXXXXXXXAVGFQQNSAMDIRATEKYMCSRFFIDYPDINVQRQKLESFLDSLVDSNYEIKINLLNVLYEVVSHSTVCLMTHERRQTLQMINSLSQNILSE 6857
            N   VL++EQVKRL  ++ + + +        P +E+  R ++  ++ +++E  + +++VRL+G+AA  +L+ +    +++L++IF   L      Q +K+ +   L+D L + +N +         I    +K+ Y+QKM +V CN   +SD WSLISL       + VELKF+D ++RQ+EF++DSFQI LD++L FY  S+ + +     P++V ESV G F  A  HL+  +I T+NPEEI GGGLLKYC LL  GF+  S  +++  E+YMCSRFFID+ D+  QR+KLES+L +        K   L  L+ VV+ STVCLM HERRQTL +I  L+  +L+E
Sbjct:    6 NNLCVLNWEQVKRLDAILTESIPIH--GKWNFPTLEMKPRDIVKVVRCRMEERKIHVREVRLNGSAASHVLHEDSGLGYKDLDLIFCADLKGEVEFQTVKDIVLDSLLDFLPEGVNKEK--------ITPVTLKEAYVQKMVKV-CN---DSDRWSLISLSN--NSGKNVELKFVDSLRRQFEFSVDSFQIRLDSLLLFYECSE-NPMAETFHPSIVGESVYGDFSVALDHLQRKLICTRNPEEIRGGGLLKYCHLLVRGFRAASEAEMKLLERYMCSRFFIDFSDVAEQRRKLESYLQNHFVGLENRKYEYLTTLHSVVNESTVCLMGHERRQTLSLITMLAVRVLAE 337          
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Zebrafish
Match: tent5c (terminal nucleotidyltransferase 5C [Source:NCBI gene;Acc:327154])

HSP 1 Score: 227.254 bits (578), Expect = 1.321e-64
Identity = 141/345 (40.87%), Postives = 214/345 (62.03%), Query Frame = 3
Query: 5823 VLSYEQVKRLHRVIEKPLKLKPVSHSVLPVIEVSLRALLGEIKRKLKEVDVVIKDVRLDGTAAGCILNLNPNDDFRELNVIFTVSLHDMTSMQKIKNTIFSLLIDLLKKTLNSKPESLKHNFLINEELIKDNYIQKMTRVLCNQESNSDCWSLISLGTLEIGNETVELKFIDKMKRQYEFTIDSFQIVLDTMLAFYTVSKCSSITPNLFPTVVAESVSGSFQEAFKHLKENIISTKNPEEIXXXXXXXXXXXXAVGFQQNSAMDIRATEKYMCSRFFIDYPDINVQRQKLESFLDSLVDSNYEIKINLLNVLYEVVSHSTVCLMTHERRQTLQMINSLSQNILSE 6857
            VL++EQV RL+ V+ + + +        P +EV L+ ++  ++ +L+   +++KDVRL+G+ A  +L  +    +++L+VIF V L      Q IK+ + S L+D L + +N +         I    +K+ Y+QK+ +V  +Q    D WSLISL         VELKF+D ++RQ+EF++DSFQI+LD++L++Y +S+ + ++ +  PTVV ES+ G F EA  HL    I+TK PEEI GGGLLKYC LL   F+     + +A E+YMCSRFFID+PDI  Q++KLE++L S        K N L +L  VV+ STVCLM HERRQTL +I+  +  +L+E
Sbjct:   20 VLTWEQVSRLNDVLTEAVPVH--GRGNFPTLEVRLKDIVQIVRNRLELRGIMVKDVRLNGSTASHVLVQDIGWSYKDLDVIFRVDLPREEEFQLIKDVVLSTLLDFLPEGVNKEK--------ITPMTLKEAYVQKLVKVYTDQ----DRWSLISLSN--NNGRNVELKFVDSIRRQFEFSVDSFQIILDSVLSYYDLSE-NPMSQHFHPTVVGESMYGDFVEALGHLTNKTIATKRPEEIRGGGLLKYCNLLVREFKPTDPDEFKALERYMCSRFFIDFPDIVEQQRKLEAYLQSHFIGEERNKYNYLMILRRVVNESTVCLMGHERRQTLNLISLTAFRVLAE 347          
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Xenopus
Match: tent5b (terminal nucleotidyltransferase 5B [Source:NCBI gene;Acc:549960])

HSP 1 Score: 243.047 bits (619), Expect = 5.499e-70
Identity = 146/393 (37.15%), Postives = 237/393 (60.31%), Query Frame = 3
Query: 5775 SSTVSKIDSVGPNRFQVLSYEQVKRLHRVIEKPLKLKPVSHSVLPVIEVSLRALLGEIKRKLKEVDVVIKDVRLDGTAAGCILNLNPNDDFRELNVIFTVSLHDMTSMQKIKNTIFSLLIDLLKKTLNSKPESLKHNFLINEELIKDNYIQKMTRVLCNQESNSDCWSLISLGTLEIGNETVELKFIDKMKRQYEFTIDSFQIVLDTMLAFYTVSKCSS--ITPNLFPTVVAESVSGSFQEAFKHLKENIISTKNPEEIXXXXXXXXXXXXAVGFQQNSAMDIRATEKYMCSRFFIDYPDINVQRQKLESFLDSLVDSNYEIKINLLNVLYEVVSHSTVCLMTHERRQTLQMINSLSQNILSEIEIKKSTVQLDDLSSQNWVLDQVFYGTFYF 6947
            SS +S+     P RF VLS+ QV+RL  ++ + + +        P +    R L+  ++ +L++  +++ +VRL+G+AA  +L+ +    +++L++IF V L    + Q +K+ + + L+D L   +N +         I    +K+ Y+QK+ +V     + SD WSLISL       + +ELKF+D ++RQ+EF++DSFQI+LD+ML F   S+CS   ++ +  PTV  ES+ G F+EA  HL+  II+T+NPEEI GGGLLKYC LL  GF+  S +D++  ++YMCSR+FID+PDI  Q++KL+ +L        + + + L  L++VV+ STVCLM HERRQTL +I SL+ ++LSE    ++             + +V Y ++YF
Sbjct:    2 SSALSQASPTAP-RFSVLSWPQVRRLDAILCESVPIH--GRGNFPTLSCRPRDLVQVVRSRLEQKGILVHNVRLNGSAASYVLHHDSGLGYKDLDLIFMVDLKGPDAFQVVKHAVLNCLLDFLPSGVNKEK--------ITPMTLKEAYVQKLVKVC----TESDRWSLISLSN--NSGKNMELKFVDSLRRQFEFSVDSFQIILDSMLMF---SQCSENPMSQSFHPTVTGESMYGDFEEAMDHLRNRIIATRNPEEIRGGGLLKYCNLLVRGFRPKSEVDMKTMQRYMCSRYFIDFPDIREQQRKLKCYLQDHFVGMEDKRYDYLMTLHQVVNESTVCLMGHERRQTLALIASLAVHVLSEQNHPQAVPTFTCYYQPAPYIGEVNYNSYYF 374          
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Xenopus
Match: TENT5A (terminal nucleotidyltransferase 5A [Source:NCBI gene;Acc:100490270])

HSP 1 Score: 240.736 bits (613), Expect = 4.239e-69
Identity = 149/365 (40.82%), Postives = 223/365 (61.10%), Query Frame = 3
Query: 5772 SSSTVSKIDSVGPNRFQVLSYEQVKRLHRVIEKPLKLKPVSHSVLPVIEVSLRALLGEIKRKLKEVDVVIKDVRLDGTAAGCILNLNPNDDFRELNVIFTVSLHDMTSMQKIKNTIFSLLIDLLKKTLNSKPESLKHNFLINEELIKDNYIQKMTRVLCNQESNSDCWSLISLGTLEIGNETVELKFIDKMKRQYEFTIDSFQIVLDTMLAFYTVSKCSSITPNLFPTVVAESVSGSFQEAFKHLKENIISTKNPEEIXXXXXXXXXXXXAVGFQQNSAMDIRATEKYMCSRFFIDYPDINVQRQKLESFLDSLVDSNYEIKINLLNVLYEVVSHSTVCLMTHERRQTLQMINSLSQNILSEIEI 6866
            S       DS   N   VLS+EQV+RL  ++ + + +        P +E+    ++  ++ +L+E  + ++DVRL+G+AA  IL+ +    +++L++IF   L      Q +K+ +   L+D L + +N +         I    +K+ Y+QKM +V CN   +SD WSLISL      N  VELKF+D ++RQ+EF++DSFQI LD++L FY  S+ + +T    PT++ ESV G FQEAF HL   II+T+NPEEI GGGLLKYC LL  GF+  S  ++++ ++YMCSRFFID+ DI  Q++KLES+L +      + K + L  L+ VV+ STVCLM HERRQTL +I  L+  +L+E  I
Sbjct:   10 SGICTGSCDSANCN---VLSWEQVQRLDAILTETIPIH--GRGNFPTLEMKPSQIVKVVRSRLEEKGIRVRDVRLNGSAASHILHEDSGLGYKDLDLIFCTDLRGEAEFQTVKDVVLDCLLDFLPEGVNKEK--------ITPLTLKEAYVQKMVKV-CN---DSDRWSLISLSNNHGKN--VELKFMDSLRRQFEFSVDSFQIKLDSLLLFYECSQ-NPMTETFHPTIIGESVYGDFQEAFDHLCNKIIATRNPEEIRGGGLLKYCNLLVRGFRAASETEMKSLQRYMCSRFFIDFSDIGEQQRKLESYLQNHFVGLEDRKYDYLMTLHGVVNESTVCLMGHERRQTLSLITMLAIRVLAEQNI 354          
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Xenopus
Match: ttk (TTK protein kinase [Source:Xenbase;Acc:XB-GENE-953775])

HSP 1 Score: 228.794 bits (582), Expect = 4.471e-65
Identity = 133/348 (38.22%), Postives = 223/348 (64.08%), Query Frame = 3
Query: 5823 VLSYEQVKRLHRVIEKPLKLKPVSHSVLPVIEVSLRALLGEIKRKLKEVDVVIKDVRLDGTAAGCILNLNPNDDFRELNVIFTVSLHDMTSMQKIKNTIFSLLIDLLKKTLNSKPESLKHNFLINEELIKDNYIQKMTRVLCNQESNSDCWSLISLGTLEIGNETVELKFIDKMKRQYEFTIDSFQIVLDTMLAFYTVSKCSSITPNLFPTVVAESVSGSFQEAFKHLKENIISTKNPEEIXXXXXXXXXXXXAVGFQQNSAMDIRATEKYMCSRFFIDYPDINVQRQKLESFLDSLVDSNYEIKINLLNVLYEVVSHSTVCLMTHERRQTLQMINSLSQNILSEIEI 6866
            VL++EQV RL+  + + + +        P ++++L+ ++ +++ +L+E  + ++DVRL+G+AA  +L  +    +++L++IF VSL      Q +K+ +  LL++ L + +N +         I+   +K+ Y+QK+ +V     +++D WSLISL   +  N  +ELKF+  ++RQ+EF++DSFQI+LD++L ++  S+ + ++ +  PTV+ ES+ G F+ AF HL+  +ISTKNPEEI GGGL+KY  LL   F+      I++ E+YMCSRFFID+ DI  Q++KLES+L +      + K + L +L  VV+ STVCLM HERRQTL +I+ L+  +L+E  I
Sbjct:   18 VLTWEQVSRLNSFLTEVVPIH--GRGNFPTLKITLKDIVQKVRSRLEEAGIKVRDVRLNGSAASHVLVKDNGLGYKDLDLIFGVSLSSEAEFQLVKDVVIGLLLNFLPEGVNKEK--------ISPLTLKEAYVQKLVKVF----TDADRWSLISLSNKDGRN--IELKFVTSIRRQFEFSVDSFQIILDSLLFYHDCSE-NPMSEHFHPTVIGESMYGDFEAAFHHLRNKLISTKNPEEIRGGGLMKYSNLLVRDFKPADKEQIKSLERYMCSRFFIDFSDIFEQQRKLESYLQNHFMGEEKSKYDYLMILRRVVNESTVCLMGHERRQTLNLISLLALRVLAEQNI 348          
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Xenopus
Match: TENT5D (terminal nucleotidyltransferase 5D [Source:HGNC Symbol;Acc:HGNC:28399])

HSP 1 Score: 223.402 bits (568), Expect = 4.326e-63
Identity = 144/393 (36.64%), Postives = 228/393 (58.02%), Query Frame = 3
Query: 5814 RFQVLSYEQVKRLHRVIEKPLKLKPVSHSVLPVIEVSLRALLGEIKRKLKEVDVVIKDVRLDGTAAGCILNLNPNDDFRELNVIFTVSLHDMTSMQKIKNTIFSLLIDLLKKTLNSKPESLKHNFLINEELIKDNYIQKMTRVLCNQESNSDCWSLISLGTLEIGNETVELKFIDKMKRQYEFTIDSFQIVLDTMLAFYTVSKCSSITPNLFPTVVAESVSGSFQEAFKHLKENIISTKNPEEIXXXXXXXXXXXXAVGFQQNSAMDIRATEKYMCSRFFIDYPDINVQRQKLESFLDSLVDSNYEIKINLLNVLYEVVSHSTVCLMTHERRQTLQMINSLSQNILSEIEIKKSTVQ----------LDDLSSQNWVLDQ----VFYGTFYFP 6950
            RF  L+++Q+  L +V+ + + +        P +EV  + ++  ++ +L +  +++KD+RL+G+ A  IL        ++L++IF V L      Q +K  +   L+D L K +N +         I    +K+ Y+QKM +V     ++ D WSLISL       + VELKF++ ++RQ+EF++DSFQI+LD++L+ YT  K + +  +  PTVVAES+ G F EA +HL+  +I+T+NPEEI GGGLLKY  LL   F+  S  +I++ E+YMCSRFFID+PD+  Q++K+ES+L +      + K + L  L  VV+ STVCLM+HERRQTL MI  L+  +L E  I  +T            + D +  N+ + Q    ++Y   Y P
Sbjct:   11 RFSNLTWDQIIILDQVLTEVIPIH--GRGNFPTMEVKPKDIIHVVREQLLKKKIIVKDIRLNGSTASHILIKQNGTSCKDLDIIFGVELPGEQEFQTVKEIVLDSLLDFLPKCVNKEK--------ITALTMKEAYVQKMVKV----STDHDRWSLISLSN--NSGKNVELKFVNSLRRQFEFSVDSFQIILDSILSVYTDDK-NELKQDSHPTVVAESMYGDFMEAMEHLRCKLIATRNPEEIRGGGLLKYSNLLVRDFKPASEAEIKSLERYMCSRFFIDFPDVTEQQRKIESYLRNHFIGEEKSKYDYLMTLRSVVNESTVCLMSHERRQTLNMITILALKVLGEQNIIPNTANVTCFYQPAPYMSDRNFSNYYIAQGQPAIYYQPLYLP 386          
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Xenopus
Match: ENSXETT00000040456.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:8:87387561:87390644:-1 gene:ENSXETG00000021299.1 transcript:ENSXETT00000040456.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 94.3597 bits (233), Expect = 1.861e-18
Identity = 74/217 (34.10%), Postives = 112/217 (51.61%), Query Frame = -2
Query:  713 STGIDGIKYNDIAILDPEGKLLTLLYNKIITENI----MPDVWKSFKTLMIPKPDKGDKYNXXXXXXXXXXXSVVYKIFASILARRLTSWVNRNNLLHIGQKGGSVHEGCVEHNSVLSSCLEHSKYSKDTPIIIAFLDIKDAFGSVPHDYMWKILRHIGVGEKFTNTLKLLYTETSSYYTCDPIVTPNIPIKQGVKQGCPLSMILFAIAINPVLQAV 1351
            + G DG+    I I     KLLT +  K+  E +     P+       +++PK  +G   +L  S+ PISLL+   KIFA +LARRL+  + +  ++H  Q G    +    +   L   L H+   +    I A LDI  AF +V   Y+W++L H G G+K+   ++LLY    +    + + TP   + +G +QGCPLS +LFAIAI P  QAV
Sbjct:   96 AAGADGL---PIEIYKRHSKLLTPMLLKLFKEAVQLGQFPESLYEAAIVLLPK--QGKDPHLCESFRPISLLTADVKIFAKVLARRLSRVITK--IIHPDQIGFIPAKTAALNTRRLYLNLAHASAGQGAKAIAA-LDITKAFDTVEWPYLWQVLTHFGFGKKYIQMVQLLYKYPVASIRINSLTTPAFALSRGTRQGCPLSPLLFAIAIEPFAQAV 304          
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Mouse
Match: Tent5c (terminal nucleotidyltransferase 5C [Source:MGI Symbol;Acc:MGI:1921895])

HSP 1 Score: 239.195 bits (609), Expect = 8.359e-69
Identity = 143/354 (40.40%), Postives = 225/354 (63.56%), Query Frame = 3
Query: 5817 FQVLSYEQVKRLHRVIEKPLKLKPVSHSVLPVIEVSLRALLGEIKRKLKEVDVVIKDVRLDGTAAGCILNLNPNDDFRELNVIFTVSLHDMTSMQKIKNTIFSLLIDLLKKTLNSKPESLKHNFLINEELIKDNYIQKMTRVLCNQESNSDCWSLISLGTLEIGNETVELKFIDKMKRQYEFTIDSFQIVLDTMLAFYTVSKCSSITPNLFPTVVAESVSGSFQEAFKHLKENIISTKNPEEIXXXXXXXXXXXXAVGFQQNSAMDIRATEKYMCSRFFIDYPDINVQRQKLESFLDSLVDSNYEIKINLLNVLYEVVSHSTVCLMTHERRQTLQMINSLSQNILSEIEIKKST 6878
            F VL+++QV RLH V+ + + +        P +E++L+ ++  ++ +L+E  + ++DVRL+G+AAG +L  +     ++L++IF V+L      Q +++ +   L++ L + +N     LK    I+   +K+ Y+QK+ +V     +++D WSLISL      N  VELKF+D ++RQ+EF++DSFQI+LD++L FY  S  + I+ +  PTV+ ES+ G F+EAF HL+  +I+TKNPEEI GGGLLKY  LL   F+     +I+  E+YMCSRFFID+PDI  Q++KLE++L +        K + L +L  VV+ STVCLM HERRQTL +I+ L+  +L+E  I  S 
Sbjct:   14 FSVLNWDQVSRLHEVLTEVVPIH--GRGNFPTLEITLKDIVQTVRGRLEEAGINVQDVRLNGSAAGHVLVKDNGLGCKDLDLIFHVALPTEAEFQLVRDVVLCSLLNFLPEGVNK----LK----ISPVTLKEAYVQKLVKVC----TDTDRWSLISLSNKNGRN--VELKFVDSIRRQFEFSVDSFQIILDSLLFFYDCSG-NPISEHFHPTVIGESMYGDFEEAFDHLQNRLIATKNPEEIRGGGLLKYSNLLVRDFRPADQEEIKTLERYMCSRFFIDFPDILEQQRKLETYLQNHFSDEERSKYDYLMILRRVVNESTVCLMGHERRQTLNLISLLALRVLAEQNIIPSA 350          
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Mouse
Match: Tent5a (terminal nucleotidyltransferase 5A [Source:MGI Symbol;Acc:MGI:2670964])

HSP 1 Score: 234.572 bits (597), Expect = 9.221e-67
Identity = 141/345 (40.87%), Postives = 217/345 (62.90%), Query Frame = 3
Query: 5823 VLSYEQVKRLHRVIEKPLKLKPVSHSVLPVIEVSLRALLGEIKRKLKEVDVVIKDVRLDGTAAGCILNLNPNDDFRELNVIFTVSLHDMTSMQKIKNTIFSLLIDLLKKTLNSKPESLKHNFLINEELIKDNYIQKMTRVLCNQESNSDCWSLISLGTLEIGNETVELKFIDKMKRQYEFTIDSFQIVLDTMLAFYTVSKCSSITPNLFPTVVAESVSGSFQEAFKHLKENIISTKNPEEIXXXXXXXXXXXXAVGFQQNSAMDIRATEKYMCSRFFIDYPDINVQRQKLESFLDSLVDSNYEIKINLLNVLYEVVSHSTVCLMTHERRQTLQMINSLSQNILSE 6857
            VL++EQV+RL  ++ + + +        P +E+    ++  ++R+L+E  + ++DVRL+G+AA  +L+ +    +++L++IF   L      Q +K+ +   L+D L + +N +         I    +K+ Y+QKM +V CN   +SD WSLISL       + VELKF+D ++RQ+EF++DSFQI LD++L FY  S+ + +T    PT++ ESV G F EAF HL   II+T+NPEEI GGGLLKYC LL  GF+  S  +I+  ++YMCSRFFID+ DI  Q++KLES+L +      + K + L  L+ VV+ STVCLM HERRQTL +I  L+  +L++
Sbjct:   51 VLNWEQVQRLDGILSETIPIH--GRGNFPTLELQPSLIVKVVRRRLEEKGIGVRDVRLNGSAASHVLHQDSGLGYKDLDLIFCADLRGEEEFQTVKDVVLDCLLDFLPEGVNKEK--------ITPLTLKEAYVQKMVKV-CN---DSDRWSLISLSN--NSGKNVELKFVDSLRRQFEFSVDSFQIKLDSLLLFYECSE-NPMTETFHPTIIGESVYGDFHEAFDHLCNKIIATRNPEEIRGGGLLKYCNLLVRGFRPASE-EIKTLQRYMCSRFFIDFSDIGEQQRKLESYLQNHFVGLEDRKYDYLMTLHGVVNESTVCLMGHERRQTLNLITMLAIRVLAD 377          
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Mouse
Match: Tent5a (terminal nucleotidyltransferase 5A [Source:MGI Symbol;Acc:MGI:2670964])

HSP 1 Score: 234.958 bits (598), Expect = 1.185e-66
Identity = 141/345 (40.87%), Postives = 217/345 (62.90%), Query Frame = 3
Query: 5823 VLSYEQVKRLHRVIEKPLKLKPVSHSVLPVIEVSLRALLGEIKRKLKEVDVVIKDVRLDGTAAGCILNLNPNDDFRELNVIFTVSLHDMTSMQKIKNTIFSLLIDLLKKTLNSKPESLKHNFLINEELIKDNYIQKMTRVLCNQESNSDCWSLISLGTLEIGNETVELKFIDKMKRQYEFTIDSFQIVLDTMLAFYTVSKCSSITPNLFPTVVAESVSGSFQEAFKHLKENIISTKNPEEIXXXXXXXXXXXXAVGFQQNSAMDIRATEKYMCSRFFIDYPDINVQRQKLESFLDSLVDSNYEIKINLLNVLYEVVSHSTVCLMTHERRQTLQMINSLSQNILSE 6857
            VL++EQV+RL  ++ + + +        P +E+    ++  ++R+L+E  + ++DVRL+G+AA  +L+ +    +++L++IF   L      Q +K+ +   L+D L + +N +         I    +K+ Y+QKM +V CN   +SD WSLISL       + VELKF+D ++RQ+EF++DSFQI LD++L FY  S+ + +T    PT++ ESV G F EAF HL   II+T+NPEEI GGGLLKYC LL  GF+  S  +I+  ++YMCSRFFID+ DI  Q++KLES+L +      + K + L  L+ VV+ STVCLM HERRQTL +I  L+  +L++
Sbjct:   70 VLNWEQVQRLDGILSETIPIH--GRGNFPTLELQPSLIVKVVRRRLEEKGIGVRDVRLNGSAASHVLHQDSGLGYKDLDLIFCADLRGEEEFQTVKDVVLDCLLDFLPEGVNKEK--------ITPLTLKEAYVQKMVKV-CN---DSDRWSLISLSN--NSGKNVELKFVDSLRRQFEFSVDSFQIKLDSLLLFYECSE-NPMTETFHPTIIGESVYGDFHEAFDHLCNKIIATRNPEEIRGGGLLKYCNLLVRGFRPASE-EIKTLQRYMCSRFFIDFSDIGEQQRKLESYLQNHFVGLEDRKYDYLMTLHGVVNESTVCLMGHERRQTLNLITMLAIRVLAD 396          
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Mouse
Match: Tent5d (terminal nucleotidyltransferase 5D [Source:MGI Symbol;Acc:MGI:2685223])

HSP 1 Score: 228.409 bits (581), Expect = 5.266e-65
Identity = 143/355 (40.28%), Postives = 214/355 (60.28%), Query Frame = 3
Query: 5814 RFQVLSYEQVKRLHRVIEKPLKLKPVSHSVLPVIEVSLRALLGEIKRKLKEVDVVIKDVRLDGTAAGCILNLNPNDDFRELNVIFTVSLHDMTSMQKIKNTIFSLLIDLLKKTLNSKPESLKHNFLINEELIKDNYIQKMTRVLCNQESNSDCWSLISLGTLEIGNETVELKFIDKMKRQYEFTIDSFQIVLDTMLAFYTVSKCSSITPNLFPTVVAESVSGSFQEAFKHLKENIISTKNPEEIXXXXXXXXXXXXAVGFQQNSAMDIRATEKYMCSRFFIDYPDINVQRQKLESFLDSLVDSNYEIKINLLNVLYEVVSHSTVCLMTHERRQTLQMINSLSQNILSEIEIKKST 6878
            RF  L+++ +  L RV+ + + +        P +EV  + ++  +K +L +  +V+KD RL+G+ A  IL  +    +++L++IF V +        +K+ + S L D L K +  +  +LK         +K+ Y+QKM ++ CN   N D WSLISL       + VELKF++ ++RQ+EF++DSFQI+LD+ML FY+V   + +T    P VVAES+ G FQEA  HLK  +IST+ PEEI GGGLLKY  LL   F+     +I+  E+YMCSRFFID+PD+  Q++K+ES+L +      + K + L  L+ VV+ STVCLM +ERRQTL MI  L+  +L E  I  ST
Sbjct:    5 RFSNLTWDHIVTLDRVLHEVIPIH--GRGNFPTLEVKPKDIIHIVKDQLIKQGIVVKDTRLNGSTASYILASHNGISYKDLDIIFGVDIPSDEEFHVVKDAVLSCLFDFLPKGVKKEKITLK--------TMKEAYVQKMVKI-CN---NHDRWSLISLSN--NNGKNVELKFVNSLRRQFEFSVDSFQILLDSMLDFYSVPN-AKLTKESCPVVVAESMYGDFQEAMIHLKYKLISTRKPEEIRGGGLLKYSNLLVRDFKPACQTEIKTLERYMCSRFFIDFPDVAEQQKKIESYLHNHFIGEAKNKYDYLMTLHGVVNQSTVCLMGYERRQTLNMITLLALKVLGEQNILPST 342          
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Mouse
Match: Tent5d (terminal nucleotidyltransferase 5D [Source:MGI Symbol;Acc:MGI:2685223])

HSP 1 Score: 228.409 bits (581), Expect = 5.266e-65
Identity = 143/355 (40.28%), Postives = 214/355 (60.28%), Query Frame = 3
Query: 5814 RFQVLSYEQVKRLHRVIEKPLKLKPVSHSVLPVIEVSLRALLGEIKRKLKEVDVVIKDVRLDGTAAGCILNLNPNDDFRELNVIFTVSLHDMTSMQKIKNTIFSLLIDLLKKTLNSKPESLKHNFLINEELIKDNYIQKMTRVLCNQESNSDCWSLISLGTLEIGNETVELKFIDKMKRQYEFTIDSFQIVLDTMLAFYTVSKCSSITPNLFPTVVAESVSGSFQEAFKHLKENIISTKNPEEIXXXXXXXXXXXXAVGFQQNSAMDIRATEKYMCSRFFIDYPDINVQRQKLESFLDSLVDSNYEIKINLLNVLYEVVSHSTVCLMTHERRQTLQMINSLSQNILSEIEIKKST 6878
            RF  L+++ +  L RV+ + + +        P +EV  + ++  +K +L +  +V+KD RL+G+ A  IL  +    +++L++IF V +        +K+ + S L D L K +  +  +LK         +K+ Y+QKM ++ CN   N D WSLISL       + VELKF++ ++RQ+EF++DSFQI+LD+ML FY+V   + +T    P VVAES+ G FQEA  HLK  +IST+ PEEI GGGLLKY  LL   F+     +I+  E+YMCSRFFID+PD+  Q++K+ES+L +      + K + L  L+ VV+ STVCLM +ERRQTL MI  L+  +L E  I  ST
Sbjct:    5 RFSNLTWDHIVTLDRVLHEVIPIH--GRGNFPTLEVKPKDIIHIVKDQLIKQGIVVKDTRLNGSTASYILASHNGISYKDLDIIFGVDIPSDEEFHVVKDAVLSCLFDFLPKGVKKEKITLK--------TMKEAYVQKMVKI-CN---NHDRWSLISLSN--NNGKNVELKFVNSLRRQFEFSVDSFQILLDSMLDFYSVPN-AKLTKESCPVVVAESMYGDFQEAMIHLKYKLISTRKPEEIRGGGLLKYSNLLVRDFKPACQTEIKTLERYMCSRFFIDFPDVAEQQKKIESYLHNHFIGEAKNKYDYLMTLHGVVNQSTVCLMGYERRQTLNMITLLALKVLGEQNILPST 342          
BLAST of Terminal nucleotidyltransferase 5C vs. UniProt/SwissProt
Match: sp|Q5XIV0|TET5C_RAT (Terminal nucleotidyltransferase 5C OS=Rattus norvegicus OX=10116 GN=Tent5c PE=2 SV=1)

HSP 1 Score: 239.58 bits (610), Expect = 4.874e-68
Identity = 145/356 (40.73%), Postives = 226/356 (63.48%), Query Frame = 3
Query: 5817 FQVLSYEQVKRLHRVIEKPLKLKPVSHSVLPVIEVSLRALLGEIKRKLKEVDVVIKDVRLDGTAAGCILNLNPNDDFRELNVIFTVSLHDMTSMQKIKNTIFSLLIDLLKKTLNSKPESLKHNFLINEELIKDNYIQKMTRVLCNQESNSDCWSLISLGTLEIGNETVELKFIDKMKRQYEFTIDSFQIVLDTMLAFYTVSKCSS--ITPNLFPTVVAESVSGSFQEAFKHLKENIISTKNPEEIXXXXXXXXXXXXAVGFQQNSAMDIRATEKYMCSRFFIDYPDINVQRQKLESFLDSLVDSNYEIKINLLNVLYEVVSHSTVCLMTHERRQTLQMINSLSQNILSEIEIKKST 6878
            F VL+++QV RLH V+ + + +        P +E++L+ ++  ++ +L+E  + ++DVRL+G+AAG +L  +     ++L++IF V+L      Q +++ +   L++ L + +N     LK    I+   +K+ Y+QK+ +V     +++D WSLISL      N  VELKF+D ++RQ+EF++DSFQI+LD++L FY    CSS  ++ +  PTVV ES+ G F+EAF HL+  +I+TKNPEEI GGGLLKY  LL   F+     +I+  E+YMCSRFFID+PDI  Q++KLE++L +        K + L +L  VV+ STVCLM HERRQTL +I+ L+  +L+E  I  S 
Sbjct:   14 FSVLNWDQVSRLHEVLTEVVPIH--GRGNFPTLEITLKDIVQTVRSRLEEAGIKVQDVRLNGSAAGHVLVKDNGLGCKDLDLIFHVALPTEAEFQLVRDVVLCSLLNFLPEGVNK----LK----ISPVTLKEAYVQKLVKVC----TDTDRWSLISLSNKNGRN--VELKFVDSIRRQFEFSVDSFQIILDSLLFFY---DCSSNPVSEHFHPTVVGESMYGDFEEAFDHLQNRLIATKNPEEIRGGGLLKYSNLLVRDFRPADQEEIKTLERYMCSRFFIDFPDILEQQRKLETYLQNHFADEERSKYDYLMILRRVVNESTVCLMGHERRQTLNLISLLALRVLAEQNIIPSA 350          
BLAST of Terminal nucleotidyltransferase 5C vs. UniProt/SwissProt
Match: sp|Q5VWP2|TET5C_HUMAN (Terminal nucleotidyltransferase 5C OS=Homo sapiens OX=9606 GN=TENT5C PE=1 SV=1)

HSP 1 Score: 239.195 bits (609), Expect = 5.574e-68
Identity = 143/354 (40.40%), Postives = 224/354 (63.28%), Query Frame = 3
Query: 5817 FQVLSYEQVKRLHRVIEKPLKLKPVSHSVLPVIEVSLRALLGEIKRKLKEVDVVIKDVRLDGTAAGCILNLNPNDDFRELNVIFTVSLHDMTSMQKIKNTIFSLLIDLLKKTLNSKPESLKHNFLINEELIKDNYIQKMTRVLCNQESNSDCWSLISLGTLEIGNETVELKFIDKMKRQYEFTIDSFQIVLDTMLAFYTVSKCSSITPNLFPTVVAESVSGSFQEAFKHLKENIISTKNPEEIXXXXXXXXXXXXAVGFQQNSAMDIRATEKYMCSRFFIDYPDINVQRQKLESFLDSLVDSNYEIKINLLNVLYEVVSHSTVCLMTHERRQTLQMINSLSQNILSEIEIKKST 6878
            F VL+++QV RLH V+ + + +        P +E++L+ ++  ++ +L+E  + + DVRL+G+AAG +L  +     ++L++IF V+L      Q +++ +   L++ L + +N     LK    I+   +K+ Y+QK+ +V     +++D WSLISL      N  VELKF+D ++RQ+EF++DSFQI+LD++L FY  S  + I+ +  PTV+ ES+ G F+EAF HL+  +I+TKNPEEI GGGLLKY  LL   F+     +I+  E+YMCSRFFID+PDI  Q++KLE++L +        K + L +L  VV+ STVCLM HERRQTL +I+ L+  +L+E  I  S 
Sbjct:   14 FSVLNWDQVSRLHEVLTEVVPIH--GRGNFPTLEITLKDIVQTVRSRLEEAGIKVHDVRLNGSAAGHVLVKDNGLGCKDLDLIFHVALPTEAEFQLVRDVVLCSLLNFLPEGVNK----LK----ISPVTLKEAYVQKLVKVC----TDTDRWSLISLSNKNGKN--VELKFVDSIRRQFEFSVDSFQIILDSLLFFYDCSN-NPISEHFHPTVIGESMYGDFEEAFDHLQNRLIATKNPEEIRGGGLLKYSNLLVRDFRPTDQEEIKTLERYMCSRFFIDFPDILEQQRKLETYLQNHFAEEERSKYDYLMILRRVVNESTVCLMGHERRQTLNLISLLALRVLAEQNIIPSA 350          
BLAST of Terminal nucleotidyltransferase 5C vs. UniProt/SwissProt
Match: sp|Q5SSF7|TET5C_MOUSE (Terminal nucleotidyltransferase 5C OS=Mus musculus OX=10090 GN=Tent5c PE=1 SV=1)

HSP 1 Score: 239.195 bits (609), Expect = 5.847e-68
Identity = 143/354 (40.40%), Postives = 225/354 (63.56%), Query Frame = 3
Query: 5817 FQVLSYEQVKRLHRVIEKPLKLKPVSHSVLPVIEVSLRALLGEIKRKLKEVDVVIKDVRLDGTAAGCILNLNPNDDFRELNVIFTVSLHDMTSMQKIKNTIFSLLIDLLKKTLNSKPESLKHNFLINEELIKDNYIQKMTRVLCNQESNSDCWSLISLGTLEIGNETVELKFIDKMKRQYEFTIDSFQIVLDTMLAFYTVSKCSSITPNLFPTVVAESVSGSFQEAFKHLKENIISTKNPEEIXXXXXXXXXXXXAVGFQQNSAMDIRATEKYMCSRFFIDYPDINVQRQKLESFLDSLVDSNYEIKINLLNVLYEVVSHSTVCLMTHERRQTLQMINSLSQNILSEIEIKKST 6878
            F VL+++QV RLH V+ + + +        P +E++L+ ++  ++ +L+E  + ++DVRL+G+AAG +L  +     ++L++IF V+L      Q +++ +   L++ L + +N     LK    I+   +K+ Y+QK+ +V     +++D WSLISL      N  VELKF+D ++RQ+EF++DSFQI+LD++L FY  S  + I+ +  PTV+ ES+ G F+EAF HL+  +I+TKNPEEI GGGLLKY  LL   F+     +I+  E+YMCSRFFID+PDI  Q++KLE++L +        K + L +L  VV+ STVCLM HERRQTL +I+ L+  +L+E  I  S 
Sbjct:   14 FSVLNWDQVSRLHEVLTEVVPIH--GRGNFPTLEITLKDIVQTVRGRLEEAGINVQDVRLNGSAAGHVLVKDNGLGCKDLDLIFHVALPTEAEFQLVRDVVLCSLLNFLPEGVNK----LK----ISPVTLKEAYVQKLVKVC----TDTDRWSLISLSNKNGRN--VELKFVDSIRRQFEFSVDSFQIILDSLLFFYDCSG-NPISEHFHPTVIGESMYGDFEEAFDHLQNRLIATKNPEEIRGGGLLKYSNLLVRDFRPADQEEIKTLERYMCSRFFIDFPDILEQQRKLETYLQNHFSDEERSKYDYLMILRRVVNESTVCLMGHERRQTLNLISLLALRVLAEQNIIPSA 350          
BLAST of Terminal nucleotidyltransferase 5C vs. UniProt/SwissProt
Match: sp|Q4R8X4|TET5C_MACFA (Terminal nucleotidyltransferase 5C OS=Macaca fascicularis OX=9541 GN=TENT5C PE=2 SV=1)

HSP 1 Score: 238.424 bits (607), Expect = 1.111e-67
Identity = 141/347 (40.63%), Postives = 222/347 (63.98%), Query Frame = 3
Query: 5817 FQVLSYEQVKRLHRVIEKPLKLKPVSHSVLPVIEVSLRALLGEIKRKLKEVDVVIKDVRLDGTAAGCILNLNPNDDFRELNVIFTVSLHDMTSMQKIKNTIFSLLIDLLKKTLNSKPESLKHNFLINEELIKDNYIQKMTRVLCNQESNSDCWSLISLGTLEIGNETVELKFIDKMKRQYEFTIDSFQIVLDTMLAFYTVSKCSSITPNLFPTVVAESVSGSFQEAFKHLKENIISTKNPEEIXXXXXXXXXXXXAVGFQQNSAMDIRATEKYMCSRFFIDYPDINVQRQKLESFLDSLVDSNYEIKINLLNVLYEVVSHSTVCLMTHERRQTLQMINSLSQNILSE 6857
            F VL+++QV RLH V+ + + +        P +E++L+ ++  ++ +L+E  + ++DVRL+G+AAG +L  +     ++L++IF V+L      Q +++ +   L++ L + +N     LK    I+   +K+ Y+QK+ +V     +++D WSLISL      N  VELKF+D ++RQ+EF++DSFQI+LD++L FY  S  + I+ +  PTV+ ES+ G F+EAF HL+  +I+TKNPEEI GGGLLKY  LL   F+     +I   E+YMCSRFFID+PDI  Q++KLE++L +        K + L +L  VV+ STVCLM HERRQTL +I+ L+  +L+E
Sbjct:   14 FSVLNWDQVSRLHEVLTEVVPIH--GRGNFPTLEITLKDIVQTVRSRLEEAGIKVQDVRLNGSAAGHVLVKDNGLGCKDLDLIFHVALPTEAEFQLVRDVVLCSLLNFLPEGVNK----LK----ISPVTLKEAYVQKLVKVC----TDTDRWSLISLSNKNGKN--VELKFVDSIRRQFEFSVDSFQIILDSLLFFYDCSN-NPISEHFHPTVIGESMYGDFEEAFDHLQNRLIATKNPEEIRGGGLLKYSNLLVRDFRPTDQEEIETLERYMCSRFFIDFPDILEQQRKLETYLQNHFAEEERSKYDYLMILRRVVNESTVCLMGHERRQTLNLISLLALRVLAE 343          
BLAST of Terminal nucleotidyltransferase 5C vs. UniProt/SwissProt
Match: sp|Q96IP4|TET5A_HUMAN (Terminal nucleotidyltransferase 5A OS=Homo sapiens OX=9606 GN=TENT5A PE=1 SV=2)

HSP 1 Score: 234.572 bits (597), Expect = 1.189e-65
Identity = 142/345 (41.16%), Postives = 216/345 (62.61%), Query Frame = 3
Query: 5823 VLSYEQVKRLHRVIEKPLKLKPVSHSVLPVIEVSLRALLGEIKRKLKEVDVVIKDVRLDGTAAGCILNLNPNDDFRELNVIFTVSLHDMTSMQKIKNTIFSLLIDLLKKTLNSKPESLKHNFLINEELIKDNYIQKMTRVLCNQESNSDCWSLISLGTLEIGNETVELKFIDKMKRQYEFTIDSFQIVLDTMLAFYTVSKCSSITPNLFPTVVAESVSGSFQEAFKHLKENIISTKNPEEIXXXXXXXXXXXXAVGFQQNSAMDIRATEKYMCSRFFIDYPDINVQRQKLESFLDSLVDSNYEIKINLLNVLYEVVSHSTVCLMTHERRQTLQMINSLSQNILSE 6857
            VL++EQV+RL  ++ + + +        P +E+    ++  ++R+L E  + ++DVRL+G+AA  +L+ +    +++L++IF   L      Q +K+ +   L+D L + +N +         I    +K+ Y+QKM +V CN   +SD WSLISL       + VELKF+D ++RQ+EF++DSFQI LD++L FY  S+ + +T    PT++ ESV G FQEAF HL   II+T+NPEEI GGGLLKYC LL  GF+  S  +I+  ++YMCSRFFID+ DI  Q++KLES+L +      + K   L  L+ VV+ STVCLM HERRQTL +I  L+  +L++
Sbjct:   65 VLNWEQVQRLDGILSETIPIH--GRGNFPTLELQPSLIVKVVRRRLAEKRIGVRDVRLNGSAASHVLHQDSGLGYKDLDLIFCADLRGEGEFQTVKDVVLDCLLDFLPEGVNKEK--------ITPLTLKEAYVQKMVKV-CN---DSDRWSLISLSN--NSGKNVELKFVDSLRRQFEFSVDSFQIKLDSLLLFYECSE-NPMTETFHPTIIGESVYGDFQEAFDHLCNKIIATRNPEEIRGGGLLKYCNLLVRGFRPASD-EIKTLQRYMCSRFFIDFSDIGEQQRKLESYLQNHFVGLEDRKYEYLMTLHGVVNESTVCLMGHERRQTLNLITMLAIRVLAD 391          
BLAST of Terminal nucleotidyltransferase 5C vs. TrEMBL
Match: A0A2T7P3E6 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_10506 PE=4 SV=1)

HSP 1 Score: 293.893 bits (751), Expect = 4.325e-84
Identity = 177/380 (46.58%), Postives = 243/380 (63.95%), Query Frame = 3
Query: 5811 NRFQVLSYEQVKRLHRVIEKPLKLKPVSHSVLPVIEVSLRALLGEIKRKLKEVDVVIKDVRLDGTAAGCILNLNPNDDFRELNVIFTVSLHDMTSMQKIKNTIFSLLIDLLKKTLNSKPESLKHNFLINEELIKDNYIQKMTRVLCNQESNSDCWSLISLGTLEIGNETVELKFIDKMKRQYEFTIDSFQIVLDTMLAFYTVSKCSSITPNLFPTVVAESVSGSFQEAFKHLKENIISTKNPEEIXXXXXXXXXXXXAVGFQQNSAMDIRATEKYMCSRFFIDYPDINVQRQKLESFLDSLVDSNYEIKINLLNVLYEVVSHSTVCLMTHERRQTLQMINSLSQNILSEIEIKKS--TVQLDDLSS-QNWVLDQVFYGTF 6941
            NRFQVL Y+QV RLH V+E  + +        P + V LR L+  +++KL    V ++DVRL+G AA  IL+     +F +L++IF V L +   +QK++N +   L+D L       PE +  + + +  L K+ Y+QKM +V CN+  + D WSLISL      N  VELKF+DKMKRQ+EF++DSFQ++LD++L FY VS+ + ++ + +PTVVAESV G F EA+ HL   II+T+NPEEI GGGLLKYC LL   F     +DIR  E+YMCSRFFID+ DIN QRQKLES+L +    +  +K + L  LY VV  ST+CLM HERRQTL +I+ L+  +L   E K     ++L +L    N V+DQVFYG F
Sbjct:    8 NRFQVLCYDQVLRLHEVMEDVVPIH--GRGNFPTLHVKLRELVQVVQKKLVAEGVQVRDVRLNGGAASYILDSASCQEFNDLDLIFGVDLSNHNELQKVRNCVLECLLDFL-------PEGVSKDKMSSCSL-KEAYVQKMVKV-CNE--HGDRWSLISLSNKTRKN--VELKFVDKMKRQFEFSVDSFQVILDSLLTFYDVSQ-APMSEHFYPTVVAESVYGDFSEAWYHLNNKIIATRNPEEIRGGGLLKYCYLLVKSFTPADDIDIRTMERYMCSRFFIDFSDINQQRQKLESYLANHFSGDESMKYHYLMTLYRVVDESTICLMGHERRQTLNLIHQLAYQVLMTQERKAQVKCIELHELDQLNNLVIDQVFYGPF 371          
BLAST of Terminal nucleotidyltransferase 5C vs. TrEMBL
Match: A0A2C9JSY4 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106066851 PE=4 SV=1)

HSP 1 Score: 290.041 bits (741), Expect = 8.010e-83
Identity = 170/385 (44.16%), Postives = 244/385 (63.38%), Query Frame = 3
Query: 5805 GPNRFQVLSYEQVKRLHRVIEKPLKLKPVSHSVLPVIEVSLRALLGEIKRKLKEVDVVIKDVRLDGTAAGCILNLNPNDDFRELNVIFTVSLHDMTSMQKIKNTIFSLLIDLLKKTLNSKPESLKHNFLINEELIKDNYIQKMTRVLCNQESNSDCWSLISLGTLEIGNETVELKFIDKMKRQYEFTIDSFQIVLDTMLAFYTVSKCSSITPNLFPTVVAESVSGSFQEAFKHLKENIISTKNPEEIXXXXXXXXXXXXAVGFQQNSAMDIRATEKYMCSRFFIDYPDINVQRQKLESFLDSLVDSNYEIKINLLNVLYEVVSHSTVCLMTHERRQTLQMINSLSQNILSEIEIKKSTV------QLDDLSSQNWVLDQVFYGTF 6941
            G NRFQVL YEQV RLH V+E  + +        P ++V L+ L+  +K KL    V ++  RL+G  A  +L      +F ++++IF V L +   +QKI+N +   L++ L + +N           I+   +K+ Y+QKM +V CN+  + D WSLISL      N  +ELKF+DKMKRQ+EF++DSFQI+LD++L FY +S+ + +T + +PT+VAES+ G F EA+ HL   +I+T+NPEEI GGGLLKYC LL  G+   + +DIR  E+YMCSRFFID+ DIN QRQKLE++L +  + + ++K   L  LY VV  ST+CLM HERRQTL +I+ L+  +    E +K+ +      QLD L+  N V+DQVFYG F
Sbjct:    6 GSNRFQVLCYEQVARLHEVMEDVIPIH--GRGNFPTLDVKLKDLVQAVKDKLTAEGVSVRSFRLNGGVASYVLGTTNAQEFNDVDLIFGVDLSNQNELQKIRNCVLGCLVNFLPEGINKDK--------ISSCSLKEAYVQKMVKV-CNE--HGDRWSLISLSHNTRKN--IELKFVDKMKRQFEFSVDSFQIILDSLLTFYDISE-APMTEHFYPTIVAESLYGDFAEAWYHLDNKLIATRNPEEIRGGGLLKYCNLLVRGYTPANEIDIRTMERYMCSRFFIDFSDINQQRQKLEAYLVNHFNGDEDMKYEYLTTLYRVVDESTICLMGHERRQTLNLIHQLAYQVYMAQE-RKAQIKCVELHQLDQLN--NLVIDQVFYGPF 371          
BLAST of Terminal nucleotidyltransferase 5C vs. TrEMBL
Match: A0A0B6Y0U5 (Uncharacterized protein OS=Arion vulgaris OX=1028688 GN=ORF7623 PE=4 SV=1)

HSP 1 Score: 290.426 bits (742), Expect = 8.447e-83
Identity = 173/386 (44.82%), Postives = 247/386 (63.99%), Query Frame = 3
Query: 5802 VGPNRFQVLSYEQVKRLHRVIEKPLKLKPVSHSVLPVIEVSLRALLGEIKRKLKEVDVVIKDVRLDGTAAGCILNLNPNDDFRELNVIFTVSLHDMTSMQKIKNTIFSLLIDLLKKTLNSKPESLKHNFLINEELIKDNYIQKMTRVLCNQESNSDCWSLISLGTLEIGNETVELKFIDKMKRQYEFTIDSFQIVLDTMLAFYTVSKCSSITPNLFPTVVAESVSGSFQEAFKHLKENIISTKNPEEIXXXXXXXXXXXXAVGFQQNSAMDIRATEKYMCSRFFIDYPDINVQRQKLESFLDSLVDSNYEIKINLLNVLYEVVSHSTVCLMTHERRQTLQMINSLSQNILSEIEIKKSTV------QLDDLSSQNWVLDQVFYGTF 6941
            V  NRFQVL YEQV RLH V+E  + +        P ++V L+ L+  +K KL    V ++D+R++G AA  IL      +F ++++IF V L +   +QKI+N +   L + L   ++           IN   +K+ Y+QKM +V CN+  + D WSLISL      N  VELKF+DKMKRQ+EF++DSFQI+LD++L+FY +S+ +S+T + +PT+VAES+ G F EA+ HL   +I+T+NPEEI GGGLLKYC LL  G+   + ++IR  E+YMCSRFFID+ DIN Q QKLE++L +  + + ++K   L  LY+VV  ST+CLM HERRQTL +I+ L+  +    E +K+ V      QLD L+  N V+DQVFYG F
Sbjct:   13 VNSNRFQVLCYEQVARLHEVMEDAIPIH--GRGNFPTLKVKLKDLVQVVKDKLTADGVRVRDIRINGGAASYILGTTNAPEFNDVDLIFGVDLSNQNELQKIRNCVLGCLENFLPSGISKDK--------INSCSLKEAYVQKMVKV-CNE--HGDRWSLISLSHKTRKN--VELKFVDKMKRQFEFSVDSFQIILDSLLSFYDISE-ASMTEHFYPTIVAESLYGDFSEAWYHLDNKLIATRNPEEIRGGGLLKYCNLLVRGYTPANEINIRTMERYMCSRFFIDFSDINQQHQKLEAYLVNHFNGDDDMKYEYLTTLYQVVDESTICLMGHERRQTLNLIHQLAYQVYMAQE-RKAQVKCIELHQLDQLN--NLVIDQVFYGPF 379          
BLAST of Terminal nucleotidyltransferase 5C vs. TrEMBL
Match: A0A3S1B855 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_013954 PE=4 SV=1)

HSP 1 Score: 288.115 bits (736), Expect = 3.776e-82
Identity = 170/383 (44.39%), Postives = 247/383 (64.49%), Query Frame = 3
Query: 5811 NRFQVLSYEQVKRLHRVIEKPLKLKPVSHSVLPVIEVSLRALLGEIKRKLKEVDVVIKDVRLDGTAAGCILNLNPNDDFRELNVIFTVSLHDMTSMQKIKNTIFSLLIDLLKKTLNSKPESLKHNFLINEELIKDNYIQKMTRVLCNQESNSDCWSLISLGTLEIGNETVELKFIDKMKRQYEFTIDSFQIVLDTMLAFYTVSKCSSITPNLFPTVVAESVSGSFQEAFKHLKENIISTKNPEEIXXXXXXXXXXXXAVGFQQNSAMDIRATEKYMCSRFFIDYPDINVQRQKLESFLDSLVDSNYEIKINLLNVLYEVVSHSTVCLMTHERRQTLQMINSLSQNILSEIEIKKSTV------QLDDLSSQNWVLDQVFYGTF 6941
            NRFQVL YEQV RL+ V+E  + +        P ++V L+ L+  +K KL    V I+D+RL+G AA  IL      +F ++++IF V L +   +QKI+N +   L++ L   +N           +    +K+ Y+QKM +V CN+  + D WSLISL      ++ +ELKF+DKMKRQ+EF++DSFQI+LD++L FY +S+ + +  + +PT+VAES+ G F EA+ HL   +I+T+NPE+I GGGLLKYC LL  G+   + +D+R  E+YMCSRFFID+ DIN QRQKLE++L +  +++ ++K   L  LY VV  ST+CLM HERRQTL +I+ L+ ++  E E +K+ V      QLD LS  N V+DQVFYG F
Sbjct:   10 NRFQVLCYEQVARLNEVMEDVVPIH--GRGNFPTLDVRLKDLVQVVKDKLISDGVTIRDIRLNGGAASYILGSTNAQEFNDVDLIFGVDLSNQNELQKIRNCVLGCLVNFLPNDINKDK--------MTSCALKEAYVQKMVKV-CNE--HGDRWSLISLS--HQTHKNIELKFVDKMKRQFEFSVDSFQIILDSLLKFYDISE-APMKEHFYPTIVAESLYGDFSEAWFHLDNKLIATRNPEQIRGGGLLKYCNLLVRGYTPATEIDLRTMERYMCSRFFIDFSDINQQRQKLEAYLANHFNNDEDMKYEYLTTLYRVVDESTICLMGHERRQTLNLIHQLAYSVYMEQE-RKAQVKCVELHQLDQLS--NLVIDQVFYGPF 373          
BLAST of Terminal nucleotidyltransferase 5C vs. TrEMBL
Match: A0A210QHP4 (Protein FAM46C OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT07927 PE=4 SV=1)

HSP 1 Score: 284.263 bits (726), Expect = 3.555e-80
Identity = 176/385 (45.71%), Postives = 244/385 (63.38%), Query Frame = 3
Query: 5811 NRFQVLSYEQVKRLHRVIEKPLKLKPVSHSVLPVIEVSLRALLGEIKRKLKEVDVVIKDVRLDGTAAGCILNLNPNDDFRELNVIFTVSLHDMTSMQKIKNTIFSLLIDLLKKTLNSKPESLKHNFLINEELIKDNYIQKMTRVLCNQESNSDCWSLISLGTLEIGNETVELKFIDKMKRQYEFTIDSFQIVLDTMLAFYTVSKCSSITPNLFPTVVAESVSGSFQEAFKHLKENIISTKNPEEIXXXXXXXXXXXXAVGFQQNSAMDIRATEKYMCSRFFIDYPDINVQRQKLESFLDSLVDSNYEIKINLLNVLYEVVSHSTVCLMTHERRQTLQMINSLSQNILSEIE----IKKSTV-QLDDLSSQNWVLDQVFYGTFYFP 6950
            NRFQ L YEQV RLH V+E+ + +        P +++ L+ L+  ++ KL+   V +KDVRL+G AA  I   +    + +L++IF V L +   +QKIKN +   L+D L   +N +  S           +K+ Y+QKM +V CN+  + D WSLISL   +  N  VELKF+DKMKRQ+EF++DSFQI+LD++L FY VS  + ++ N +PTVVAESV G F EA+ HL + +IST+NPEEI GGGLLKYC LL   +     +DIRA E+YMCSRFFID+ D+N QRQKLES+L++      E+K + L  LY VV  ST+CLM HERRQTL +I+ L+  +L + E    IK   + Q D L+S    +DQVF+   + P
Sbjct:   60 NRFQGLCYEQVVRLHEVMEEVVPIH--GRGNFPTMDIKLKDLVQVVREKLRTDGVSVKDVRLNGGAASYIFGTDNVRSYNDLDLIFGVDLSNHNELQKIKNCVLGCLLDFLPDGVNKEKMS--------SCSLKEAYVQKMVKV-CNE--HGDRWSLISLSNNKGKN--VELKFVDKMKRQFEFSVDSFQIILDSLLTFYEVSA-APMSENFYPTVVAESVYGDFCEAWYHLNKKLISTRNPEEIRGGGLLKYCNLLTRTYTPVENIDIRAMERYMCSRFFIDFSDLNQQRQKLESYLNNHFSGEEELKHDYLMTLYRVVDESTICLMGHERRQTLNLIHQLAYQVLMDQERRAHIKYLEIQQFDQLNS--LTIDQVFFHGPFSP 426          
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Cavefish
Match: tent5ba (protein FAM46A-like [Source:NCBI gene;Acc:103046783])

HSP 1 Score: 250.366 bits (638), Expect = 1.046e-72
Identity = 150/350 (42.86%), Postives = 226/350 (64.57%), Query Frame = 3
Query: 5814 RFQVLSYEQVKRLHRVIEKPLKLKPVSHSVLPVIEVSLRALLGEIKRKLKEVDVVIKDVRLDGTAAGCILNLNPNDDFRELNVIFTVSLHDMTSMQKIKNTIFSLLIDLLKKTLNSKPESLKHNFLINEELIKDNYIQKMTRVLCNQESNSDCWSLISLGTLEIGNETVELKFIDKMKRQYEFTIDSFQIVLDTMLAFYTVSKCSS--ITPNLFPTVVAESVSGSFQEAFKHLKENIISTKNPEEIXXXXXXXXXXXXAVGFQQNSAMDIRATEKYMCSRFFIDYPDINVQRQKLESFLDSLVDSNYEIKINLLNVLYEVVSHSTVCLMTHERRQTLQMINSLSQNILSE 6857
            R  VLS+EQV+RL  +I +P+ +        P + V  R ++  ++ +L++  V ++DVRL+G+AA  +L+ +    +++L++IF VSL D  + + +K+ +   L+D L       PE +     I    +K+ Y+QK+ +V CN   ++D WSLISL      N  VELKF+D ++RQ+EF++DSFQI LD++L F    +CS   ++ +  PTVV ESV G F+EA  HL++ IIST+NPEEI GGGLLKYC LL  GFQ  S  ++++ ++YMCSRFFID+PDI  Q++KLES+L +        + + L  LY VV+ STVCLM HERRQTL +I++L+  +L+E
Sbjct:   12 RLCVLSWEQVQRLDSIIGEPVPIH--GRGNFPTLSVQPRQIVQVVRERLEQQGVTVRDVRLNGSAASHVLHQDTGLGYKDLDLIFGVSLSDDQAFRLVKDVVLDSLLDFL-------PEGVSKE-RITALTLKEAYVQKLVKV-CN---DTDRWSLISLSNNTGKN--VELKFVDSLRRQFEFSVDSFQIGLDSLLLF---DRCSETPMSESFHPTVVGESVYGDFEEAHSHLRDKIISTRNPEEIRGGGLLKYCHLLVRGFQPRSEAEMKSLQRYMCSRFFIDFPDIGEQQRKLESYLQNHFAGMEHKRYDCLVRLYHVVNESTVCLMGHERRQTLNLISTLALRVLAE 342          
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Cavefish
Match: tent5ab (protein FAM46A-like [Source:NCBI gene;Acc:103042328])

HSP 1 Score: 231.876 bits (590), Expect = 2.822e-66
Identity = 140/349 (40.11%), Postives = 213/349 (61.03%), Query Frame = 3
Query: 5823 VLSYEQVKRLHRVIEKPLKLKPVSHSVLPVIEVSLRALLGEIKRKLKEVDVVIKDVRLDGTAAGCILNLNPNDDFRELNVIFTVSLHDMTSMQKIKNTIFSLLIDLLKKTLNSKPESLKHNFLINEELIKDNYIQKMTRVLCNQESNSDCWSLISLGTLEIGNETVELKFIDKMKRQYEFTIDSFQIVLDTMLAFYTVSKCSSITPNLFPTVVAESVSGSFQEAFKHLKENIISTKNPEEIXXXXXXXXXXXXAVGFQQNSAMDIRATEKYMCSRFFIDYPDINVQRQKLESFLD----SLVDSNYEIKINLLNVLYEVVSHSTVCLMTHERRQTLQMINSLSQNILSE 6857
            VLS+EQV+RL  ++ + + +        P + +  R ++  ++ +L+E  + +++VRL+G+AA  +L+ +    +++L++IF   L      Q +K  +   L+D L   +N +         I    +K+ Y+QKM +V     ++SD WSLISL       + VELKF+D ++RQ+EF++DSFQI LD++L FY  S+ + +     P++V ESV G F+EA +HL+  +I T+NPEEI GGGLLKYC LL  GF+  S   ++  E+YMCSRFFID+PD + QR+KLES+L      L D  YE     L+ L+ VVS STVCLM HERRQ L +I  L+  +L+E
Sbjct:   21 VLSWEQVQRLDALLAESIPIH--GRWNFPTLHMKPRDIVRVVRARLRERHIDVREVRLNGSAASHVLHEDSGLGYKDLDLIFRADLKGEREFQTVKEIVLHSLLDFLPAGVNKEK--------ITPLTLKEAYVQKMVKVY----NDSDRWSLISLSN--NSGKNVELKFVDSLRRQFEFSVDSFQIRLDSLLLFYECSE-NPMAETFHPSIVGESVYGDFEEALEHLRHRLICTRNPEEIRGGGLLKYCHLLVRGFRAASPSHMKQLERYMCSRFFIDFPDASEQRRKLESYLQNHFVGLEDRKYEY----LSTLHGVVSESTVCLMGHERRQALSLITMLAVRVLAE 348          
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Cavefish
Match: tent5bb (protein FAM46A-like [Source:NCBI gene;Acc:103036989])

HSP 1 Score: 228.794 bits (582), Expect = 2.982e-65
Identity = 138/351 (39.32%), Postives = 220/351 (62.68%), Query Frame = 3
Query: 5811 NRFQVLSYEQVKRLHRVIEKPLKLKPVSHSVLPVIEVSLRALLGEIKRKLKEVDVVIKDVRLDGTAAGCILNLNPNDDFRELNVIFTVSLHDMTSMQKIKNTIFSLLIDLLKKTLNSKPESLKHNFLINEELIKDNYIQKMTRVLCNQESNSDCWSLISLGTLEIGNETVELKFIDKMKRQYEFTIDSFQIVLDTMLAFYTVSKCSS--ITPNLFPTVVAESVSGSFQEAFKHLKENIISTKNPEEIXXXXXXXXXXXXAVGFQQNSAMDIRATEKYMCSRFFIDYPDINVQRQKLESFLDSLVDSNYEIKINLLNVLYEVVSHSTVCLMTHERRQTLQMINSLSQNILSE 6857
             RF VLS+EQV+RL  ++ + + +        P + V  R ++  ++ +L+E  V ++DV+L+G+AA  +L+ +    +++L++IF +SL D  + + +K+ +   L++ L   ++ +         I+   +K+ Y+QK+ +V CN   ++D WSLISL      N  VELKF+D ++RQ+EF++DSFQI LD++L F    +CS   ++ +  PTV+ ES+ G F+EA  HL+   I+T++PEEI GGGLLKYC LL  GF+  S   I+  ++YMCSRFFID+PDI  Q +KLE++L +  +     +   L  L  VV  STVCLM HERRQTL +I++L+  +L+E
Sbjct:   12 RRFCVLSWEQVQRLDSILGESVPIH--GRGNFPTLSVQPRQIVQVVRARLEERGVAVRDVKLNGSAASHVLHQDTGLGYKDLDLIFGLSLTDDKTFRLVKDVVLDSLLEFLPVGVSRER--------ISALTLKEAYVQKLVKV-CN---DTDRWSLISLSNNTGKN--VELKFVDSLRRQFEFSVDSFQIGLDSLLLF---DRCSETPMSESFHPTVLGESMYGDFEEALGHLRSKTIATRSPEEIRGGGLLKYCHLLVRGFRPVSESQIKTLQRYMCSRFFIDFPDIGEQHRKLEAYLQNHFNGIEHKRYECLVTLRRVVDESTVCLMGHERRQTLALISALALRVLAE 343          
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Cavefish
Match: tent5c (terminal nucleotidyltransferase 5C [Source:NCBI gene;Acc:103030177])

HSP 1 Score: 227.254 bits (578), Expect = 9.080e-65
Identity = 137/345 (39.71%), Postives = 213/345 (61.74%), Query Frame = 3
Query: 5823 VLSYEQVKRLHRVIEKPLKLKPVSHSVLPVIEVSLRALLGEIKRKLKEVDVVIKDVRLDGTAAGCILNLNPNDDFRELNVIFTVSLHDMTSMQKIKNTIFSLLIDLLKKTLNSKPESLKHNFLINEELIKDNYIQKMTRVLCNQESNSDCWSLISLGTLEIGNETVELKFIDKMKRQYEFTIDSFQIVLDTMLAFYTVSKCSSITPNLFPTVVAESVSGSFQEAFKHLKENIISTKNPEEIXXXXXXXXXXXXAVGFQQNSAMDIRATEKYMCSRFFIDYPDINVQRQKLESFLDSLVDSNYEIKINLLNVLYEVVSHSTVCLMTHERRQTLQMINSLSQNILSE 6857
            VL+++QV RL+ V+ + + +        P +EV L+ ++  ++ +L++  + +KDVRL+G+ A  +L  +    +++L++IF V L      Q IK+ +   L+D L + +N +         I    +K+ Y+QK+ +V   Q    D WSLISL         VELKF+D ++RQ+EF++DSFQI+LD++L++Y  S+ + ++ +  PTV+ ESV G F  A  HLK  +I+TK PEEI GGGLLKYC LL   F+     + +A E+YMCSRFFID+PDI  Q++KLE++L S      + K + L +L  VV+ STVCLM HERRQTL +I+  +  +L+E
Sbjct:   15 VLTWDQVSRLNEVLTEAVPVH--GRGNFPTLEVRLKDIVQMVRNRLEQRGIQVKDVRLNGSTASHVLVKDIGWCYKDLDIIFRVDLPQEAQFQLIKDVVLGTLLDFLPEGVNKEK--------ITPMTLKEAYVQKLVKVYTEQ----DRWSLISLSN--NNGRNVELKFVDSIRRQFEFSVDSFQIILDSLLSYYDFSE-TPMSQHFHPTVLGESVYGDFAVALDHLKNKMIATKRPEEIRGGGLLKYCNLLVRDFRPTDEEEFKALERYMCSRFFIDFPDIGEQQRKLEAYLQSHFVGEEKSKYDYLMILRRVVNESTVCLMGHERRQTLNLISLTAFRVLAE 342          
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Cavefish
Match: TENT5A (terminal nucleotidyltransferase 5A [Source:HGNC Symbol;Acc:HGNC:18345])

HSP 1 Score: 217.624 bits (553), Expect = 1.989e-61
Identity = 137/348 (39.37%), Postives = 218/348 (62.64%), Query Frame = 3
Query: 5814 RFQVLSYEQVKRLHRVIEKPLKLKPVSHSVLPVIEVSLRALLGEIKRKLKEVDVVIKDVRLDGTAAGCILNLNPNDDFRELNVIFTVSLHDMTSMQKIKNTIFSLLIDLLKKTLNSKPESLKHNFLINEELIKDNYIQKMTRVLCNQESNSDCWSLISLGTLEIGNETVELKFIDKMKRQYEFTIDSFQIVLDTMLAFYTVSKCSSITPNLFPTVVAESVSGSFQEAFKHLKENIISTKNPEEIXXXXXXXXXXXXAVGFQQNSAMDIRATEKYMCSRFFIDYPDINVQRQKLESFLDSLVDSNYEIKINLLNVLYEVVSHSTVCLMTHERRQTLQMINSLSQNILSE 6857
            + + L +EQV+RL  ++ + + +        P +++  R ++  ++R+++E ++ ++DVRL+G+AA  +L+      +++L++IF   L      Q +K+ +   L+D L + +N +         I    +K+ Y+QKM +V CN   +SD WSLISL      N  VELKF+D ++RQ+EF++DSFQI LD++L FY  S+ + +     PT++ ESV G F  A +HL+  +I T+NPEEI GGGLLKYC LL  GF+  S  ++++ ++YMCSRFFID+ DIN Q++KLES+L +      + K + L  L+ VV+ STVCLM HERRQTL +I  L+  +L+E
Sbjct:   12 KMEHLIWEQVQRLDSLLTESIPIH--GRGNFPTLQMKPRQIVKAVRRRMEERELRVRDVRLNGSAASHVLHEQSGLGYKDLDLIFCAELKGEAEFQMVKDIVLDCLLDFLPEGVNKEK--------ITPLTLKEAYVQKMVKV-CN---DSDRWSLISLSNNRGKN--VELKFVDSLRRQFEFSVDSFQIKLDSLLLFYECSE-NPMAKTFHPTIIGESVYGDFNVALEHLRNKVICTRNPEEIRGGGLLKYCHLLVRGFRAASETEMKSLQRYMCSRFFIDFSDINEQQRKLESYLQNHFVGLEDRKYDYLMTLHGVVNESTVCLMGHERRQTLGLIAMLAVRVLAE 342          
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Sea Lamprey
Match: tent5ab (terminal nucleotidyltransferase 5Ab [Source:ZFIN;Acc:ZDB-GENE-071004-35])

HSP 1 Score: 143.28 bits (360), Expect = 9.140e-39
Identity = 78/210 (37.14%), Postives = 132/210 (62.86%), Query Frame = 3
Query: 5916 EVSLRALLGEIKRKLKEVDVVIKDVRLDGTAAGCILNLNPNDDFRELNVIFTVSLHDMTSMQKIKNTIFSLLIDLLKKTLNSKPESLKHNFLINEELIKDNYIQKMTRVLCNQESNSDCWSLISLGTLEIGNETVELKFIDKMKRQYEFTIDSFQIVLDTMLAFYTVSKCSSITPNLFPTVVAESVSGSFQEAFKHLKENIISTKNPEEI 6545
            +V  R ++  ++ +L+E  + ++DVRL+G+AA  +L+ +    +++L++IF V L      Q +K  +   L+D L + ++ +         I  + +K+ Y+QKM +V CN   ++D WSLISL      N  VELKF+D ++RQ+EF++DSFQIVLD++L FY  S+  +++    P+V+ ES+ G F EA +HL+  +I+T+NPEEI
Sbjct:    1 QVRPRDIVRIVRGRLEERGIAVRDVRLNGSAASHVLHHDSGLSYKDLDLIFGVGLTGEAEFQLVKEVVLDCLLDFLPEGVSKEK--------IGPQTLKEAYVQKMVKV-CN---DTDRWSLISLSNNSGKN--VELKFVDSLRRQFEFSVDSFQIVLDSLLLFYECSE-HAMSERFHPSVLGESMYGDFGEALEHLRGRLIATRNPEEI 195          
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Nematostella
Match: EDO30295 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T168])

HSP 1 Score: 249.595 bits (636), Expect = 2.695e-73
Identity = 144/341 (42.23%), Postives = 225/341 (65.98%), Query Frame = 3
Query: 5820 QVLSYEQVKRLHRVIEKPLKLKPVSHSVLPVIEVSLRALLGEIKRKLKEVDVVIKDVRLDGTAAGCILNLNPNDDFRELNVIFTVSLHDMTSMQKIKNTIFSLLIDLLKKTLNSKPESLKHNFLINEELIKDNYIQKMTRVLCNQESNSDCWSLISLGTLEIGNETVELKFIDKMKRQYEFTIDSFQIVLDTMLAFYTVSKCSSITPNLFPTVVAESVSGSFQEAFKHLKENIISTKNPEEIXXXXXXXXXXXXAVGFQQNSAMDIRATEKYMCSRFFIDYPDINVQRQKLESFLDSLVDSNYEIKINLLNVLYEVVSHSTVCLMTHERRQTLQMINSLSQ 6842
            QVL+YEQV RL  V+ + +++    +   P ++V LR L+  +   LK+ ++ I+D+RL+G+ A  IL+ + N  + ++++IF V +   T +Q+IK+ + S L++ L   ++ +  S           +K+ Y+QKM +V     +++D WSLISL   +  N  +ELKF+D M+RQ+EF++DSFQ+ LD++L FY +S C  + PN FPTVVAESV G  + A  HL   +I+T+NPEEI GGGLLKYC LL   ++  +  ++R  E+YMCSRFFID+ D+  QRQKLES+L +      + K + L++LY +V++STVCLM HERRQTL++I++L++
Sbjct:    8 QVLTYEQVHRLDNVLNQVVQVHGRGN--FPTLDVHLRELINVVSSGLKDENLRIRDIRLNGSTASYILSRDSNTAYNDIDLIFGVEIKSHTHLQQIKSVVLSSLLNFLPNGVSKEKMS--------SCTLKEAYVQKMVKV----SNDNDRWSLISLSNNDGKN--IELKFVDTMRRQFEFSVDSFQVNLDSLLGFYKLS-CVPMKPNFFPTVVAESVYGDIKVALFHLDNQLIATRNPEEIRGGGLLKYCNLLVRNYRPENMDELRLLERYMCSRFFIDFGDLESQRQKLESYLANHFIGENDTKYDYLSILYTIVANSTVCLMGHERRQTLRLISTLAR 331          
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Medaka
Match: tent5ab (putative nucleotidyltransferase FAM46A [Source:NCBI gene;Acc:101158158])

HSP 1 Score: 237.654 bits (605), Expect = 4.133e-68
Identity = 141/345 (40.87%), Postives = 216/345 (62.61%), Query Frame = 3
Query: 5823 VLSYEQVKRLHRVIEKPLKLKPVSHSVLPVIEVSLRALLGEIKRKLKEVDVVIKDVRLDGTAAGCILNLNPNDDFRELNVIFTVSLHDMTSMQKIKNTIFSLLIDLLKKTLNSKPESLKHNFLINEELIKDNYIQKMTRVLCNQESNSDCWSLISLGTLEIGNETVELKFIDKMKRQYEFTIDSFQIVLDTMLAFYTVSKCSSITPNLFPTVVAESVSGSFQEAFKHLKENIISTKNPEEIXXXXXXXXXXXXAVGFQQNSAMDIRATEKYMCSRFFIDYPDINVQRQKLESFLDSLVDSNYEIKINLLNVLYEVVSHSTVCLMTHERRQTLQMINSLSQNILSE 6857
            VL++EQV+RL  ++   + +        P +EV  R ++  ++ +++E  + +++VRL+G+AA  +L+ +    +++L++IF   L      Q +K  +   L+D   + +N +         I    +K+ Y+QKM +V CN   +SD WSLISL      N  VELKF+D ++RQ+EF++DSFQI LD++L FY  S+  S+     PT++ ESV G F  A  HL++ +I T++PEEI GGGLLKYC LL  GF+  S  +++  ++YMCSRFFID+PD+N QR+KLES+L +      + K + L  LYEVV  STVCLM HERRQTL +I+SL+  +L+E
Sbjct:   23 VLNWEQVQRLDTILTSSIPIH--GRWSFPTLEVKPRDIVKVVRSRMEEKRIHVREVRLNGSAASYVLHEDSGLGWKDLDLIFCAELKGEMEFQIVKELVLDSLLDFFPEGVNKEK--------ITPVTLKEAYVQKMVKV-CN---DSDRWSLISLSNNRGKN--VELKFVDSLRRQFEFSVDSFQIRLDSLLLFYECSE-HSMAATFHPTILGESVYGDFPTALDHLRKRLICTRSPEEIRGGGLLKYCHLLVRGFRAASDTEMKLLQRYMCSRFFIDFPDVNEQRRKLESYLHNHFVDLEDRKYDYLATLYEVVQESTVCLMGHERRQTLSLISSLALRVLAE 350          
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Medaka
Match: tent5ba (terminal nucleotidyltransferase 5B [Source:NCBI gene;Acc:101173494])

HSP 1 Score: 236.884 bits (603), Expect = 4.567e-68
Identity = 140/348 (40.23%), Postives = 219/348 (62.93%), Query Frame = 3
Query: 5814 RFQVLSYEQVKRLHRVIEKPLKLKPVSHSVLPVIEVSLRALLGEIKRKLKEVDVVIKDVRLDGTAAGCILNLNPNDDFRELNVIFTVSLHDMTSMQKIKNTIFSLLIDLLKKTLNSKPESLKHNFLINEELIKDNYIQKMTRVLCNQESNSDCWSLISLGTLEIGNETVELKFIDKMKRQYEFTIDSFQIVLDTMLAFYTVSKCSSITPNLFPTVVAESVSGSFQEAFKHLKENIISTKNPEEIXXXXXXXXXXXXAVGFQQNSAMDIRATEKYMCSRFFIDYPDINVQRQKLESFLDSLVDSNYEIKINLLNVLYEVVSHSTVCLMTHERRQTLQMINSLSQNILSE 6857
            RF VLS++QV+RL  ++ + + +        P + V  R ++  ++ +L+E  + +KDVRL+G+AA  +L+      +++L++IF VSL D  + + +K+ +   L+D L   ++ +         I    +K+ Y+QK+ +V CN   ++D WSLISL      N  VELKF+D ++RQ+EF++DSFQI LD++L F   S+ + ++ +  PTV+ ESV G F EA  HL    I+T++PEEI GGGLLKYC LL  GF  +S  D++  ++YMCSRFFID+PDI  Q++KLE++L +        +   L  L++VV+ STVCLM HERRQTL +I+ L+  +L+E
Sbjct:   10 RFCVLSWDQVRRLDSILAESVPIH--GRGNFPTLSVQPRQIVQVVRARLQERGICVKDVRLNGSAASHVLHQGNGLGYKDLDLIFGVSLKDDQAFRLVKDVVLDCLLDFLPPGVSKE--------RITALTLKEAYVQKLVKV-CN---DTDRWSLISLSNNTGKN--VELKFVDSLRRQFEFSVDSFQICLDSLLLFDRCSE-TPMSESFHPTVIGESVYGDFSEALDHLCRRTIATRSPEEIRGGGLLKYCHLLVRGFTPSSEADMKQMQRYMCSRFFIDFPDIGEQQRKLEAYLQNHFVGMEHKRYECLMTLHQVVNESTVCLMGHERRQTLSLISMLALKVLAE 340          
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Medaka
Match: tent5bb (putative nucleotidyltransferase FAM46A [Source:NCBI gene;Acc:101172962])

HSP 1 Score: 235.343 bits (599), Expect = 2.630e-67
Identity = 145/360 (40.28%), Postives = 224/360 (62.22%), Query Frame = 3
Query: 5781 TVSKIDSVGPNR-FQVLSYEQVKRLHRVIEKPLKLKPVSHSVLPVIEVSLRALLGEIKRKLKEVDVVIKDVRLDGTAAGCILNLNPNDDFRELNVIFTVSLHDMTSMQKIKNTIFSLLIDLLKKTLNSKPESLKHNFLINEELIKDNYIQKMTRVLCNQESNSDCWSLISLGTLEIGNETVELKFIDKMKRQYEFTIDSFQIVLDTMLAFYTVSKCSSITPNLFPTVVAESVSGSFQEAFKHLKENIISTKNPEEIXXXXXXXXXXXXAVGFQQNSAMDIRATEKYMCSRFFIDYPDINVQRQKLESFLDSLVDSNYEIKINLLNVLYEVVSHSTVCLMTHERRQTLQMINSLSQNILSE 6857
            T+S  D+   +R   VLS++QV+RL  ++ + + +        P + V  R ++  +  +L+E  VV++DVRL+G+AA  +L+ +    +++L++IF +SL D  + + IK+ +   L+D L       PE +     I    +K+ Y+QK+ +V CN   ++D WSLISL      N  VELKF+D M+RQ+EF++DSFQI LD++L F   S+ ++++    PTV  ES+ G FQEA  HL+   I+T++PEEI GGGLLKYC LL  GF  +S   ++  ++YMCSRFFID+PDIN Q++KLE++L +        +   L  L  VV  STVCLM HERRQTL +I++L+  +++E
Sbjct:   14 TMSSCDAPAQSRRLSVLSWDQVRRLDSILGESVPIH--GRGNFPTLSVQPRQIVQVVMARLEEEGVVVRDVRLNGSAASHVLHQDNGLGYKDLDLIFGLSLTDDKTFRLIKDVVLDCLVDFL-------PEGVCRE-RITALALKEAYVQKLVKV-CN---DTDRWSLISLSNNTGKN--VELKFVDSMRRQFEFSVDSFQITLDSLLLFDRCSE-TAMSETFHPTVQGESMYGDFQEALHHLRSKTIATRSPEEIRGGGLLKYCHLLVRGFHPSSESQMKQMQRYMCSRFFIDFPDINEQQRKLEAYLQNHFAGIEHKRYEYLVTLRRVVDESTVCLMGHERRQTLALISALAIRVMAE 356          
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Medaka
Match: TENT5A (terminal nucleotidyltransferase 5A [Source:NCBI gene;Acc:101158475])

HSP 1 Score: 227.639 bits (579), Expect = 1.114e-64
Identity = 136/342 (39.77%), Postives = 213/342 (62.28%), Query Frame = 3
Query: 5832 YEQVKRLHRVIEKPLKLKPVSHSVLPVIEVSLRALLGEIKRKLKEVDVVIKDVRLDGTAAGCILNLNPNDDFRELNVIFTVSLHDMTSMQKIKNTIFSLLIDLLKKTLNSKPESLKHNFLINEELIKDNYIQKMTRVLCNQESNSDCWSLISLGTLEIGNETVELKFIDKMKRQYEFTIDSFQIVLDTMLAFYTVSKCSSITPNLFPTVVAESVSGSFQEAFKHLKENIISTKNPEEIXXXXXXXXXXXXAVGFQQNSAMDIRATEKYMCSRFFIDYPDINVQRQKLESFLDSLVDSNYEIKINLLNVLYEVVSHSTVCLMTHERRQTLQMINSLSQNILSE 6857
            ++QV+RL  ++ + + +        P +++  R ++  ++ +++E  + ++DVRL+G+AA  IL+ +    F++L++IF   +   +  Q +K+ +   L+D L   +N +         I    +K+ Y+QKM +V CN   +SD WSLISL      N  VELKF+D ++RQ+EF++DSFQI LD++L FY  S+ + +T    PT++ ESV G   EA  HL+  II T+NPEEI GGGLLKYC LL  GF+  S  ++++ ++YMCSRFFID+ DI  Q++KLES+L +      + K + L  L+ VV+ STVCLM HERRQTL +I  L+  +L+E
Sbjct:   29 WDQVQRLDAILTETIPIH--GRGNFPTLQMQPRQIVKVVRSRMEEKRIHVRDVRLNGSAASHILHDDSGLGFKDLDLIFCADMKGESEFQTVKDIVLDCLLDFLPDCVNKEK--------ITPLTLKEAYVQKMVKV-CN---DSDRWSLISLSNNRGKN--VELKFVDSLRRQFEFSVDSFQIKLDSLLLFYECSE-NPMTETFHPTIMGESVYGDISEALDHLRHKIICTRNPEEIRGGGLLKYCHLLVRGFRAASESEMKSLQRYMCSRFFIDFSDIGEQQRKLESYLQNHFVGLEDRKYDYLMTLHGVVNESTVCLMGHERRQTLGLIAMLAVRVLAE 353          
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Medaka
Match: TENT5A (terminal nucleotidyltransferase 5A [Source:NCBI gene;Acc:101158475])

HSP 1 Score: 227.639 bits (579), Expect = 1.114e-64
Identity = 136/342 (39.77%), Postives = 213/342 (62.28%), Query Frame = 3
Query: 5832 YEQVKRLHRVIEKPLKLKPVSHSVLPVIEVSLRALLGEIKRKLKEVDVVIKDVRLDGTAAGCILNLNPNDDFRELNVIFTVSLHDMTSMQKIKNTIFSLLIDLLKKTLNSKPESLKHNFLINEELIKDNYIQKMTRVLCNQESNSDCWSLISLGTLEIGNETVELKFIDKMKRQYEFTIDSFQIVLDTMLAFYTVSKCSSITPNLFPTVVAESVSGSFQEAFKHLKENIISTKNPEEIXXXXXXXXXXXXAVGFQQNSAMDIRATEKYMCSRFFIDYPDINVQRQKLESFLDSLVDSNYEIKINLLNVLYEVVSHSTVCLMTHERRQTLQMINSLSQNILSE 6857
            ++QV+RL  ++ + + +        P +++  R ++  ++ +++E  + ++DVRL+G+AA  IL+ +    F++L++IF   +   +  Q +K+ +   L+D L   +N +         I    +K+ Y+QKM +V CN   +SD WSLISL      N  VELKF+D ++RQ+EF++DSFQI LD++L FY  S+ + +T    PT++ ESV G   EA  HL+  II T+NPEEI GGGLLKYC LL  GF+  S  ++++ ++YMCSRFFID+ DI  Q++KLES+L +      + K + L  L+ VV+ STVCLM HERRQTL +I  L+  +L+E
Sbjct:   29 WDQVQRLDAILTETIPIH--GRGNFPTLQMQPRQIVKVVRSRMEEKRIHVRDVRLNGSAASHILHDDSGLGFKDLDLIFCADMKGESEFQTVKDIVLDCLLDFLPDCVNKEK--------ITPLTLKEAYVQKMVKV-CN---DSDRWSLISLSNNRGKN--VELKFVDSLRRQFEFSVDSFQIKLDSLLLFYECSE-NPMTETFHPTIMGESVYGDISEALDHLRHKIICTRNPEEIRGGGLLKYCHLLVRGFRAASESEMKSLQRYMCSRFFIDFSDIGEQQRKLESYLQNHFVGLEDRKYDYLMTLHGVVNESTVCLMGHERRQTLGLIAMLAVRVLAE 353          
BLAST of Terminal nucleotidyltransferase 5C vs. Planmine SMEST
Match: SMESG000016756.1 (SMESG000016756.1)

HSP 1 Score: 959.903 bits (2480), Expect = 0.000e+0
Identity = 524/524 (100.00%), Postives = 524/524 (100.00%), Query Frame = 3
Query: 5622 MPSSHRNKSSQTKPISQKLKSQNTIIMKNQSKSLAEKSIKPEMPKSAPEKSSSTVSKIDSVGPNRFQVLSYEQVKRLHRVIEKPLKLKPVSHSVLPVIEVSLRALLGEIKRKLKEVDVVIKDVRLDGTAAGCILNLNPNDDFRELNVIFTVSLHDMTSMQKIKNTIFSLLIDLLKKTLNSKPESLKHNFLINEELIKDNYIQKMTRVLCNQESNSDCWSLISLGTLEIGNETVELKFIDKMKRQYEFTIDSFQIVLDTMLAFYTVSKCSSITPNLFPTVVAESVSGSFQEAFKHLKENIISTKNPEEIXXXXXXXXXXXXAVGFQQNSAMDIRATEKYMCSRFFIDYPDINVQRQKLESFLDSLVDSNYEIKINLLNVLYEVVSHSTVCLMTHERRQTLQMINSLSQNILSEIEIKKSTVQLDDLSSQNWVLDQVFYGTFYFPQQVYVTGPMNASXXXXXXXXXXXXXXXXXCTGDNTDFITTSNQIVSVNQATSAVIDSSSWXXXXXXXXXXXXXXXXPLMCA 7193
            MPSSHRNKSSQTKPISQKLKSQNTIIMKNQSKSLAEKSIKPEMPKSAPEKSSSTVSKIDSVGPNRFQVLSYEQVKRLHRVIEKPLKLKPVSHSVLPVIEVSLRALLGEIKRKLKEVDVVIKDVRLDGTAAGCILNLNPNDDFRELNVIFTVSLHDMTSMQKIKNTIFSLLIDLLKKTLNSKPESLKHNFLINEELIKDNYIQKMTRVLCNQESNSDCWSLISLGTLEIGNETVELKFIDKMKRQYEFTIDSFQIVLDTMLAFYTVSKCSSITPNLFPTVVAESVSGSFQEAFKHLKENIISTKNPEEILGGGLLKYCGLLAVGFQQNSAMDIRATEKYMCSRFFIDYPDINVQRQKLESFLDSLVDSNYEIKINLLNVLYEVVSHSTVCLMTHERRQTLQMINSLSQNILSEIEIKKSTVQLDDLSSQNWVLDQVFYGTFYFPQQVYVTGPMNASQSNNINLGNISGNQILICTGDNTDFITTSNQIVSVNQATSAVIDSSSWIGGYQNQNNQIYCCNGPLMCA
Sbjct:    1 MPSSHRNKSSQTKPISQKLKSQNTIIMKNQSKSLAEKSIKPEMPKSAPEKSSSTVSKIDSVGPNRFQVLSYEQVKRLHRVIEKPLKLKPVSHSVLPVIEVSLRALLGEIKRKLKEVDVVIKDVRLDGTAAGCILNLNPNDDFRELNVIFTVSLHDMTSMQKIKNTIFSLLIDLLKKTLNSKPESLKHNFLINEELIKDNYIQKMTRVLCNQESNSDCWSLISLGTLEIGNETVELKFIDKMKRQYEFTIDSFQIVLDTMLAFYTVSKCSSITPNLFPTVVAESVSGSFQEAFKHLKENIISTKNPEEILGGGLLKYCGLLAVGFQQNSAMDIRATEKYMCSRFFIDYPDINVQRQKLESFLDSLVDSNYEIKINLLNVLYEVVSHSTVCLMTHERRQTLQMINSLSQNILSEIEIKKSTVQLDDLSSQNWVLDQVFYGTFYFPQQVYVTGPMNASQSNNINLGNISGNQILICTGDNTDFITTSNQIVSVNQATSAVIDSSSWIGGYQNQNNQIYCCNGPLMCA 524          
BLAST of Terminal nucleotidyltransferase 5C vs. Planmine SMEST
Match: SMESG000079542.1 (SMESG000079542.1)

HSP 1 Score: 528.48 bits (1360), Expect = 0.000e+0
Identity = 306/437 (70.02%), Postives = 326/437 (74.60%), Query Frame = -2
Query:  686 FVALVLLVGFSYVHLSNTALDLSLDNINLRDIGNVIKSLLPTVQDIIKDLIKNLPDNKTNVKLKLNQRILLINENLLTLQNASVNEISNFIINEIRIHKETNVT*ISRPYLGNKISKVPPPK------LTSNHHLSKYENDGTQHLS*R*NKRDANN*RSHW*F*PSRSAN*KL**CFKLWSKISKYSFTSTN-------YR*EVIFERKTADNTSTGIDGIKYNDIAILDPEGKLLTLLYNKIITENIMPDVWKSFKTLMIPKPDKGDKYNXXXXXXXXXXXSVVYKIFASILARRLTSWVNRNNLLHIGQKGGSVHEGCVEHNSVLSSCLEHSKYSKDTPIIIAFLDIKDAFGSVPHDYMWKILRHIGVGEKFTNTLKLLYTETSSYYTCDPIVTPNIPIKQGVKQGCPLSMILFAIAINPVLQAVPLSKVKPFK 1957
             V+ +L+  F    + + ALDLSL+NINLRDIGNVIKSLLPTVQDIIKD IKNL DNKTNVKLKL+QRILLINENLLTLQNA+VNE                        + NKISKVP PK         N   + Y+      ++ R   +D     SH    P            K +  +  +   S N          EVIFE K ADNTS GIDGIKYNDIAI D EGKLLTLLYNKIITEN MPDVWKSFKTLM PKPDKGDKYNLISSW PI+LLSVVYKIFASIL+RRLTSWVNRNNLLHIGQKGGSVH+GCVEHNSVLSSCLEHSKYSKDTPIIIAFLDIKDAFGSVPHDYMWKILRHIGVGEKFTNTLKLLYTETSSYYTC PIVTPNIPIKQGVKQGCPLSMILFAIAINPVLQAV LSKVKPFK
Sbjct:  182 LVSRILICAF----IKHYALDLSLENINLRDIGNVIKSLLPTVQDIIKDSIKNLSDNKTNVKLKLDQRILLINENLLTLQNANVNE------------------------MRNKISKVPHPKTKFKSSFNQNMKTTVYKILVNDEINERPTIKDHIGNFSHQD--P----------LIKSYDNVLNFGLKSQNTLLLRPIIDKEVIFELKRADNTSPGIDGIKYNDIAIHDAEGKLLTLLYNKIITENTMPDVWKSFKTLMTPKPDKGDKYNLISSWRPIALLSVVYKIFASILSRRLTSWVNRNNLLHIGQKGGSVHDGCVEHNSVLSSCLEHSKYSKDTPIIIAFLDIKDAFGSVPHDYMWKILRHIGVGEKFTNTLKLLYTETSSYYTCGPIVTPNIPIKQGVKQGCPLSMILFAIAINPVLQAVTLSKVKPFK 578          

HSP 2 Score: 357.451 bits (916), Expect = 0.000e+0
Identity = 177/228 (77.63%), Postives = 187/228 (82.02%), Query Frame = -3
Query:    1 IGESSIEVLTYVDDIALIVNNTHDLQNILNIAFDVAREIGFEYRPEKCAYIQLPNVDTXXXXXXXXXXXXXXXXXEFYQYLGVPIGEQPNQSPYEILKKVISEAKKLADFDLCGWQK*KAYKNFLHSRLTFPFRSREIIISALSANVNNNTTKLRSHLRKMMSLPNNSEISYFYNSIENGGASCTDLLDEYHMQTPSHFFRLFTANCEFTKRINIDSLKFVTGPRLGN 684
            +GESSI+VL Y DDIALI NNTHDLQNILNIAFDVAREIGFEYRP+KCAYIQLPNV+T                          I E  NQSPYEIL KV+S+AKKLAD DLCGWQK KAYK FLHSRLTFPFR+R+  ISALSANV NNTTKLRSHLRKMMSLPNNSEISYFYNS+ENGGASCTDLLDEYH QT S+FFRLFTANCEFTKRINIDSLKFVTGPRLGN
Sbjct:  579 VGESSIQVLAYADDIALIANNTHDLQNILNIAFDVAREIGFEYRPKKCAYIQLPNVET--------------------------ISEHTNQSPYEILNKVVSDAKKLADSDLCGWQKLKAYKTFLHSRLTFPFRTRDFKISALSANVCNNTTKLRSHLRKMMSLPNNSEISYFYNSVENGGASCTDLLDEYHTQTISYFFRLFTANCEFTKRINIDSLKFVTGPRLGN 780          

HSP 3 Score: 201.06 bits (510), Expect = 1.331e-51
Identity = 117/136 (86.03%), Postives = 121/136 (88.97%), Query Frame = -1
Query: 1905 RKHFNKIFHQFELIRKFHFLNDTMTTAIVDDCTQYLNEFLNIENLMKAKIVFAIIAPPKARQILMIIDYNSDEHXXXXXXXXXXXXXXLCTANSLLTKINEIKETPELCKLLGNCPHDIRGSGLVSRILICAFIKH 2312
             K     F    L   F FLN+TMTTAI++DCTQYLNEFLNIENLMKAKIVFAIIAPPKARQILMIIDY SDE+YLLNPSSLLPNFPYLCTANSLLTKINEIKETPELCKLLGNCPHDIRGSGLVSRILICAFIKH
Sbjct:   59 EKLLTNFFINLNLSENFIFLNNTMTTAILNDCTQYLNEFLNIENLMKAKIVFAIIAPPKARQILMIIDYTSDEYYLLNPSSLLPNFPYLCTANSLLTKINEIKETPELCKLLGNCPHDIRGSGLVSRILICAFIKH 194          

HSP 4 Score: 149.443 bits (376), Expect = 1.187e-35
Identity = 72/77 (93.51%), Postives = 74/77 (96.10%), Query Frame = -2
Query: 2255 MFSDDPIHHATTFILFLEEFISGNVVNRDKVIEKLVNMQSKMCDEVVVNLNLINCKITENILTKFFINLNLSENFIF 2485
            MFSDDPIHHA+TFILFLEEFISGNVVNRDKVIEKLVNMQSKMCDEVVVNLNL NCKITE +LT FFINLNLSENFIF
Sbjct:    1 MFSDDPIHHASTFILFLEEFISGNVVNRDKVIEKLVNMQSKMCDEVVVNLNLKNCKITEKLLTNFFINLNLSENFIF 77          

HSP 5 Score: 117.087 bits (292), Expect = 1.011e-25
Identity = 58/69 (84.06%), Postives = 60/69 (86.96%), Query Frame = -3
Query: 1363 QNMKTTVLNILVNDEINEMPTIKDHIGNFSHQDQLIKSYDNVLNFGLKSQNTLLLRPIIDKRLFLNGKQ 1569
            QNMKTTV  ILVNDEINE PTIKDHIGNFSHQD LIKSYDNVLNFGLKSQNTLLLRPIIDK +    K+
Sbjct:  284 QNMKTTVYKILVNDEINERPTIKDHIGNFSHQDPLIKSYDNVLNFGLKSQNTLLLRPIIDKEVIFELKR 352          
BLAST of Terminal nucleotidyltransferase 5C vs. Planmine SMEST
Match: SMESG000021486.1 (SMESG000021486.1)

HSP 1 Score: 345.125 bits (884), Expect = 0.000e+0
Identity = 166/233 (71.24%), Postives = 201/233 (86.27%), Query Frame = -2
Query:  689 EVIFERKTADNTSTGIDGIKYNDIAILDPEGKLLTLLYNKIITENIMPDVWKSFKTLMIPKPDKGDKYNXXXXXXXXXXXSVVYKIFASILARRLTSWVNRNNLLHIGQKGGSVHEGCVEHNSVLSSCLEHSKYSKDTPIIIAFLDIKDAFGSVPHDYMWKILRHIGVGEKFTNTLKLLYTETSSYYTCDPIVTPNIPIKQGVKQGCPLSMILFAIAINPVLQAVPLSKVKPF 1387
            E++F+ K ADNTS GIDGI+Y D+ +LDPEGKLLT L+NKII   I+PD WKSFKTL+ PKP+K  KY+ +SSW PI+LLSV+YK+FAS LA RLT W+N NNLLHIGQKGGS H+GCVEHNS+LS+ LEHSKYSK+ P+ IA+LDIKDAFGSVPHDYMW +LR IGVGE FT+ L+LLY++TS++Y+C PI+TPNIPIKQGVKQGCP+SMILFA+AINPVL+AV  S  +PF
Sbjct: 3060 EIMFQLKRADNTSPGIDGIQYRDLLLLDPEGKLLTFLFNKIIVNKIIPDSWKSFKTLLTPKPNKDGKYDDVSSWRPIALLSVIYKVFASCLASRLTYWINTNNLLHIGQKGGSRHDGCVEHNSILSAALEHSKYSKNCPLAIAWLDIKDAFGSVPHDYMWSLLRFIGVGEDFTSILQLLYSDTSTFYSCGPILTPNIPIKQGVKQGCPISMILFALAINPVLEAVSRSDCEPF 3292          

HSP 2 Score: 345.125 bits (884), Expect = 0.000e+0
Identity = 166/233 (71.24%), Postives = 201/233 (86.27%), Query Frame = -2
Query:  689 EVIFERKTADNTSTGIDGIKYNDIAILDPEGKLLTLLYNKIITENIMPDVWKSFKTLMIPKPDKGDKYNXXXXXXXXXXXSVVYKIFASILARRLTSWVNRNNLLHIGQKGGSVHEGCVEHNSVLSSCLEHSKYSKDTPIIIAFLDIKDAFGSVPHDYMWKILRHIGVGEKFTNTLKLLYTETSSYYTCDPIVTPNIPIKQGVKQGCPLSMILFAIAINPVLQAVPLSKVKPF 1387
            E++F+ K ADNTS GIDGI+Y D+ +LDPEGKLLT L+NKII   I+PD WKSFKTL+ PKP+K  KY+ +SSW PI+LLSV+YK+FAS LA RLT W+N NNLLHIGQKGGS H+GCVEHNS+LS+ LEHSKYSK+ P+ IA+LDIKDAFGSVPHDYMW +LR IGVGE FT+ L+LLY++TS++Y+C PI+TPNIPIKQGVKQGCP+SMILFA+AINPVL+AV  S  +PF
Sbjct: 5416 EIMFQLKRADNTSPGIDGIQYRDLLLLDPEGKLLTFLFNKIIVNKIIPDSWKSFKTLLTPKPNKDGKYDDVSSWRPIALLSVIYKVFASCLASRLTYWINTNNLLHIGQKGGSRHDGCVEHNSILSAALEHSKYSKNCPLAIAWLDIKDAFGSVPHDYMWSLLRFIGVGEDFTSILQLLYSDTSTFYSCGPILTPNIPIKQGVKQGCPISMILFALAINPVLEAVSRSDCEPF 5648          

HSP 3 Score: 290.041 bits (741), Expect = 0.000e+0
Identity = 152/233 (65.24%), Postives = 182/233 (78.11%), Query Frame = -3
Query:    4 IGESSIEVLTYVDDIALIVNNTHDLQNILNIAFDVAREIGFEYRPEKCAYIQLPNVDTXXXXXXXXXXXXXXXXXEFYQYLGVPIGEQPNQSPYEILKKVISEAKKLADFDLCGWQK*KAYKNFLHSRLTFPFRSREIIISALS-ANVNNN-----TTKLRSHLRKMMSLPNNSEISYFYNSIENGGASCTDLLDEYHMQTPSHFFRLFTANCEFTKRINIDSLKFVTGPRLG 684
            IGES +++L Y DDIALI  +  DLQ I NIA   A EIGFEYRPEKC Y+QLP V   SEI INN KIKKLLSKEFYQYLGVP+GE+P+QSPY+IL K +S+ +KLA+ +L GWQK KAYK F+HSRL FPFR+REI   ALS +N NNN     +++LR   RKM+ LPN SE+SYFYN+ E GGA+C DLLDEYH QT +HFFRL T+ C++ ++INIDSLKFVTGPRLG
Sbjct: 3294 IGESPVKILAYADDIALIAKSVEDLQKITNIAVRTAAEIGFEYRPEKCGYLQLPKVHIDSEILINNTKIKKLLSKEFYQYLGVPVGEEPDQSPYDILDKAVSDTRKLANSELLGWQKLKAYKIFVHSRLIFPFRTREIKTGALSKSNGNNNRSVNISSQLRGCFRKMLCLPNQSEVSYFYNATEKGGANCVDLLDEYHTQTITHFFRLLTSECDYARQINIDSLKFVTGPRLG 3526          

HSP 4 Score: 290.041 bits (741), Expect = 0.000e+0
Identity = 152/233 (65.24%), Postives = 182/233 (78.11%), Query Frame = -3
Query:    4 IGESSIEVLTYVDDIALIVNNTHDLQNILNIAFDVAREIGFEYRPEKCAYIQLPNVDTXXXXXXXXXXXXXXXXXEFYQYLGVPIGEQPNQSPYEILKKVISEAKKLADFDLCGWQK*KAYKNFLHSRLTFPFRSREIIISALS-ANVNNN-----TTKLRSHLRKMMSLPNNSEISYFYNSIENGGASCTDLLDEYHMQTPSHFFRLFTANCEFTKRINIDSLKFVTGPRLG 684
            IGES +++L Y DDIALI  +  DLQ I NIA   A EIGFEYRPEKC Y+QLP V   SEI INN KIKKLLSKEFYQYLGVP+GE+P+QSPY+IL K +S+ +KLA+ +L GWQK KAYK F+HSRL FPFR+REI   ALS +N NNN     +++LR   RKM+ LPN SE+SYFYN+ E GGA+C DLLDEYH QT +HFFRL T+ C++ ++INIDSLKFVTGPRLG
Sbjct: 5650 IGESPVKILAYADDIALIAKSVEDLQKITNIAVRTAAEIGFEYRPEKCGYLQLPKVHIDSEILINNTKIKKLLSKEFYQYLGVPVGEEPDQSPYDILDKAVSDTRKLANSELLGWQKLKAYKIFVHSRLIFPFRTREIKTGALSKSNGNNNRSVNISSQLRGCFRKMLCLPNQSEVSYFYNATEKGGANCVDLLDEYHTQTITHFFRLLTSECDYARQINIDSLKFVTGPRLG 5882          

HSP 5 Score: 51.9878 bits (123), Expect = 0.000e+0
Identity = 44/120 (36.67%), Postives = 65/120 (54.17%), Query Frame = -2
Query: 1616 FVALVLLVGFSYVHLSNTALDLSLDNINLRDIGNVIKSLLPTVQD----IIKDLIKNLPDNKTNVKLKLNQRILLINENLLTLQNASVNEISNFIINEI--RIHKETNVT*ISRPYLGNK 1957
             V+ +L+  F    + N A DL L N+NLR+IG  I SLLP + +    ++ DL K     K+N  L L QR L I+E L  + + +VNEI + I+ +   R+  +       +PYLGNK
Sbjct: 2875 LVSKLLICAF----IKNYANDLPLINLNLREIGTNISSLLPIISESKKILMSDLTKITKIKKSN--LNLEQRKLKIDELLHDVSHLTVNEIIDIIVRQFPDRVKSK------HKPYLGNK 2982          

HSP 6 Score: 51.9878 bits (123), Expect = 0.000e+0
Identity = 44/120 (36.67%), Postives = 65/120 (54.17%), Query Frame = -2
Query: 1616 FVALVLLVGFSYVHLSNTALDLSLDNINLRDIGNVIKSLLPTVQD----IIKDLIKNLPDNKTNVKLKLNQRILLINENLLTLQNASVNEISNFIINEI--RIHKETNVT*ISRPYLGNK 1957
             V+ +L+  F    + N A DL L N+NLR+IG  I SLLP + +    ++ DL K     K+N  L L QR L I+E L  + + +VNEI + I+ +   R+  +       +PYLGNK
Sbjct: 5231 LVSKLLICAF----IKNYANDLPLINLNLREIGTNISSLLPIISESKKILMSDLTKITKIKKSN--LNLEQRKLKIDELLHDVSHLTVNEIIDIIVRQFPDRVKSK------HKPYLGNK 5338          

HSP 7 Score: 23.8682 bits (50), Expect = 0.000e+0
Identity = 15/52 (28.85%), Postives = 27/52 (51.92%), Query Frame = -3
Query: 1411 NMKTTVLNILVNDEINEMPTIKDHIGNFSHQDQLIKSYDNVLNFGLKSQNTL 1566
            +MK TV  +  N  ++  PT +  + NF  +     +++N LNF  +S+  L
Sbjct: 3000 DMKWTVDKVFNNTNVSIRPTFQKIVLNFLIKSPFQGNWNNPLNFCKRSKQAL 3051          

HSP 8 Score: 23.8682 bits (50), Expect = 0.000e+0
Identity = 15/52 (28.85%), Postives = 27/52 (51.92%), Query Frame = -3
Query: 1411 NMKTTVLNILVNDEINEMPTIKDHIGNFSHQDQLIKSYDNVLNFGLKSQNTL 1566
            +MK TV  +  N  ++  PT +  + NF  +     +++N LNF  +S+  L
Sbjct: 5356 DMKWTVDKVFNNTNVSIRPTFQKIVLNFLIKSPFHGNWNNPLNFCKRSKQAL 5407          

HSP 9 Score: 492.271 bits (1266), Expect = 1.094e-153
Identity = 316/768 (41.15%), Postives = 448/768 (58.33%), Query Frame = -3
Query: 2524 RSQFHELLISFPELHELCFVGKMSKNSDEIIKLINAFKLNKNFPDEISFVGGKYLILNKINTSENPNFENSSDIMFNLGLLNFLQMSKDDMELRTLLNKPNTSEKVIDIIFXXXXXXXXXXXXXKTNGTYGDYALNYIRNCLLMYSIVDIESTPSLDPDHNETLISEMIDMIPXXXXXXXXXXXXXXXXRQWKLSGEIDRIHNIISPPTINNVNSSFDLLDKIFTVKSNQIQLLCEISNKSNNWNPDSSNVDEIKSKRLIYLAIRDKKKFLSSMKQSYRRLETCRKICTSKMSGFISQIIDSLVLFIQEKADVNQVEQFTTINLQTSSESRA--PVVQTSLCFIHESKILMVETPIVNIDNKVIETTNNLTTDIDEEPSHTLTIKNIYVKKMTTRKDVKLLKTTSK*RYVPASVSTPAARSNETDADCSFE-----------NFDFEFWFTDDDIDYYFETHIRNPKFAFLKCFVVSILCSNNSKDIFPIPNNIYEAQVILCPININNCHWILFVYCKVSCNSYFIEPVFKNKRKFENIERAHIINSELNNKFDLQNKITDHPHKILQYQNNNFDCGPYICAYAMIVCKEWYYFTVDFILNIRKKIYKIQSFHLIQNTKLSGGGISKDHFLNKINFXXXXXXXXXXXXXXXKETIKLTQKKACVSTLFKKWFENNLEVMVLSPAQTINLIAQNNIYIVAHVGFKQFXXXXXXXXXISNDNYWCLFLCSVCLGFSYIFDVRSSQNINGRLLGIGENIKDYLNKFILEKQ 4788
            RSQ  +L  SFPEL EL F  +   N+D+   LIN  K    FP++ISFVGGK++ LN+   S++   E  SDIMFN+GLLNF +M   D  LR+L ++P +SEK+IDIIF+LNYL LK  L + +NG+YGDY  NY+RNCL +YSI DIE+  +L  D  E     ++ MIP LSY++SS +ERLLRLRQWKLS EIDR+HNIISP TI ++NS    +DK++  K+ Q++ L  +SN  N    +S +    K+KR ++  IRDKKKFL   K SYR    CRKICT+ M+  I  II SL+L +         ++  +I L  +++S    P  Q+         I +VET       +       L  DIDE  S                              +  ++S  A  S ETDAD + +           + D   WFTDDDID Y + HI + +FA + CF+V IL +N  +D+FPIP  +++AQ+ILCP+NI+  HWILFVYCK S  SYFI+P+ + + +F N   A  +   LN  F+L+  +T HPH+   YQ N++DCGPYICAYAM++   W  F   FI  IRK+++++Q F   ++ K+SGGG+ K   + K N  +  +   +           L ++ +C+S+L  ++F+      VLSP  T+N++AQN  +I  +V F+QF GI  II I+ ND+ W LF+ S+ LG SYIF+    + +  RL+ IGEN+ +YLNKFI+  +
Sbjct: 4316 RSQMRDLFKSFPELAEL-FFSESDCNTDKFKNLINNLKSEHGFPEQISFVGGKFIKLNETKDSDHSQAEGESDIMFNIGLLNFHEMCLKDTTLRSLFSQPKSSEKIIDIIFHLNYLQLKGELKHTSNGSYGDYVCNYVRNCLSLYSISDIETYNTLSLDDIEKWAPSLVKMIPPLSYHSSSCKERLLRLRQWKLSSEIDRLHNIISPETIKHINSFLSEIDKVYPQKATQLKALQNLSNNINAIKSESDDETIAKAKRFLFFVIRDKKKFLLGSKYSYRIPLHCRKICTTNMTTHIFSIIQSLLLTLTVSDSEQIADRSDSITLVNTTQSVEINPGTQSGSIV----DISVVETG----STEHARVKRRLEVDIDEVES-----------------------------IIHTTISKSALISEETDADSTIKIIEINKPLNESDRDPTIWFTDDDIDLYLKNHISSLEFASINCFIVEILRTNPGEDLFPIPEKVFKAQIILCPLNIDKTHWILFVYCKNSLTSYFIDPILQYRHRFVNKTYALQVTMALNQLFNLKAAMTFHPHENFLYQENSYDCGPYICAYAMMISGVWQSFPDHFIDIIRKEVHQLQLFCQQKDQKVSGGGLPKFMEIIKRNGVRKTSSATQAF---------LLKQNSCISSLLDEYFKTRTNTTVLSPELTMNIVAQNLTFIRENVTFRQFTGIDHIISIVPNDSNWSLFVFSLVLGNSYIFNFH-DRIVTERLIAIGENMTEYLNKFIISNR 5035          

HSP 10 Score: 65.0846 bits (157), Expect = 1.094e-153
Identity = 35/96 (36.46%), Postives = 55/96 (57.29%), Query Frame = -2
Query: 2255 IYS*KTIIFKKSHTLFRFAMFSDDPIHHATTFILFLEEFISGNVVNRDKVIEKLVNMQSKMCDEVVVNLNLINCKITENILTKFFINLNLSENFIF 2542
            I S + +IF   H +   ++ SDD +  A+ FI+ +E  I    V+  +  E L +++ K  +E+ +NLN INCKI E I  K+F NL L+ NF+ 
Sbjct: 5031 IISNRKVIFISEHNIEHASITSDDSLLFASAFIILIESLIFSKQVSHTRTSEFLKSVKIKQANEICLNLNSINCKINEEITAKYFSNLKLNSNFML 5126          

HSP 11 Score: 31.187 bits (69), Expect = 1.094e-153
Identity = 16/35 (45.71%), Postives = 23/35 (65.71%), Query Frame = -2
Query: 4814 QNVLTDFFTKSQ-KYRNGDFIMLDI*NNHISDADI 4915
            Q  L D+  KS  KY +GDF+MLD+    +SD+D+
Sbjct: 4272 QRALPDYLMKSHIKYHDGDFVMLDL----LSDSDL 4302          

HSP 12 Score: 474.937 bits (1221), Expect = 1.983e-148
Identity = 310/768 (40.36%), Postives = 443/768 (57.68%), Query Frame = -3
Query: 2524 RSQFHELLISFPELHELCFVGKMSKNSDEIIKLINAFKLNKNFPDEISFVGGKYLILNKINTSENPNFENSSDIMFNLGLLNFLQMSKDDMELRTLLNKPNTSEKVIDIIFXXXXXXXXXXXXXKTNGTYGDYALNYIRNCLLMYSIVDIESTPSLDPDHNETLISEMIDMIPXXXXXXXXXXXXXXXXRQWKLSGEIDRIHNIISPPTINNVNSSFDLLDKIFTVKSNQIQLLCEISNKSNNWNPDSSNVDEIKSKRLIYLAIRDKKKFLSSMKQSYRRLETCRKICTSKMSGFISQIIDSLVLFIQEKADVNQVEQFTTINLQTSSESRA--PVVQTSLCFIHESKILMVETPIVNIDNKVIETTNNLTTDIDEEPSHTLTIKNIYVKKMTTRKDVKLLKTTSK*RYVPASVSTPAARSNETDADCSFE-----------NFDFEFWFTDDDIDYYFETHIRNPKFAFLKCFVVSILCSNNSKDIFPIPNNIYEAQVILCPININNCHWILFVYCKVSCNSYFIEPVFKNKRKFENIERAHIINSELNNKFDLQNKITDHPHKILQYQNNNFDCGPYICAYAMIVCKEWYYFTVDFILNIRKKIYKIQSFHLIQNTKLSGGGISKDHFLNKINFXXXXXXXXXXXXXXXKETIKLTQKKACVSTLFKKWFENNLEVMVLSPAQTINLIAQNNIYIVAHVGFKQFXXXXXXXXXISNDNYWCLFLCSVCLGFSYIFDVRSSQNINGRLLGIGENIKDYLNKFILEKQ 4788
            RSQ  +L  SFPEL EL F  +   N+D+   LIN  K    FP++ISFVGGK++ LN+   S++   E  SDIMFN+GLLNF +M   D  LR+L ++P +SEK+IDIIF+LNYL LK  L + +NG+YGDY  NY+RNCL +YSI DIE+  +L  D  E     ++ MIP LSY++SS +ERLLRLRQWKLS EIDR+HNIISP TI ++NS    +DK++  K+ Q++ L  +SN  N    +S +    K+KR ++  IRDKKKFL   K SYR    CRKICT+ M+  I  II SL+L +         ++  +I L  +++S    P  Q+         I +VET       +       L  DIDE  S                    ++ TTS  +     +S  A  S ETDAD + +           + D   WFTDDDID Y + HI + +FA + CF+V IL +N  +D+FPIP  +++AQ+ILCP+NI+  HWILFVYCK S  SYFI+P+ + + +F N   A  +   LN  F+L+  +T HPH+   YQ N++DCGPYICAYAM++   W  F   FI  IRK+++++Q F   ++ K+SGGG+ K   + K N  +  +   +           L ++ +C+S+L  ++F+      VLSP  T+N++AQ     ++H          +   I+ ND+ W LF+ S+ LG SYIF+    + +  RL+ IGEN+ +YLNKFI+  +
Sbjct: 1967 RSQMRDLFKSFPELAEL-FFSESDCNTDKFKNLINNLKSEHGFPEQISFVGGKFIKLNETKDSDHSQAEGESDIMFNIGLLNFHEMCLKDTTLRSLFSQPKSSEKIIDIIFHLNYLQLKGELKHTSNGSYGDYVCNYVRNCLSLYSISDIETYNTLSLDDIEKWAPSLVKMIPPLSYHSSSCKERLLRLRQWKLSSEIDRLHNIISPETIKHINSFLSEIDKVYPQKATQLKALQNLSNNINAIKSESDDETIAKAKRFLFFVIRDKKKFLLGSKYSYRIPLHCRKICTTNMTTHIFSIIQSLLLTLTVSDSEQIADRSDSITLVNTTQSVEINPGTQSGSIV----DISVVETG----STEHARVKRRLEVDIDEVES--------------------IIHTTSGTQQ--NHISKSALISKETDADSTIKIIEINKPLNESDRDPTIWFTDDDIDLYLKNHISSLEFASINCFIVEILRTNPGEDLFPIPEKVFKAQIILCPLNIDKTHWILFVYCKNSLTSYFIDPILQYRHRFVNKTYALQVTMALNQLFNLKAAMTFHPHENFLYQENSYDCGPYICAYAMMISGVWQSFPDHFIDIIRKEVHQLQLFCQQKDQKVSGGGLPKFMEIIKRNGVRKTSSATQAF---------LLKQNSCISSLLDEYFKTRTNTTVLSPELTMNIVAQ-----ISH---------SLEKIIVPNDSNWSLFVFSLVLGNSYIFNFH-DRIVTERLIAIGENMTEYLNKFIISNR 2679          

HSP 13 Score: 65.0846 bits (157), Expect = 1.983e-148
Identity = 35/96 (36.46%), Postives = 55/96 (57.29%), Query Frame = -2
Query: 2255 IYS*KTIIFKKSHTLFRFAMFSDDPIHHATTFILFLEEFISGNVVNRDKVIEKLVNMQSKMCDEVVVNLNLINCKITENILTKFFINLNLSENFIF 2542
            I S + +IF   H +   ++ SDD +  A+ FI+ +E  I    V+  +  E L +++ K  +E+ +NLN INCKI E I  K+F NL L+ NF+ 
Sbjct: 2675 IISNRKVIFISEHNIEHASITSDDSLLFASAFIILIESLIFSKQVSHTRTSEFLKSVKIKQANEICLNLNSINCKINEEITAKYFSNLKLNSNFML 2770          

HSP 14 Score: 31.187 bits (69), Expect = 1.983e-148
Identity = 16/35 (45.71%), Postives = 23/35 (65.71%), Query Frame = -2
Query: 4814 QNVLTDFFTKSQ-KYRNGDFIMLDI*NNHISDADI 4915
            Q  L D+  KS  KY +GDF+MLD+    +SD+D+
Sbjct: 1923 QRALPDYLMKSHIKYHDGDFVMLDL----LSDSDL 1953          

HSP 15 Score: 274.248 bits (700), Expect = 3.812e-98
Identity = 147/233 (63.09%), Postives = 179/233 (76.82%), Query Frame = -3
Query:    4 IGESSIEVLTYVDDIALIVNNTHDLQNILNIAFDVAREIGFEYRPEKCAYIQLPNVDTXXXXXXXXXXXXXXXXXEFYQYLGVPIGEQPNQSPYEILKKVISEAKKLADFDLCGWQK*KAYKNFLHSRLTFPFRSREIIISALS-----ANVN-NNTTKLRSHLRKMMSLPNNSEISYFYNSIENGGASCTDLLDEYHMQTPSHFFRLFTANCEFTKRINIDSLKFVTGPRLG 684
            IG SS++VL Y DDIALI  N+ DLQ + ++A + A  IGFEYRPEKCAYIQ P V+T+SEI +NN+ IKKL S EFYQYLGVPIG+  +QSPYEI+ KVI + KK+A  +L GWQK KAYK FLHSRL FPFR+REI  S+L+     + +N NNT++LR HLRK+++LPN+SEISYFYNS ENGGA C DLLDEYH QT  +FFRL T+ C ++K IN  SL  VT PRLG
Sbjct:  975 IGTSSVQVLAYADDIALIATNSSDLQTLFDLAVNTANMIGFEYRPEKCAYIQYPKVETVSEIIVNNVLIKKLASNEFYQYLGVPIGDNNDQSPYEIVSKVIEDTKKIAHSNLYGWQKLKAYKIFLHSRLIFPFRTREIKTSSLADPSRNSRINVNNTSQLRGHLRKILNLPNHSEISYFYNSTENGGAGCIDLLDEYHAQTIVYFFRLLTSTCGYSKTINTFSLLSVTSPRLG 1207          

HSP 16 Score: 106.686 bits (265), Expect = 3.812e-98
Identity = 46/72 (63.89%), Postives = 60/72 (83.33%), Query Frame = -2
Query:  689 ILRHIGVGEKFTNTLKLLYTETSSYYTCDPIVTPNIPIKQGVKQGCPLSMILFAIAINPVLQAVPLSKVKPF 904
            +L+H+ V  +F N L+LLYT+TSS+Y C+ + TP+IPIK+GVKQGCP+SMILFAIAINPVL+A+ LS   PF
Sbjct:  902 LLKHMNVSAEFVNILQLLYTDTSSFYQCNQMQTPDIPIKKGVKQGCPISMILFAIAINPVLEAISLSNTTPF 973          

HSP 17 Score: 299.671 bits (766), Expect = 3.050e-88
Identity = 211/519 (40.66%), Postives = 303/519 (58.38%), Query Frame = -3
Query: 2521 EIKSKRLIYLAIRDKKKFLSSMKQSYRRLETCRKICTSKMSGFISQIIDSLVLFIQEKADVNQVEQFTTIN--LQTSSESRAPVVQTSLCF----IHESKILMVETPIVNI-DN------KVIETTNNLT--TDIDEEPSHTLTIKNIYVKKMTTRKDVKLLKTTSK*RYVPASVSTPAARSNETDADCSFENFDFEFWFTDDDIDYYFETHIRNPKFAFLKCFVVSILCSNNSKDIFPIPNNIYEAQVILCPININNCHWILFVYCKVSCNSYFIEPVFKNKRKFENIERAHIINSELNNKFDLQNKITDHPHKILQYQNNNFDCGPYICAYAMIVCKEWYYFTVDFILNIRKKIYKIQSFHLIQNTKLSGGGISKDHFLNKINFXXXXXXXXXXXXXXXKETIKLTQKKACVSTLFKKWFENNLEVMVLSPAQTINLIAQNNIYIVAHVGFKQFXXXXXXXXXISNDNYWCLFLCSVCLGFSYIFDVRSSQNINGRLLGIGENIKDYLNKFILEKQL 4032
            ++KSKR IY  +RD KK+L    Q++R  ETC K CTS+MS  IS II  L   +    DV+ +EQ   ++  ++    ++  V++   C     I E  IL+ E   VNI +N       V+E  +N +  T+ + +   T  I N   K+   R  VK  K  SK             +S   +   + +N D E WF+D+DID+Y ETHI NP   ++KCF+V+ILCSN  +++  IP +I  A+++ CP+NINN HWILFVYCK S +SYFI+P+ KN+    N + A  IN  LN  F+L+  ++ +PHK LQYQNNNFDCGP+ CAYA+I+ K+   F   FI  IR+ +++ Q   ++ N  L GG  +K   ++  NFKKA+A    + N      I L  +  CVS++  K++ENN +V VLS   T+NLIAQNN +I  +V FKQFKGI  I+ +I   N WCLF+ S+ L  S+IFD  + + I+ RL+ IG  I DYLN+F L + +
Sbjct:   15 DVKSKRFIYFLLRDSKKYLIR-NQTFRLFETCNKYCTSEMSQQISLIITKLKPIVINVKDVDLIEQDCDLDKPIENIDITKPIVIEEIHCMKCNSILEKCILVREGMNVNICENCLLDAISVVEPDSNESNQTNSNHDSPITENIINPPTKRTGQRNTVK--KQPSK------------PKSTICNKYLTIDNRDPEIWFSDNDIDWYLETHIDNPMHGYIKCFIVNILCSNIQEEVVAIPRSISNAEMVFCPLNINNSHWILFVYCKKSHSSYFIDPILKNRNNLINKQMALKINIALNRFFNLKIAVSYNPHKNLQYQNNNFDCGPFTCAYAVIISKDLDNFPDGFIDEIRRDVHRNQ-MEIVGN--LIGGAKTKMD-MSSFNFKKAIAKTKYSNNNPNTSNI-LKSQMPCVSSIICKYYENNCKVSVLSAELTLNLIAQNNSFIADNVTFKQFKGIDHILCVIPKFNDWCLFIYSIKLKHSHIFDF-NYRTIDDRLIEIGVKITDYLNQFCLNRNV 512          

HSP 18 Score: 48.521 bits (114), Expect = 3.050e-88
Identity = 28/92 (30.43%), Postives = 52/92 (56.52%), Query Frame = -2
Query: 2255 KTIIFKKSHTLFRFAMFSDDPIHHATTFILFLEEFISGNVVNRDKVIEKLVNMQSKMCDEVVVNLNLINCKITENILTKFFINLNLSENFIF 2530
            + + F  +H +      S D  + A+ FI+  E+ +    ++ DKV + L  ++++ C E+   LNLIN KIT+ I+ ++F  L LS+++I 
Sbjct:  510 RNVKFLANHHISHSTFLSYDTQYFASHFIVLFEKLVYEIHLDCDKVYDSLSKIKTETCIEISPGLNLINGKITDKIIFEYFNKLKLSDDYIL 601          

HSP 19 Score: 131.339 bits (329), Expect = 1.117e-29
Identity = 71/131 (54.20%), Postives = 96/131 (73.28%), Query Frame = -1
Query: 1905 KIFHQFELIRKFHFLNDTMTTAIVDDCTQYLNEFLNIENLMKAKIVFAIIAPPKARQILMIIDYNSDEHXXXXXXXXXXXXXXLCTANSLLTKINEIKETPELCKLLGNCPHDIRGSGLVSRILICAFIKH 2297
            K F   +L   F  LN+TM TAI+DDCT++L +FLN E+L+KA+++FAIIAPPK R+IL+IIDY +DE+Y++NP++L               KINEIKETP     +G+ P+DIRGSGLVS++LICAFIK+
Sbjct: 2757 KYFSNLKLNSNFMLLNETMCTAILDDCTRHLTKFLNYEDLIKAQVIFAIIAPPKHREILLIIDYITDEYYIINPTTLCGTESSQSVCRIFRNKINEIKETPGRVINMGDIPNDIRGSGLVSKLLICAFIKN 2887          

HSP 20 Score: 131.339 bits (329), Expect = 1.117e-29
Identity = 71/131 (54.20%), Postives = 96/131 (73.28%), Query Frame = -1
Query: 1905 KIFHQFELIRKFHFLNDTMTTAIVDDCTQYLNEFLNIENLMKAKIVFAIIAPPKARQILMIIDYNSDEHXXXXXXXXXXXXXXLCTANSLLTKINEIKETPELCKLLGNCPHDIRGSGLVSRILICAFIKH 2297
            K F   +L   F  LN+TM TAI+DDCT++L +FLN E+L+KA+++FAIIAPPK R+IL+IIDY +DE+Y++NP++L               KINEIKETP     +G+ P+DIRGSGLVS++LICAFIK+
Sbjct: 5113 KYFSNLKLNSNFMLLNETMCTAILDDCTRHLTKFLNYEDLIKAQVIFAIIAPPKHREILLIIDYITDEYYIINPTTLCGTESSQSVCRIFRNKINEIKETPGRVINMGDIPNDIRGSGLVSKLLICAFIKN 5243          

HSP 21 Score: 121.324 bits (303), Expect = 9.836e-27
Identity = 62/129 (48.06%), Postives = 92/129 (71.32%), Query Frame = -1
Query: 1905 FHQFELIRKFHFLNDTMTTAIVDDCTQYLNEFLNIENLMKAKIVFAIIAPPKARQILMIIDYNSDEHXXXXXXXXXXXXXXLCTANSLLTKINEIKETPELCKLLGNCPHDIRGSGLVSRILICAFIKH 2291
            F++ +L   +  LN T+  AI DDCTQY+ +FLNIE +MKA ++FAII+PPK  ++L++IDY+++EHY L+P +   N        ++L KINE++E+       G+C HDIRGSGL+S+ILICAFI++
Sbjct:  590 FNKLKLSDDYILLNKTLCVAISDDCTQYMKDFLNIECMMKANVIFAIISPPKVHELLLVIDYSTEEHYYLSPVTTDLNVVSQHFCYNILIKINELRESKGRAMKTGHCRHDIRGSGLLSKILICAFIRN 718          

HSP 22 Score: 48.9062 bits (115), Expect = 1.124e-10
Identity = 38/114 (33.33%), Postives = 58/114 (50.88%), Query Frame = -2
Query: 1622 FVALVLLVGFSYVHLSNTALDLSLDNINLRDIGNVIKSLLPTV--QDIIKDLIKNLPDNKTNVKLKLNQRILLINENLLTLQNASVNEISNFIINEIRIHKETNVT*ISRPYLG 1957
             ++ +L+  F    + N ALD SL+NINL +IG ++ SL+P V   D +K   +        +KL L QR   IN+ L+ L ++ V+EI   I+  I   +         PYLG
Sbjct:  706 LLSKILICAF----IRNYALDYSLENINLHEIGKIVNSLVPIVDGSDNVKYEKREKLKAANTLKLNLKQRKEKINQLLIKLSDSDVDEIICTILTNIPRLENLQKKEFREPYLG 815          

HSP 23 Score: 38.891 bits (89), Expect = 1.124e-10
Identity = 27/87 (31.03%), Postives = 43/87 (49.43%), Query Frame = -3
Query: 1306 NMKTTVLNILVNDEINEMPTIKDHIGNFSHQDQLIKSYDNVLNFGLKSQNTLLLRPIIDKRLFLNGKQLIIHLLELMELNITILLFL 1566
            NMKTTV  IL +  +   P  ++ I NF+H D + + +DNVL F   S   L L  I  + +  N +  ++  + +    + IL  L
Sbjct:  833 NMKTTVYRILNDQSVKIEPPFQEIINNFTHPDVVPECWDNVLKFSKISDELLELTYISSEEILSNLQNTLLKHMNVSAEFVNILQLL 919          
BLAST of Terminal nucleotidyltransferase 5C vs. Planmine SMEST
Match: SMESG000021486.1 (SMESG000021486.1)

HSP 1 Score: 344.739 bits (883), Expect = 0.000e+0
Identity = 166/233 (71.24%), Postives = 201/233 (86.27%), Query Frame = -2
Query:  689 EVIFERKTADNTSTGIDGIKYNDIAILDPEGKLLTLLYNKIITENIMPDVWKSFKTLMIPKPDKGDKYNXXXXXXXXXXXSVVYKIFASILARRLTSWVNRNNLLHIGQKGGSVHEGCVEHNSVLSSCLEHSKYSKDTPIIIAFLDIKDAFGSVPHDYMWKILRHIGVGEKFTNTLKLLYTETSSYYTCDPIVTPNIPIKQGVKQGCPLSMILFAIAINPVLQAVPLSKVKPF 1387
            E++F+ K ADNTS GIDGI+Y D+ +LDPEGKLLT L+NKII   I+PD WKSFKTL+ PKP+K  KY+ +SSW PI+LLSV+YK+FAS LA RLT W+N NNLLHIGQKGGS H+GCVEHNS+LS+ LEHSKYSK+ P+ IA+LDIKDAFGSVPHDYMW +LR IGVGE FT+ L+LLY++TS++Y+C PI+TPNIPIKQGVKQGCP+SMILFA+AINPVL+AV  S  +PF
Sbjct: 3031 EIMFQLKRADNTSPGIDGIQYRDLLLLDPEGKLLTFLFNKIIVNKIIPDSWKSFKTLLTPKPNKDGKYDDVSSWRPIALLSVIYKVFASCLASRLTYWINTNNLLHIGQKGGSRHDGCVEHNSILSAALEHSKYSKNCPLAIAWLDIKDAFGSVPHDYMWSLLRFIGVGEDFTSILQLLYSDTSTFYSCGPILTPNIPIKQGVKQGCPISMILFALAINPVLEAVSRSDCEPF 3263          

HSP 2 Score: 344.739 bits (883), Expect = 0.000e+0
Identity = 166/233 (71.24%), Postives = 201/233 (86.27%), Query Frame = -2
Query:  689 EVIFERKTADNTSTGIDGIKYNDIAILDPEGKLLTLLYNKIITENIMPDVWKSFKTLMIPKPDKGDKYNXXXXXXXXXXXSVVYKIFASILARRLTSWVNRNNLLHIGQKGGSVHEGCVEHNSVLSSCLEHSKYSKDTPIIIAFLDIKDAFGSVPHDYMWKILRHIGVGEKFTNTLKLLYTETSSYYTCDPIVTPNIPIKQGVKQGCPLSMILFAIAINPVLQAVPLSKVKPF 1387
            E++F+ K ADNTS GIDGI+Y D+ +LDPEGKLLT L+NKII   I+PD WKSFKTL+ PKP+K  KY+ +SSW PI+LLSV+YK+FAS LA RLT W+N NNLLHIGQKGGS H+GCVEHNS+LS+ LEHSKYSK+ P+ IA+LDIKDAFGSVPHDYMW +LR IGVGE FT+ L+LLY++TS++Y+C PI+TPNIPIKQGVKQGCP+SMILFA+AINPVL+AV  S  +PF
Sbjct: 5358 EIMFQLKRADNTSPGIDGIQYRDLLLLDPEGKLLTFLFNKIIVNKIIPDSWKSFKTLLTPKPNKDGKYDDVSSWRPIALLSVIYKVFASCLASRLTYWINTNNLLHIGQKGGSRHDGCVEHNSILSAALEHSKYSKNCPLAIAWLDIKDAFGSVPHDYMWSLLRFIGVGEDFTSILQLLYSDTSTFYSCGPILTPNIPIKQGVKQGCPISMILFALAINPVLEAVSRSDCEPF 5590          

HSP 3 Score: 289.656 bits (740), Expect = 0.000e+0
Identity = 152/233 (65.24%), Postives = 182/233 (78.11%), Query Frame = -3
Query:    4 IGESSIEVLTYVDDIALIVNNTHDLQNILNIAFDVAREIGFEYRPEKCAYIQLPNVDTXXXXXXXXXXXXXXXXXEFYQYLGVPIGEQPNQSPYEILKKVISEAKKLADFDLCGWQK*KAYKNFLHSRLTFPFRSREIIISALS-ANVNNN-----TTKLRSHLRKMMSLPNNSEISYFYNSIENGGASCTDLLDEYHMQTPSHFFRLFTANCEFTKRINIDSLKFVTGPRLG 684
            IGES +++L Y DDIALI  +  DLQ I NIA   A EIGFEYRPEKC Y+QLP V   SEI INN KIKKLLSKEFYQYLGVP+GE+P+QSPY+IL K +S+ +KLA+ +L GWQK KAYK F+HSRL FPFR+REI   ALS +N NNN     +++LR   RKM+ LPN SE+SYFYN+ E GGA+C DLLDEYH QT +HFFRL T+ C++ ++INIDSLKFVTGPRLG
Sbjct: 3265 IGESPVKILAYADDIALIAKSVEDLQKITNIAVRTAAEIGFEYRPEKCGYLQLPKVHIDSEILINNTKIKKLLSKEFYQYLGVPVGEEPDQSPYDILDKAVSDTRKLANSELLGWQKLKAYKIFVHSRLIFPFRTREIKTGALSKSNGNNNRSVNISSQLRGCFRKMLCLPNQSEVSYFYNATEKGGANCVDLLDEYHTQTITHFFRLLTSECDYARQINIDSLKFVTGPRLG 3497          

HSP 4 Score: 289.656 bits (740), Expect = 0.000e+0
Identity = 152/233 (65.24%), Postives = 182/233 (78.11%), Query Frame = -3
Query:    4 IGESSIEVLTYVDDIALIVNNTHDLQNILNIAFDVAREIGFEYRPEKCAYIQLPNVDTXXXXXXXXXXXXXXXXXEFYQYLGVPIGEQPNQSPYEILKKVISEAKKLADFDLCGWQK*KAYKNFLHSRLTFPFRSREIIISALS-ANVNNN-----TTKLRSHLRKMMSLPNNSEISYFYNSIENGGASCTDLLDEYHMQTPSHFFRLFTANCEFTKRINIDSLKFVTGPRLG 684
            IGES +++L Y DDIALI  +  DLQ I NIA   A EIGFEYRPEKC Y+QLP V   SEI INN KIKKLLSKEFYQYLGVP+GE+P+QSPY+IL K +S+ +KLA+ +L GWQK KAYK F+HSRL FPFR+REI   ALS +N NNN     +++LR   RKM+ LPN SE+SYFYN+ E GGA+C DLLDEYH QT +HFFRL T+ C++ ++INIDSLKFVTGPRLG
Sbjct: 5592 IGESPVKILAYADDIALIAKSVEDLQKITNIAVRTAAEIGFEYRPEKCGYLQLPKVHIDSEILINNTKIKKLLSKEFYQYLGVPVGEEPDQSPYDILDKAVSDTRKLANSELLGWQKLKAYKIFVHSRLIFPFRTREIKTGALSKSNGNNNRSVNISSQLRGCFRKMLCLPNQSEVSYFYNATEKGGANCVDLLDEYHTQTITHFFRLLTSECDYARQINIDSLKFVTGPRLG 5824          

HSP 5 Score: 51.9878 bits (123), Expect = 0.000e+0
Identity = 44/120 (36.67%), Postives = 65/120 (54.17%), Query Frame = -2
Query: 1616 FVALVLLVGFSYVHLSNTALDLSLDNINLRDIGNVIKSLLPTVQD----IIKDLIKNLPDNKTNVKLKLNQRILLINENLLTLQNASVNEISNFIINEI--RIHKETNVT*ISRPYLGNK 1957
             V+ +L+  F    + N A DL L N+NLR+IG  I SLLP + +    ++ DL K     K+N  L L QR L I+E L  + + +VNEI + I+ +   R+  +       +PYLGNK
Sbjct: 2846 LVSKLLICAF----IKNYANDLPLINLNLREIGTNISSLLPIISESKKILMSDLTKITKIKKSN--LNLEQRKLKIDELLHDVSHLTVNEIIDIIVRQFPDRVKSK------HKPYLGNK 2953          

HSP 6 Score: 51.9878 bits (123), Expect = 0.000e+0
Identity = 44/120 (36.67%), Postives = 65/120 (54.17%), Query Frame = -2
Query: 1616 FVALVLLVGFSYVHLSNTALDLSLDNINLRDIGNVIKSLLPTVQD----IIKDLIKNLPDNKTNVKLKLNQRILLINENLLTLQNASVNEISNFIINEI--RIHKETNVT*ISRPYLGNK 1957
             V+ +L+  F    + N A DL L N+NLR+IG  I SLLP + +    ++ DL K     K+N  L L QR L I+E L  + + +VNEI + I+ +   R+  +       +PYLGNK
Sbjct: 5173 LVSKLLICAF----IKNYANDLPLINLNLREIGTNISSLLPIISESKKILMSDLTKITKIKKSN--LNLEQRKLKIDELLHDVSHLTVNEIIDIIVRQFPDRVKSK------HKPYLGNK 5280          

HSP 7 Score: 23.8682 bits (50), Expect = 0.000e+0
Identity = 15/52 (28.85%), Postives = 27/52 (51.92%), Query Frame = -3
Query: 1411 NMKTTVLNILVNDEINEMPTIKDHIGNFSHQDQLIKSYDNVLNFGLKSQNTL 1566
            +MK TV  +  N  ++  PT +  + NF  +     +++N LNF  +S+  L
Sbjct: 2971 DMKWTVDKVFNNTNVSIRPTFQKIVLNFLIKSPFQGNWNNPLNFCKRSKQAL 3022          

HSP 8 Score: 23.8682 bits (50), Expect = 0.000e+0
Identity = 15/52 (28.85%), Postives = 27/52 (51.92%), Query Frame = -3
Query: 1411 NMKTTVLNILVNDEINEMPTIKDHIGNFSHQDQLIKSYDNVLNFGLKSQNTL 1566
            +MK TV  +  N  ++  PT +  + NF  +     +++N LNF  +S+  L
Sbjct: 5298 DMKWTVDKVFNNTNVSIRPTFQKIVLNFLIKSPFHGNWNNPLNFCKRSKQAL 5349          

HSP 9 Score: 481.485 bits (1238), Expect = 1.902e-150
Identity = 311/757 (41.08%), Postives = 439/757 (57.99%), Query Frame = -3
Query: 2524 RSQFHELLISFPELHELCFVGKMSKNSDEIIKLINAFKLNKNFPDEISFVGGKYLILNKINTSENPNFENSSDIMFNLGLLNFLQMSKDDMELRTLLNKPNTSEKVIDIIFXXXXXXXXXXXXXKTNGTYGDYALNYIRNCLLMYSIVDIESTPSLDPDHNETLISEMIDMIPXXXXXXXXXXXXXXXXRQWKLSGEIDRIHNIISPPTINNVNSSFDLLDKIFTVKSNQIQLLCEISNKSNNWNPDSSNVDEIKSKRLIYLAIRDKKKFLSSMKQSYRRLETCRKICTSKMSGFISQIIDSLVLFIQEKADVNQVEQFTTINLQTSSESRA--PVVQTSLCFIHESKILMVETPIVNIDNKVIETTNNLTTDIDEEPSHTLTIKNIYVKKMTTRKDVKLLKTTSK*RYVPASVSTPAARSNETDADCSFENFDFEFWFTDDDIDYYFETHIRNPKFAFLKCFVVSILCSNNSKDIFPIPNNIYEAQVILCPININNCHWILFVYCKVSCNSYFIEPVFKNKRKFENIERAHIINSELNNKFDLQNKITDHPHKILQYQNNNFDCGPYICAYAMIVCKEWYYFTVDFILNIRKKIYKIQSFHLIQNTKLSGGGISKDHFLNKINFXXXXXXXXXXXXXXXKETIKLTQKKACVSTLFKKWFENNLEVMVLSPAQTINLIAQNNIYIVAHVGFKQFXXXXXXXXXISNDNYWCLFLCSVCLGFSYIFDVRSSQNINGRLLGIGENIKDYLNKFILEKQ 4788
            RSQ  +L  SFPEL EL F  +   N+D+   LIN  K    FP++ISFVGGK++ LN+   S++   E  SDIMFN+GLLNF +M   D  LR+L ++P +SEK+IDIIF+LNYL LK  L + +NG+YGDY  NY+RNCL +YSI DIE+  +L  D  E     ++ MIP LSY++SS +ERLLRLRQWKLS EIDR+HNIISP TI ++NS    +DK++  K+ Q++ L  +SN  N    +S +    K+KR ++  IRDKKKFL   K SYR    CRKICT+ M+  I  II SL+L +         ++  +I L  +++S    P  Q+         I +VET       +       L  DIDE  S                    ++ TT                           N D   WFTDDDID Y + HI + +FA + CF+V IL +N  +D+FPIP  +++AQ+ILCP+NI+  HWILFVYCK S  SYFI+P+ + + +F N   A  +   LN  F+L+  +T HPH+   YQ N++DCGPYICAYAM++   W  F   FI  IRK+++++Q F   ++ K+SGGG+ K   + K N  +  +   +           L ++ +C+S+L  ++F+      VLSP  T+N++AQN  +I  +V F+QF GI  II I+ ND+ W LF+ S+ LG SYIF+    + +  RL+ IGEN+ +YLNKFI+  +
Sbjct: 4287 RSQMRDLFKSFPELAEL-FFSESDCNTDKFKNLINNLKSEHGFPEQISFVGGKFIKLNETKDSDHSQAEGESDIMFNIGLLNFHEMCLKDTTLRSLFSQPKSSEKIIDIIFHLNYLQLKGELKHTSNGSYGDYVCNYVRNCLSLYSISDIETYNTLSLDDIEKWAPSLVKMIPPLSYHSSSCKERLLRLRQWKLSSEIDRLHNIISPETIKHINSFLSEIDKVYPQKATQLKALQNLSNNINAIKSESDDETIAKAKRFLFFVIRDKKKFLLGSKYSYRIPLHCRKICTTNMTTHIFSIIQSLLLTLTVSDSEQIADRSDSITLVNTTQSVEINPGTQSGSIV----DISVVETG----STEHARVKRRLEVDIDEVES--------------------IIHTT---------------------------NRDPTIWFTDDDIDLYLKNHISSLEFASINCFIVEILRTNPGEDLFPIPEKVFKAQIILCPLNIDKTHWILFVYCKNSLTSYFIDPILQYRHRFVNKTYALQVTMALNQLFNLKAAMTFHPHENFLYQENSYDCGPYICAYAMMISGVWQSFPDHFIDIIRKEVHQLQLFCQQKDQKVSGGGLPKFMEIIKRNGVRKTSSATQAF---------LLKQNSCISSLLDEYFKTRTNTTVLSPELTMNIVAQNLTFIRENVTFRQFTGIDHIISIVPNDSNWSLFVFSLVLGNSYIFNFH-DRIVTERLIAIGENMTEYLNKFIISNR 4977          

HSP 10 Score: 65.0846 bits (157), Expect = 1.902e-150
Identity = 35/96 (36.46%), Postives = 55/96 (57.29%), Query Frame = -2
Query: 2255 IYS*KTIIFKKSHTLFRFAMFSDDPIHHATTFILFLEEFISGNVVNRDKVIEKLVNMQSKMCDEVVVNLNLINCKITENILTKFFINLNLSENFIF 2542
            I S + +IF   H +   ++ SDD +  A+ FI+ +E  I    V+  +  E L +++ K  +E+ +NLN INCKI E I  K+F NL L+ NF+ 
Sbjct: 4973 IISNRKVIFISEHNIEHASITSDDSLLFASAFIILIESLIFSKQVSHTRTSEFLKSVKIKQANEICLNLNSINCKINEEITAKYFSNLKLNSNFML 5068          

HSP 11 Score: 31.187 bits (69), Expect = 1.902e-150
Identity = 16/35 (45.71%), Postives = 23/35 (65.71%), Query Frame = -2
Query: 4814 QNVLTDFFTKSQ-KYRNGDFIMLDI*NNHISDADI 4915
            Q  L D+  KS  KY +GDF+MLD+    +SD+D+
Sbjct: 4243 QRALPDYLMKSHIKYHDGDFVMLDL----LSDSDL 4273          

HSP 12 Score: 466.463 bits (1199), Expect = 6.129e-146
Identity = 305/760 (40.13%), Postives = 436/760 (57.37%), Query Frame = -3
Query: 2524 RSQFHELLISFPELHELCFVGKMSKNSDEIIKLINAFKLNKNFPDEISFVGGKYLILNKINTSENPNFENSSDIMFNLGLLNFLQMSKDDMELRTLLNKPNTSEKVIDIIFXXXXXXXXXXXXXKTNGTYGDYALNYIRNCLLMYSIVDIESTPSLDPDHNETLISEMIDMIPXXXXXXXXXXXXXXXXRQWKLSGEIDRIHNIISPPTINNVNSSFDLLDKIFTVKSNQIQLLCEISNKSNNWNPDSSNVDEIKSKRLIYLAIRDKKKFLSSMKQSYRRLETCRKICTSKMSGFISQIIDSLVLFIQEKADVNQVEQFTTINLQTSSESRA--PVVQTSLCFIHESKILMVETPIVNIDNKVIETTNNLTTDID---EEPSHTLTIKNIYVKKMTTRKDVKLLKTTSK*RYVPASVSTPAARSNETDADCSFENFDFEFWFTDDDIDYYFETHIRNPKFAFLKCFVVSILCSNNSKDIFPIPNNIYEAQVILCPININNCHWILFVYCKVSCNSYFIEPVFKNKRKFENIERAHIINSELNNKFDLQNKITDHPHKILQYQNNNFDCGPYICAYAMIVCKEWYYFTVDFILNIRKKIYKIQSFHLIQNTKLSGGGISKDHFLNKINFXXXXXXXXXXXXXXXKETIKLTQKKACVSTLFKKWFENNLEVMVLSPAQTINLIAQNNIYIVAHVGFKQFXXXXXXXXXISNDNYWCLFLCSVCLGFSYIFDVRSSQNINGRLLGIGENIKDYLNKFILEKQ 4788
            RSQ  +L  SFPEL EL F  +   N+D+   LIN  K    FP++ISFVGGK++ LN+   S++   E  SDIMFN+GLLNF +M   D  LR+L ++P +SEK+IDIIF+LNYL LK  L + +NG+YGDY  NY+RNCL +YSI DIE+  +L  D  E     ++ MIP LSY++SS +ERLLRLRQWKLS EIDR+HNIISP TI ++NS    +DK++  K+ Q++ L  +SN  N    +S +    K+KR ++  IRDKKKFL   K SYR    CRKICT+ M+  I  II SL+L +         ++  +I L  +++S    P  Q+                IV+I   V+ET +     +    EE     TIK I + K                              NE+D D +        WFTDDDID Y + HI + +FA + CF+V IL +N  +D+FPIP  +++AQ+ILCP+NI+  HWILFVYCK S  SYFI+P+ + + +F N   A  +   LN  F+L+  +T HPH+   YQ N++DCGPYICAYAM++   W  F   FI  IRK+++++Q F   ++ K+SGGG+ K   + K N  +  +   +           L ++ +C+S+L  ++F+      VLSP  T+N++AQ     ++H          +   I+ ND+ W LF+ S+ LG SYIF+    + +  RL+ IGEN+ +YLNKFI+  +
Sbjct: 1967 RSQMRDLFKSFPELAEL-FFSESDCNTDKFKNLINNLKSEHGFPEQISFVGGKFIKLNETKDSDHSQAEGESDIMFNIGLLNFHEMCLKDTTLRSLFSQPKSSEKIIDIIFHLNYLQLKGELKHTSNGSYGDYVCNYVRNCLSLYSISDIETYNTLSLDDIEKWAPSLVKMIPPLSYHSSSCKERLLRLRQWKLSSEIDRLHNIISPETIKHINSFLSEIDKVYPQKATQLKALQNLSNNINAIKSESDDETIAKAKRFLFFVIRDKKKFLLGSKYSYRIPLHCRKICTTNMTTHIFSIIQSLLLTLTVSDSEQIADRSDSITLVNTTQSVEINPGTQSG--------------SIVDIS--VVETGSTEHARVKRRLEETDADSTIKIIEINKPL----------------------------NESDRDPT-------IWFTDDDIDLYLKNHISSLEFASINCFIVEILRTNPGEDLFPIPEKVFKAQIILCPLNIDKTHWILFVYCKNSLTSYFIDPILQYRHRFVNKTYALQVTMALNQLFNLKAAMTFHPHENFLYQENSYDCGPYICAYAMMISGVWQSFPDHFIDIIRKEVHQLQLFCQQKDQKVSGGGLPKFMEIIKRNGVRKTSSATQAF---------LLKQNSCISSLLDEYFKTRTNTTVLSPELTMNIVAQ-----ISH---------SLEKIIVPNDSNWSLFVFSLVLGNSYIFNFH-DRIVTERLIAIGENMTEYLNKFIISNR 2650          

HSP 13 Score: 65.0846 bits (157), Expect = 6.129e-146
Identity = 35/96 (36.46%), Postives = 55/96 (57.29%), Query Frame = -2
Query: 2255 IYS*KTIIFKKSHTLFRFAMFSDDPIHHATTFILFLEEFISGNVVNRDKVIEKLVNMQSKMCDEVVVNLNLINCKITENILTKFFINLNLSENFIF 2542
            I S + +IF   H +   ++ SDD +  A+ FI+ +E  I    V+  +  E L +++ K  +E+ +NLN INCKI E I  K+F NL L+ NF+ 
Sbjct: 2646 IISNRKVIFISEHNIEHASITSDDSLLFASAFIILIESLIFSKQVSHTRTSEFLKSVKIKQANEICLNLNSINCKINEEITAKYFSNLKLNSNFML 2741          

HSP 14 Score: 31.187 bits (69), Expect = 6.129e-146
Identity = 16/35 (45.71%), Postives = 23/35 (65.71%), Query Frame = -2
Query: 4814 QNVLTDFFTKSQ-KYRNGDFIMLDI*NNHISDADI 4915
            Q  L D+  KS  KY +GDF+MLD+    +SD+D+
Sbjct: 1923 QRALPDYLMKSHIKYHDGDFVMLDL----LSDSDL 1953          

HSP 15 Score: 274.248 bits (700), Expect = 5.141e-98
Identity = 147/233 (63.09%), Postives = 179/233 (76.82%), Query Frame = -3
Query:    4 IGESSIEVLTYVDDIALIVNNTHDLQNILNIAFDVAREIGFEYRPEKCAYIQLPNVDTXXXXXXXXXXXXXXXXXEFYQYLGVPIGEQPNQSPYEILKKVISEAKKLADFDLCGWQK*KAYKNFLHSRLTFPFRSREIIISALS-----ANVN-NNTTKLRSHLRKMMSLPNNSEISYFYNSIENGGASCTDLLDEYHMQTPSHFFRLFTANCEFTKRINIDSLKFVTGPRLG 684
            IG SS++VL Y DDIALI  N+ DLQ + ++A + A  IGFEYRPEKCAYIQ P V+T+SEI +NN+ IKKL S EFYQYLGVPIG+  +QSPYEI+ KVI + KK+A  +L GWQK KAYK FLHSRL FPFR+REI  S+L+     + +N NNT++LR HLRK+++LPN+SEISYFYNS ENGGA C DLLDEYH QT  +FFRL T+ C ++K IN  SL  VT PRLG
Sbjct:  975 IGTSSVQVLAYADDIALIATNSSDLQTLFDLAVNTANMIGFEYRPEKCAYIQYPKVETVSEIIVNNVLIKKLASNEFYQYLGVPIGDNNDQSPYEIVSKVIEDTKKIAHSNLYGWQKLKAYKIFLHSRLIFPFRTREIKTSSLADPSRNSRINVNNTSQLRGHLRKILNLPNHSEISYFYNSTENGGAGCIDLLDEYHAQTIVYFFRLLTSTCGYSKTINTFSLLSVTSPRLG 1207          

HSP 16 Score: 106.686 bits (265), Expect = 5.141e-98
Identity = 46/72 (63.89%), Postives = 60/72 (83.33%), Query Frame = -2
Query:  689 ILRHIGVGEKFTNTLKLLYTETSSYYTCDPIVTPNIPIKQGVKQGCPLSMILFAIAINPVLQAVPLSKVKPF 904
            +L+H+ V  +F N L+LLYT+TSS+Y C+ + TP+IPIK+GVKQGCP+SMILFAIAINPVL+A+ LS   PF
Sbjct:  902 LLKHMNVSAEFVNILQLLYTDTSSFYQCNQMQTPDIPIKKGVKQGCPISMILFAIAINPVLEAISLSNTTPF 973          

HSP 17 Score: 298.901 bits (764), Expect = 4.621e-88
Identity = 211/519 (40.66%), Postives = 303/519 (58.38%), Query Frame = -3
Query: 2521 EIKSKRLIYLAIRDKKKFLSSMKQSYRRLETCRKICTSKMSGFISQIIDSLVLFIQEKADVNQVEQFTTIN--LQTSSESRAPVVQTSLCF----IHESKILMVETPIVNI-DN------KVIETTNNLT--TDIDEEPSHTLTIKNIYVKKMTTRKDVKLLKTTSK*RYVPASVSTPAARSNETDADCSFENFDFEFWFTDDDIDYYFETHIRNPKFAFLKCFVVSILCSNNSKDIFPIPNNIYEAQVILCPININNCHWILFVYCKVSCNSYFIEPVFKNKRKFENIERAHIINSELNNKFDLQNKITDHPHKILQYQNNNFDCGPYICAYAMIVCKEWYYFTVDFILNIRKKIYKIQSFHLIQNTKLSGGGISKDHFLNKINFXXXXXXXXXXXXXXXKETIKLTQKKACVSTLFKKWFENNLEVMVLSPAQTINLIAQNNIYIVAHVGFKQFXXXXXXXXXISNDNYWCLFLCSVCLGFSYIFDVRSSQNINGRLLGIGENIKDYLNKFILEKQL 4032
            ++KSKR IY  +RD KK+L    Q++R  ETC K CTS+MS  IS II  L   +    DV+ +EQ   ++  ++    ++  V++   C     I E  IL+ E   VNI +N       V+E  +N +  T+ + +   T  I N   K+   R  VK  K  SK             +S   +   + +N D E WF+D+DID+Y ETHI NP   ++KCF+V+ILCSN  +++  IP +I  A+++ CP+NINN HWILFVYCK S +SYFI+P+ KN+    N + A  IN  LN  F+L+  ++ +PHK LQYQNNNFDCGP+ CAYA+I+ K+   F   FI  IR+ +++ Q   ++ N  L GG  +K   ++  NFKKA+A    + N      I L  +  CVS++  K++ENN +V VLS   T+NLIAQNN +I  +V FKQFKGI  I+ +I   N WCLF+ S+ L  S+IFD  + + I+ RL+ IG  I DYLN+F L + +
Sbjct:   15 DVKSKRFIYFLLRDSKKYLIR-NQTFRLFETCNKYCTSEMSQQISLIITKLKPIVINVKDVDLIEQDCDLDKPIENIDITKPIVIEEIHCMKCNSILEKCILVREGMNVNICENCLLDAISVVEPDSNESNQTNSNHDSPITENIINPPTKRTGQRNTVK--KQPSK------------PKSTICNKYLTIDNRDPEIWFSDNDIDWYLETHIDNPMHGYIKCFIVNILCSNIQEEVVAIPRSISNAEMVFCPLNINNSHWILFVYCKKSHSSYFIDPILKNRNNLINKQMALKINIALNRFFNLKIAVSYNPHKNLQYQNNNFDCGPFTCAYAVIISKDLDNFPDGFIDEIRRDVHRNQ-MEIVGN--LIGGAKTKMD-MSSFNFKKAIAKTKYSNNNPNTSNI-LKSQMPCVSSIICKYYENNCKVSVLSAELTLNLIAQNNSFIADNVTFKQFKGIDHILCVIPKFNDWCLFIYSIKLKHSHIFDF-NYRTIDDRLIEIGVKITDYLNQFCLNRNV 512          

HSP 18 Score: 48.521 bits (114), Expect = 4.621e-88
Identity = 28/92 (30.43%), Postives = 52/92 (56.52%), Query Frame = -2
Query: 2255 KTIIFKKSHTLFRFAMFSDDPIHHATTFILFLEEFISGNVVNRDKVIEKLVNMQSKMCDEVVVNLNLINCKITENILTKFFINLNLSENFIF 2530
            + + F  +H +      S D  + A+ FI+  E+ +    ++ DKV + L  ++++ C E+   LNLIN KIT+ I+ ++F  L LS+++I 
Sbjct:  510 RNVKFLANHHISHSTFLSYDTQYFASHFIVLFEKLVYEIHLDCDKVYDSLSKIKTETCIEISPGLNLINGKITDKIIFEYFNKLKLSDDYIL 601          

HSP 19 Score: 131.339 bits (329), Expect = 1.135e-29
Identity = 71/131 (54.20%), Postives = 96/131 (73.28%), Query Frame = -1
Query: 1905 KIFHQFELIRKFHFLNDTMTTAIVDDCTQYLNEFLNIENLMKAKIVFAIIAPPKARQILMIIDYNSDEHXXXXXXXXXXXXXXLCTANSLLTKINEIKETPELCKLLGNCPHDIRGSGLVSRILICAFIKH 2297
            K F   +L   F  LN+TM TAI+DDCT++L +FLN E+L+KA+++FAIIAPPK R+IL+IIDY +DE+Y++NP++L               KINEIKETP     +G+ P+DIRGSGLVS++LICAFIK+
Sbjct: 2728 KYFSNLKLNSNFMLLNETMCTAILDDCTRHLTKFLNYEDLIKAQVIFAIIAPPKHREILLIIDYITDEYYIINPTTLCGTESSQSVCRIFRNKINEIKETPGRVINMGDIPNDIRGSGLVSKLLICAFIKN 2858          

HSP 20 Score: 131.339 bits (329), Expect = 1.135e-29
Identity = 71/131 (54.20%), Postives = 96/131 (73.28%), Query Frame = -1
Query: 1905 KIFHQFELIRKFHFLNDTMTTAIVDDCTQYLNEFLNIENLMKAKIVFAIIAPPKARQILMIIDYNSDEHXXXXXXXXXXXXXXLCTANSLLTKINEIKETPELCKLLGNCPHDIRGSGLVSRILICAFIKH 2297
            K F   +L   F  LN+TM TAI+DDCT++L +FLN E+L+KA+++FAIIAPPK R+IL+IIDY +DE+Y++NP++L               KINEIKETP     +G+ P+DIRGSGLVS++LICAFIK+
Sbjct: 5055 KYFSNLKLNSNFMLLNETMCTAILDDCTRHLTKFLNYEDLIKAQVIFAIIAPPKHREILLIIDYITDEYYIINPTTLCGTESSQSVCRIFRNKINEIKETPGRVINMGDIPNDIRGSGLVSKLLICAFIKN 5185          

HSP 21 Score: 121.709 bits (304), Expect = 9.503e-27
Identity = 62/129 (48.06%), Postives = 92/129 (71.32%), Query Frame = -1
Query: 1905 FHQFELIRKFHFLNDTMTTAIVDDCTQYLNEFLNIENLMKAKIVFAIIAPPKARQILMIIDYNSDEHXXXXXXXXXXXXXXLCTANSLLTKINEIKETPELCKLLGNCPHDIRGSGLVSRILICAFIKH 2291
            F++ +L   +  LN T+  AI DDCTQY+ +FLNIE +MKA ++FAII+PPK  ++L++IDY+++EHY L+P +   N        ++L KINE++E+       G+C HDIRGSGL+S+ILICAFI++
Sbjct:  590 FNKLKLSDDYILLNKTLCVAISDDCTQYMKDFLNIECMMKANVIFAIISPPKVHELLLVIDYSTEEHYYLSPVTTDLNVVSQHFCYNILIKINELRESKGRAMKTGHCRHDIRGSGLLSKILICAFIRN 718          

HSP 22 Score: 48.9062 bits (115), Expect = 1.134e-10
Identity = 39/119 (32.77%), Postives = 60/119 (50.42%), Query Frame = -2
Query: 1607 FVALVLLVGFSYVHLSNTALDLSLDNINLRDIGNVIKSLLPTV--QDIIKDLIKNLPDNKTNVKLKLNQRILLINENLLTLQNASVNEISNFIINEIRIHKETNVT*ISRPYLGNKISK 1957
             ++ +L+  F    + N ALD SL+NINL +IG ++ SL+P V   D +K   +        +KL L QR   IN+ L+ L ++ V+EI   I+  I   +         PYLG   +K
Sbjct:  706 LLSKILICAF----IRNYALDYSLENINLHEIGKIVNSLVPIVDGSDNVKYEKREKLKAANTLKLNLKQRKEKINQLLIKLSDSDVDEIICTILTNIPRLENLQKKEFREPYLGKNHNK 820          

HSP 23 Score: 38.891 bits (89), Expect = 1.134e-10
Identity = 27/87 (31.03%), Postives = 43/87 (49.43%), Query Frame = -3
Query: 1306 NMKTTVLNILVNDEINEMPTIKDHIGNFSHQDQLIKSYDNVLNFGLKSQNTLLLRPIIDKRLFLNGKQLIIHLLELMELNITILLFL 1566
            NMKTTV  IL +  +   P  ++ I NF+H D + + +DNVL F   S   L L  I  + +  N +  ++  + +    + IL  L
Sbjct:  833 NMKTTVYRILNDQSVKIEPPFQEIINNFTHPDVVPECWDNVLKFSKISDELLELTYISSEEILSNLQNTLLKHMNVSAEFVNILQLL 919          
BLAST of Terminal nucleotidyltransferase 5C vs. Planmine SMEST
Match: SMESG000071441.1 (SMESG000071441.1)

HSP 1 Score: 342.428 bits (877), Expect = 1.874e-172
Identity = 186/234 (79.49%), Postives = 190/234 (81.20%), Query Frame = -2
Query:  686 EVIFERKTADNTSTGIDGIKYNDIAILDPEGKLLTLLYNKIITENIMPDVWKSFKTLMIPKPDKGDKYNXXXXXXXXXXXSVVYKIFASILARRLTSWVNRNNLLHIGQKGGSVHEGCVEHNSVLSSCLEHSKYSKDTPIIIAFLDIKDAFGSVPHDYMWKILRHIGVGEKFTNTLKLLYTETSSYYTCDPIVTPNIPIKQGVKQGCPLSMILFAIAINPVLQAVPLSKVKPFK 1387
            EVIFE K ADNTS GIDGI YNDIAILDPEGKLLTLLYNKIITEN MPDVWK FKTLMIPKPDKGDKYNLISSW PI+LLSVVYKIFASILARRLTSWVNRNNLLHIGQKGGSVH+GCVEHNSVL SCLEHSKYSKDTPIIIAFLDIKDAFGSVPHDYMWKILRHIGV                                 G ++GCPLSMILFAIAIN VLQAV LSKVKPFK
Sbjct:  105 EVIFELKRADNTSPGIDGIIYNDIAILDPEGKLLTLLYNKIITENTMPDVWKYFKTLMIPKPDKGDKYNLISSWRPITLLSVVYKIFASILARRLTSWVNRNNLLHIGQKGGSVHDGCVEHNSVLLSCLEHSKYSKDTPIIIAFLDIKDAFGSVPHDYMWKILRHIGVA--------------------------------GCQKGCPLSMILFAIAINSVLQAVTLSKVKPFK 306          

HSP 2 Score: 286.574 bits (732), Expect = 1.874e-172
Identity = 168/228 (73.68%), Postives = 173/228 (75.88%), Query Frame = -3
Query:    1 IGESSIEVLTYVDDIALIVNNTHDLQNILNIAFDVAREIGFEYRPEKCAYIQLPNVDTXXXXXXXXXXXXXXXXXEFYQYLGVPIGEQPNQSPYEILKKVISEAKKLADFDLCGWQK*KAYKNFLHSRLTFPFRSREIIISALSANVNNNTTKLRSHLRKMMSLPNNSEISYFYNSIENGGASCTDLLDEYHMQTPSHFFRLFTANCEFTKRINIDSLKFVTGPRLGN 684
            IGESSI+VL Y DDIALI NNTHDLQNILNIAFDVAREIGFEYRPEKCAYIQLPNVDTISEISI NIKIKKLLSKEFYQYLGVPIGEQPNQSPYEIL KV+S+AKKLAD DLCGWQK KAYK FLHSRLTFPFR+REI ISALSANV NNTTKLRSHLRKMMSLPNNSE                                             I+SLKFVTGPRLGN
Sbjct:  307 IGESSIQVLAYADDIALIANNTHDLQNILNIAFDVAREIGFEYRPEKCAYIQLPNVDTISEISIINIKIKKLLSKEFYQYLGVPIGEQPNQSPYEILNKVVSDAKKLADSDLCGWQKLKAYKTFLHSRLTFPFRTREIKISALSANVCNNTTKLRSHLRKMMSLPNNSE---------------------------------------------INSLKFVTGPRLGN 489          

HSP 3 Score: 169.474 bits (428), Expect = 2.632e-42
Identity = 96/107 (89.72%), Postives = 101/107 (94.39%), Query Frame = -1
Query: 1923 MTTAIVDDCTQYLNEFLNIENLMKAKIVFAIIAPPKARQILMIIDYNSDEHXXXXXXXXXXXXXXLCTANSLLTKINEIKETPELCKLLGNCPHDIRGSGLVSRILI 2243
            M TAI+DDCTQYLNEFLNIENLMKAK VFAIIAPPKARQILMIIDYNSDEHYLLNPS LLP+F YLCTANSLLTKINEIKETPELCKLLGNC HDIRGSGLV++ +I
Sbjct:    1 MITAILDDCTQYLNEFLNIENLMKAKTVFAIIAPPKARQILMIIDYNSDEHYLLNPSFLLPHFLYLCTANSLLTKINEIKETPELCKLLGNCSHDIRGSGLVNKEVI 107          
The following BLAST results are available for this feature:
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TENT5C1.161e-6840.40terminal nucleotidyltransferase 5C [Source:HGNC Sy... [more]
TENT5A2.477e-6641.16terminal nucleotidyltransferase 5A [Source:HGNC Sy... [more]
TENT5A3.125e-6641.16terminal nucleotidyltransferase 5A [Source:HGNC Sy... [more]
TENT5A9.438e-6641.83terminal nucleotidyltransferase 5A [Source:HGNC Sy... [more]
TENT5D1.036e-6540.28terminal nucleotidyltransferase 5D [Source:HGNC Sy... [more]
back to top
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pqn-443.091e-4534.47Prion-like-(Q/N-rich)-domain-bearing protein [Sou... [more]
pqn-443.091e-4534.47Prion-like-(Q/N-rich)-domain-bearing protein [Sou... [more]
pqn-443.828e-4534.47Prion-like-(Q/N-rich)-domain-bearing protein [Sou... [more]
pqn-443.898e-4534.47Prion-like-(Q/N-rich)-domain-bearing protein [Sou... [more]
pqn-445.789e-4534.47Prion-like-(Q/N-rich)-domain-bearing protein [Sou... [more]
back to top
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG463858.252e-7041.69gene:FBgn0286778 transcript:FBtr0474227[more]
CG463858.252e-7041.69gene:FBgn0286778 transcript:FBtr0474226[more]
CG463851.718e-6941.69gene:FBgn0286778 transcript:FBtr0474225[more]
CG463857.027e-6841.73gene:FBgn0286778 transcript:FBtr0474229[more]
CG463852.501e-6741.73gene:FBgn0286778 transcript:FBtr0474224[more]
back to top
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TENT5A3.783e-7041.21terminal nucleotidyltransferase 5Aa [Source:NCBI g... [more]
tent5ba7.602e-6941.09terminal nucleotidyltransferase 5ba [Source:ZFIN;A... [more]
tent5ab7.804e-6539.54terminal nucleotidyltransferase 5Ab [Source:ZFIN;A... [more]
tent5ab7.804e-6539.54terminal nucleotidyltransferase 5Ab [Source:ZFIN;A... [more]
tent5c1.321e-6440.87terminal nucleotidyltransferase 5C [Source:NCBI ge... [more]
back to top
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tent5b5.499e-7037.15terminal nucleotidyltransferase 5B [Source:NCBI ge... [more]
TENT5A4.239e-6940.82terminal nucleotidyltransferase 5A [Source:NCBI ge... [more]
ttk4.471e-6538.22TTK protein kinase [Source:Xenbase;Acc:XB-GENE-953... [more]
TENT5D4.326e-6336.64terminal nucleotidyltransferase 5D [Source:HGNC Sy... [more]
ENSXETT00000040456.11.861e-1834.10pep primary_assembly:Xenopus_tropicalis_v9.1:8:873... [more]
back to top
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tent5c8.359e-6940.40terminal nucleotidyltransferase 5C [Source:MGI Sym... [more]
Tent5a9.221e-6740.87terminal nucleotidyltransferase 5A [Source:MGI Sym... [more]
Tent5a1.185e-6640.87terminal nucleotidyltransferase 5A [Source:MGI Sym... [more]
Tent5d5.266e-6540.28terminal nucleotidyltransferase 5D [Source:MGI Sym... [more]
Tent5d5.266e-6540.28terminal nucleotidyltransferase 5D [Source:MGI Sym... [more]
back to top
BLAST of Terminal nucleotidyltransferase 5C vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5XIV0|TET5C_RAT4.874e-6840.73Terminal nucleotidyltransferase 5C OS=Rattus norve... [more]
sp|Q5VWP2|TET5C_HUMAN5.574e-6840.40Terminal nucleotidyltransferase 5C OS=Homo sapiens... [more]
sp|Q5SSF7|TET5C_MOUSE5.847e-6840.40Terminal nucleotidyltransferase 5C OS=Mus musculus... [more]
sp|Q4R8X4|TET5C_MACFA1.111e-6740.63Terminal nucleotidyltransferase 5C OS=Macaca fasci... [more]
sp|Q96IP4|TET5A_HUMAN1.189e-6541.16Terminal nucleotidyltransferase 5A OS=Homo sapiens... [more]
back to top
BLAST of Terminal nucleotidyltransferase 5C vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2T7P3E64.325e-8446.58Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A2C9JSY48.010e-8344.16Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A0B6Y0U58.447e-8344.82Uncharacterized protein OS=Arion vulgaris OX=10286... [more]
A0A3S1B8553.776e-8244.39Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
A0A210QHP43.555e-8045.71Protein FAM46C OS=Mizuhopecten yessoensis OX=6573 ... [more]
back to top
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tent5ba1.046e-7242.86protein FAM46A-like [Source:NCBI gene;Acc:10304678... [more]
tent5ab2.822e-6640.11protein FAM46A-like [Source:NCBI gene;Acc:10304232... [more]
tent5bb2.982e-6539.32protein FAM46A-like [Source:NCBI gene;Acc:10303698... [more]
tent5c9.080e-6539.71terminal nucleotidyltransferase 5C [Source:NCBI ge... [more]
TENT5A1.989e-6139.37terminal nucleotidyltransferase 5A [Source:HGNC Sy... [more]
back to top
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tent5ab9.140e-3937.14terminal nucleotidyltransferase 5Ab [Source:ZFIN;A... [more]
back to top
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO302952.695e-7342.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tent5ab4.133e-6840.87putative nucleotidyltransferase FAM46A [Source:NCB... [more]
tent5ba4.567e-6840.23terminal nucleotidyltransferase 5B [Source:NCBI ge... [more]
tent5bb2.630e-6740.28putative nucleotidyltransferase FAM46A [Source:NCB... [more]
TENT5A1.114e-6439.77terminal nucleotidyltransferase 5A [Source:NCBI ge... [more]
TENT5A1.114e-6439.77terminal nucleotidyltransferase 5A [Source:NCBI ge... [more]
back to top
BLAST of Terminal nucleotidyltransferase 5C vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000016756.10.000e+0100.00SMESG000016756.1[more]
SMESG000079542.11.331e-5170.02SMESG000079542.1[more]
SMESG000021486.11.094e-15371.24SMESG000021486.1[more]
SMESG000021486.11.902e-15071.24SMESG000021486.1[more]
SMESG000071441.11.874e-17279.49SMESG000071441.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024611 ID=SMED30024611|Name=Terminal nucleotidyltransferase 5C|organism=Schmidtea mediterranea sexual|type=transcript|length=8177bp
ATTCCCAAGCCTAGGTCCAGTGACAAATTTTAAAGAATCTATATTAATAC
GTTTTGTAAATTCACAATTAGCAGTAAAAAGTCTAAAAAAGTGGCTTGGA
GTTTGCATGTGATATTCATCCAAAAGGTCAGTGCAAGATGCGCCTCCATT
TTCAATCGAGTTATAAAAGTAACTGATTTCAGAATTGTTAGGTAAACTCA
TCATTTTTCTCAAATGACTACGAAGTTTTGTAGTATTATTATTTACATTT
GCAGAAAGAGCACTAATTATAATTTCTCTCGATCTAAATGGGAAGGTTAG
TCGAGAGTGAAGGAAGTTCTTATAAGCTTTCTACTTTTGCCAACCGCACA
AATCAAAATCCGCTAGCTTTTTCGCCTCACTGATAACCTTTTTCAAGATT
TCATAAGGACTTTGGTTAGGTTGCTCACCTATTGGAACTCCAAGATATTG
ATAAAATTCTTTACTCAATAATTTCTTTATTTTTATATTATTAATTGAAA
TTTCACTAATCGTGTCGACATTTGGCAGTTGAATATATGCACACTTTTCA
GGTCGATATTCAAATCCAATTTCACGAGCTACATCAAAAGCAATGTTTAA
GATATTTTGCAAATCATGAGTATTATTAACAATAAGAGCGATATCATCAA
CATAAGTAAGAACTTCGATTGAAGATTCACCAATTTTTGAAAGGCTTTAC
TTTAGAAAGAGGAACAGCTTGAAGGACAGGATTTATTGCAATGGCAAACA
AAATCATTGAAAGAGGGCATCCTTGTTTGACGCCCTGCTTTATAGGAATA
TTCGGAGTAACAATTGGATCACATGTATAGTATGAGCTTGTTTCAGTGTA
TAGAAGTTTCAAAGTGTTTGTGAATTTTTCACCAACTCCAATGTGTCGTA
AAATCTTCCACATGTAATCATGGGGTACACTGCCAAAAGCGTCTTTGATG
TCAAGAAATGCAATTATGATAGGTGTATCTTTACTATATTTCGAGTGCTC
AAGACAAGATGAAAGTACCGAATTGTGTTCTACACAACCCTCATGCACAG
ACCCCCCTTTTTGTCCGATATGAAGTAGATTGTTTCGATTTACCCACGAT
GTTAAGCGTCTAGCTAATATTGACGCAAATATTTTATAAACAACGGATAA
CAAAGAAATTGGTCACCAAGAAGAGATCAGATTATATTTATCCCCTTTAT
CAGGTTTAGGAATCATTAGAGTTTTAAACGATTTCCAAACGTCAGGCATA
ATATTTTCCGTGATGATTTTGTTGTAAAGAAGAGTCAACAATTTACCTTC
TGGGTCAAGAATAGCAATATCGTTATATTTAATTCCATCAATTCCAGTAG
ATGTATTATCAGCTGTTTTCCGTTCAAAAATAACCTCTTATCTATAATTG
GTCGAAGTAAAAGAGTATTTTGAGATTTTAGACCAAAGTTTAAAACATTA
TCATAACTTTTAATTAGCTGATCTTGATGGCTAAAATTACCAATGTGATC
TTTAATTGTTGGCATCTCGTTTATTTCATCGTTAACTAAGATGTTGAGTA
CCGTCGTTTTCATATTTTGATAAATGATGATTTGAAGTTAGTTTTGGTGG
TGGAACTTTACTGATTTTATTTCCTAAATATGGTCTACTGATTTAAGTTA
CATTTGTTTCTTTATGAATACGTATTTCATTAATAATAAAGTTACTGATT
TCGTTTACACTTGCGTTTTGTAAAGTCAACAAATTCTCATTTATCAAAAG
TATGCGTTGATTTAATTTTAGCTTTACATTTGTTTTGTTATCAGGTAAAT
TCTTTATCAAATCCTTTATAATGTCTTGTACAGTCGGTAATAAAGACTTT
ATGACATTTCCAATATCACGGAGATTAATATTGTCCAAAGACAAATCTAA
GGCAGTGTTTGATAAATGCACATATGAGAATCCTACTAACAAGACCAGAG
CCACGAATATCATGAGGACAGTTACCAAGTAGTTTACAAAGTTCCGGAGT
TTCTTTGATTTCATTGATTTTAGTCAATAAAGAGTTTGCTGTACAAAGAT
AAGGAAAGTTTGGAAGTAAAGATGAAGGATTAAGTAGATAATGTTCATCA
GAGTTGTAGTCGATGATCATCAAAATTTGCCGAGCTTTAGGAGGAGCAAT
AATGGCAAAAACAATTTTTGCTTTCATTAAATTTTCAATATTTAAAAATT
CATTTAAGTATTGAGTGCAATCATCCACTATTGCTGTGGTCATTGTATCA
TTTAAAAAATGAAATTTTCGGATAAGTTCAAATTGATGAAAAATTTTGTT
AAAATGTTTTCTGTAATCTTACAATTTATTAAATTCAAATTTACTACAAC
TTCATCGCACATCTTGGATTGCATATTTACAAGCTTTTCAATTACTTTAT
CTCTATTGACAACATTTCCAGAAATAAATTCTTCTAAAAATAGTATAAAA
GTAGTAGCGTGATGTATAGGGTCATCAGAGAACATTGCAAAGCGAAAAAG
AGTATGAGATTTCTTAAATATAATTGTTTTTCAAGAATAAATTTATTCAA
GTAATCTTTTATATTCTCTCCTATTCCTAACAGCCTTCCGTTGATATTTT
GAGAAGATCGAACGTCAAAGATGTAACTGAAGCCAAGACAAACTGAACAA
AGAAAGAGACACCAATAATTATCGTTGGATATAATACCAATGATTATTTT
AATGCCCTTAAATTGTTTAAAACCAACATGAGCGACTATATAAATATTGT
TTTGAGCAATCAAGTTAATTGTTTGCGCTGGAGAAAGAACCATCACCTCA
AGATTATTTTCAAACCATTTTTTAAAGAGAGTCGAGACACAAGCTTTTTT
TTGAGTCAGTTTTATAGTTTCTTTCGCTTTGGGGTTTGGGTTTTTATTTT
TAATTGCTAATGCTTTTTTAAAGTTAATTTTATTTAGGAAGTGATCTTTA
GAAATTCCACCCCCAGATAGTTTTGTATTTTGAATTAAATGAAAACTTTG
AATTTTGTAAATCTTTTTCCTAATATTCAAAATGAAATCAACGGTAAAAT
AGTACCATTCTTTGCACACAATCATCGCATAAGCGCAAATGTAAGGTCCA
CAATCAAAATTATTATTTTGATATTGCAGAATTTTATGGGGATGATCTGT
TATTTTATTTTGAAGGTCAAATTTATTATTTAATTCAGAATTAATTATAT
GCGCTCTTTCAATATTTTCAAACTTTCTCTTATTTTTAAAAACAGGTTCA
ATAAAGTAAGAGTTACAAGAGACTTTACAGTATACAAATAAAATCCAGTG
GCAGTTGTTAATGTTAATTGGACATAAGATAACTTGAGCCTCATATATAT
TGTTAGGAATTGGAAAAATATCCTTGGAATTATTTGAGCATAAAATACTC
ACAACAAAACATTTAAGGAAAGCGAACTTTGGATTTCTAATGTGGGTTTC
AAAATAATAATCTATGTCATCATCAGTAAACCAGAATTCAAAATCAAAAT
TTTCAAAACTGCAATCTGCATCAGTCTCATTAGACCGTGCAGCAGGTGTT
GAGACTGATGCAGGAACGTACCTTCATTTGGATGTTGTCTTTAACAGCTT
TACATCCTTTCGTGTCGTCATCTTTTTAACATATATATTTTTTATCGTTA
AAGTATGTGAAGGTTCCTCATCAATATCAGTAGTTAGATTATTTGTTGTT
TCAATAACTTTATTATCTATATTTACTATAGGCGTTTCAACCATTAAGAT
TTTACTTTCATGAATAAAGCAGAGCGAGGTTTGTACAACAGGAGCCCTAG
ATTCAGATGAAGTTTGTAGATTTATAGTTGTAAATTGTTCTACTTGGTTA
ACGTCTGCTTTTTCTTGGATAAACAACACAAGTGAGTCTATAATTTGAGA
AATGAATCCACTCATTTTACTTGTGCAGATTTTCCGACAAGTTTCAAGTC
TTCTATATGATTGTTTCATTGAAGAGAGAAATTTCTTCTTGTCTCTAATA
GCTAAGTAAATCAAGCGTTTTGATTTTATCTCATCTACATTGCTAGAGTC
AGGATTCCAATTATTGGATTTATTACTTATTTCGCATAGTAACTGTATCT
GGTTAGACTTTACAGTAAAGATTTTGTCTAACAAATCAAAGGAACTATTC
ACGTTGTTTATTGTTGGCGGAGAAATGATGTTGTGAATTCTATCTATTTC
ACCTGACAGTTTCCACTGTCTGAGCCTTAAGAGTCGTTCACGTCAACTAG
AGTTGTAATAAGATAACGATGGAATCATATCAATCATTTCAGAAATAAGT
GTTTCATTATGATCAGGATCAAGTGAAGGAGTACTTTCAATGTCAACAAT
TGAATACATAAGTAAACAATTTCTAATATAGTTTAGAGCGTAATCACCAT
AAGTTCCATTCGTTTTATAATATAAATTATTTTTTAAATTTAAGTAGTTG
AGATAAAATATTATATCAATTACTTTTTCAGAAGTGTTCGGTTTATTAAG
CAAAGTTCTAAGTTCCATGTCATCTTTTGACATTTGGAGAAAATTAAGCA
AACCAAGATTGAACATTATATCGGACGAATTTTCAAAATTTGGATTTTCC
GAAGTATTTATTTTATTAAGAATTAAATATTTTCCACCCACAAATGAGAT
TTCGTCAGGAAAGTTTTTATTTAATTTAAATGCGTTTATTAATTTAATTA
TTTCGTCAGAATTTTTAGACATTTTTCCAACAAAACATAACTCGTGTAAT
TCTGGAAAGGATATAAGCAACTCATGAAACTGAGATCTTATACTTTTAAT
TATTTATACTTTTAATATCAGCATCAGATATATGGTTATTTCAAATGTCT
AGCATGATAAAATCTCCATTGCGATATTTTTGTGATTTTGTAAAAAAATC
AGTCAACACATTTTGCTACTTCAATAATATTAATATGTTATTTATTTATT
TGTCAGGGGCAGTTTGTTATTCGTTACATTAAATACAGATTTTTAACCCG
AGTTATCTTTGTTCATACATAAAATCATCAAGTTGAGAATCTGGTAACCT
TCACATCATTATATAGATGCCGTAGCCTTCCATGAGGGGTTCTCAGTATG
TGTCAAATCGGTTCATATATTTGAAAATCCGTTCATATATTGAATGATAA
AAATAAAAATAAAAAAATGTAATAATAGCAAAGGCACCCATATATATTTA
CACCGAGTAAAATTCGATTATTTTGTTATTTTTTCAAATAAAATCCAATA
ATAAATCAATAAATTTTCAATTTTCAATTTTAATCACAACACTTGTCCGT
TGGTATTAGTTTCTCATATAATTTGTTTTTCTGTAATCTCCGGCCAGCTT
ATTTAAAACAAATAAATATTTAGTTATCATTAAATTGATATATCCAGCTA
ATTTATATCTGCAACTAAATAGTAAATTATATTTTACTCCCAATTTTTCT
ATTTCGTCTTTTTATTTGAGGGAATAGAGAAAAATAGGAAATTCTCCCAG
CCCTCTGCACATAGCAGTGAATTTTGGAATAAGGCGTGCCTAACCGGTTA
AAGTAGAAGGGATTTTGACTGGTGTTGTCGAATAGAAAAGTTGACATTTA
ACCGTTTTCATGTGTTACAGAATGCCAAGTTCCCATCGAAATAAATCGTC
TCAGACAAAACCAATCAGCCAGAAATTAAAATCACAGAATACAATAATAA
TGAAAAATCAATCGAAATCACTGGCGGAAAAATCAATCAAACCAGAAATG
CCGAAAAGTGCGCCAGAAAAATCGTCCAGCACTGTATCGAAAATTGACAG
TGTCGGACCGAATCGGTTTCAGGTTTTGAGTTATGAACAAGTCAAACGGC
TTCATCGAGTGATTGAAAAGCCTTTGAAACTTAAACCCGTTTCACATTCC
GTTCTCCCAGTAATTGAAGTGTCGTTAAGAGCTTTGCTTGGAGAAATAAA
AAGAAAGTTGAAAGAAGTCGATGTTGTGATCAAGGATGTCAGATTAGATG
GCACTGCCGCAGGGTGCATATTAAATCTCAACCCAAATGATGACTTTAGA
GAACTTAATGTGATTTTCACTGTCAGCCTCCATGACATGACCTCAATGCA
GAAAATCAAAAATACAATCTTTTCACTATTAATTGACCTGTTAAAGAAAA
CTCTCAACAGCAAACCAGAAAGCCTTAAACATAACTTCCTCATTAATGAA
GAATTAATCAAAGACAACTATATTCAGAAAATGACACGGGTTTTATGTAA
TCAAGAGTCCAACTCCGATTGCTGGTCACTAATCTCTCTCGGTACTCTGG
AAATCGGTAATGAAACTGTTGAACTGAAATTTATCGATAAAATGAAACGA
CAATATGAATTCACAATTGATTCATTTCAAATTGTTCTTGACACGATGTT
AGCCTTCTATACCGTCAGCAAGTGCTCCTCAATCACACCGAATCTATTCC
CCACTGTTGTTGCAGAATCTGTATCGGGAAGTTTTCAAGAAGCTTTCAAG
CATTTGAAAGAGAACATAATTTCCACCAAAAATCCCGAAGAAATTCTTGG
TGGAGGACTGCTTAAATATTGTGGATTATTGGCAGTGGGATTTCAACAAA
ACAGCGCGATGGATATTCGAGCAACAGAGAAGTACATGTGTTCTCGGTTC
TTTATTGACTATCCTGATATTAACGTCCAGAGACAGAAACTGGAGTCATT
TCTTGATTCTTTAGTCGATTCCAATTATGAAATCAAAATTAATTTGTTGA
ATGTTCTTTATGAGGTGGTGTCGCATTCAACTGTTTGCCTAATGACCCAT
GAACGTCGCCAGACCTTGCAAATGATCAACAGTCTCAGTCAGAATATTTT
GTCGGAAATCGAAATAAAAAAATCAACTGTCCAACTGGATGATTTGAGCA
GTCAGAATTGGGTTCTTGATCAGGTGTTTTACGGGACATTTTATTTCCCG
CAACAAGTTTATGTGACCGGACCGATGAATGCCAGCCAGTCAAACAATAT
CAATTTGGGAAATATATCGGGTAACCAAATACTGATTTGTACAGGCGACA
ACACCGATTTCATAACAACCAGCAATCAAATCGTATCCGTCAATCAAGCA
ACATCTGCAGTCATCGACAGCAGCTCCTGGATAGGGGGGTACCAGAACCA
GAATAATCAAATATATTGTTGCAATGGCCCATTAATGTGCGCATAATCAA
CTTGTATAAATGTTAATGTTTTCTTTTTCTTCAAAGGTGATTTGGTGACA
TTTTGTTTTTGTGCTTAATATTGCTTACGTTGTTGCTATTGTTATCATTG
TTAATGCTGTTTTTGTTGTTGTTGTTGTTTTTATCGTTCTTAGCGTCTTT
TTGTATGTGTATATTTTAAATTTAAATTTAAATTTAAATTTTAAAGTTAT
ATTATATTTTAATGGTGCTGCTATTTGTGATTAATTGTACAAATTTTGTG
ATAGAAATAATTTTGTTGGGGTCTTTCATTGAAATTTTTATCGTATTTAA
ATAAGATCATTTTGTTTATTTCTATGTTGTTTACTTATATGAGGTTTTTA
TGTATAATTATCATTGTGTCATTATAATTACCTTGTTGGAATTGTATATC
TGATCTTATTCATATTATTCAGATTAACATTTTCGTACAAATGTTGATAT
TGCTTATAATATATTTATAACAAATTTTTATCATAAATATATTACATAGG
AAATTATAAATTGAATGCCAAATGTTCAGCCAGTTAATTATTTTTTTCAT
GGAGAGGAAACCAAGAGCATATATAGTGAACATATAGTCCATATAAAGAC
CATAAGAGAAGTGCAAGAACTCAAACAACATGTAATGCTTTTTATTCTGC
TCCTAAAATCATTTTAGGGAGAGGCAGTCCTTTTATTGACGGGCAATTTA
CCATAAAGTGCGCCTTAGCAGTTACCAGCATAACATAAGCCTCCTTTGAA
TCGCCAGTGAAAGAAAAGATTTCTACGTGAGTTATATTTTGAAAAGAAAT
CTCATTTCCAATGATATGAATGTATATTTCATTAAAACAAACATTACATG
TATATAATCATGTCCTGCGGAGCTGTGATAACTATTTTATTTTATGTAAA
AACTGTTTTCAATTTCATTGGTATCGAGAAGTCGTTTACAATTTTACGAG
GTTTGAAAATGTTATCAAATCGCCGCT
back to top

protein sequence of SMED30024611-orf-1

>SMED30024611-orf-1 ID=SMED30024611-orf-1|Name=SMED30024611-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=132bp
MKQSYRRLETCRKICTSKMSGFISQIIDSLVLFIQEKADVNQVEQFTTIN
LQTSSESRAPVVQTSLCFIHESKILMVETPIVNIDNKVIETTNNLTTDID
EEPSHTLTIKNIYVKKMTTRKDVKLLKTTSK*
back to top

protein sequence of SMED30024611-orf-2

>SMED30024611-orf-2 ID=SMED30024611-orf-2|Name=SMED30024611-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=529bp
MCYRMPSSHRNKSSQTKPISQKLKSQNTIIMKNQSKSLAEKSIKPEMPKS
APEKSSSTVSKIDSVGPNRFQVLSYEQVKRLHRVIEKPLKLKPVSHSVLP
VIEVSLRALLGEIKRKLKEVDVVIKDVRLDGTAAGCILNLNPNDDFRELN
VIFTVSLHDMTSMQKIKNTIFSLLIDLLKKTLNSKPESLKHNFLINEELI
KDNYIQKMTRVLCNQESNSDCWSLISLGTLEIGNETVELKFIDKMKRQYE
FTIDSFQIVLDTMLAFYTVSKCSSITPNLFPTVVAESVSGSFQEAFKHLK
ENIISTKNPEEILGGGLLKYCGLLAVGFQQNSAMDIRATEKYMCSRFFID
YPDINVQRQKLESFLDSLVDSNYEIKINLLNVLYEVVSHSTVCLMTHERR
QTLQMINSLSQNILSEIEIKKSTVQLDDLSSQNWVLDQVFYGTFYFPQQV
YVTGPMNASQSNNINLGNISGNQILICTGDNTDFITTSNQIVSVNQATSA
VIDSSSWIGGYQNQNNQIYCCNGPLMCA*
back to top

protein sequence of SMED30024611-orf-3

>SMED30024611-orf-3 ID=SMED30024611-orf-3|Name=SMED30024611-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=160bp
MSKNSDEIIKLINAFKLNKNFPDEISFVGGKYLILNKINTSENPNFENSS
DIMFNLGLLNFLQMSKDDMELRTLLNKPNTSEKVIDIIFYLNYLNLKNNL
YYKTNGTYGDYALNYIRNCLLMYSIVDIESTPSLDPDHNETLISEMIDMI
PSLSYYNSS*
back to top

protein sequence of SMED30024611-orf-4

>SMED30024611-orf-4 ID=SMED30024611-orf-4|Name=SMED30024611-orf-4|organism=Schmidtea mediterranea sexual|type=polypeptide|length=123bp
MTTAIVDDCTQYLNEFLNIENLMKAKIVFAIIAPPKARQILMIIDYNSDE
HYLLNPSSLLPNFPYLCTANSLLTKINEIKETPELCKLLGNCPHDIRGSG
LVSRILICAFIKHCLRFVFGQY*
back to top

protein sequence of SMED30024611-orf-5

>SMED30024611-orf-5 ID=SMED30024611-orf-5|Name=SMED30024611-orf-5|organism=Schmidtea mediterranea sexual|type=polypeptide|length=124bp
MKSKKLRNFVNYLVTVLMIFVALVLLVGFSYVHLSNTALDLSLDNINLRD
IGNVIKSLLPTVQDIIKDLIKNLPDNKTNVKLKLNQRILLINENLLTLQN
ASVNEISNFIINEIRIHKETNVT*
back to top

protein sequence of SMED30024611-orf-6

>SMED30024611-orf-6 ID=SMED30024611-orf-6|Name=SMED30024611-orf-6|organism=Schmidtea mediterranea sexual|type=polypeptide|length=214bp
MIVCKEWYYFTVDFILNIRKKIYKIQSFHLIQNTKLSGGGISKDHFLNKI
NFKKALAIKNKNPNPKAKETIKLTQKKACVSTLFKKWFENNLEVMVLSPA
QTINLIAQNNIYIVAHVGFKQFKGIKIIIGIISNDNYWCLFLCSVCLGFS
YIFDVRSSQNINGRLLGIGENIKDYLNKFILEKQLYLRNLILFFALQCSL
MTLYITLLLLYYF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
PLANA:0002089reproductive organ
PLANA:0003001lateral region of the whole animal
PLANA:0003116parenchymal cell
Vocabulary: molecular function
TermDefinition
GO:1990817RNA adenylyltransferase activity
GO:0008234cysteine-type peptidase activity
Vocabulary: INTERPRO
TermDefinition
IPR000477RT_dom
IPR003653Peptidase_C48_C
IPR012937TET5
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR012937Terminal nucleotidyltransferaseSMARTSM01153DUF1693_2coord: 73..409
e-value: 4.1E-104
score: 361.8
IPR012937Terminal nucleotidyltransferasePFAMPF07984NTP_transf_7coord: 73..409
e-value: 1.5E-103
score: 346.4
IPR012937Terminal nucleotidyltransferasePANTHERPTHR12974PRION-LIKE- Q/N-RICH -DOMAIN-BEARING PROTEIN PROTEIN 44coord: 42..427
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..62
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 7..40