Serine/arginine repetitive matrix protein 1

Overview
NameSerine/arginine repetitive matrix protein 1
Smed IDSMED30024600
Length (bp)2434
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Serine/arginine repetitive matrix protein 1 (SMED30024600) t-SNE clustered cells

Violin plots show distribution of expression levels for Serine/arginine repetitive matrix protein 1 (SMED30024600) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Serine/arginine repetitive matrix protein 1 (SMED30024600) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Serine/arginine repetitive matrix protein 1 (SMED30024600) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024600

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30024600h1SMcG0001813 SmedASXL_013555SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30024600h1SMcG0001813 SmedASXL_013555SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30024600h1SMcG0001813 Contig48940newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30024600h1SMcG0001813 Contig48940uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30024600h1SMcG0001813 dd_Smed_v4_3886_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30024600h1SMcG0001813 dd_Smed_v4_3886_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30024600h1SMcG0001813 dd_Smed_v4_3886_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30024600h1SMcG0001813 dd_Smed_v4_3886_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30024600h1SMcG0001813 dd_Smed_v4_3886_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30024600h1SMcG0001813 dd_Smed_v4_3886_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30024600h1SMcG0001813 dd_Smed_v6_3886_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Serine/arginine repetitive matrix protein 1 vs. Ensembl Human
Match: SRRM1 (serine and arginine repetitive matrix 1 [Source:HGNC Symbol;Acc:HGNC:16638])

HSP 1 Score: 169.474 bits (428), Expect = 5.613e-43
Identity = 81/150 (54.00%), Postives = 116/150 (77.33%), Query Frame = 3
Query:   63 MDGGFFKGTTTEQDSRFSDKQSKLMRQMKFSDILDNKIDMSKIDLKIIKPWINKRLTELLGFDDDVVVAYVFNQLETKHPNPKEIQVNLTGFLNAKNSRMFLAELWELLISASLTDKGVPLNMIEAQLTELKNFEDEE---AKIKNQLED 503
            MD GFF+GT+ EQD+RFS+KQ KL++Q+KF++ L+ K+DMSK++L++IKPWI KR+TE+LGF+DDVV+ ++FNQLE K+P+ K +Q+NLTGFLN KN+R F+ ELW LL+SA     G+P   +E +  E+K  + E+   A +K Q ED
Sbjct:    1 MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEILGFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIPSAFLELKKEEIKQRQIEQEKLASMKKQDED 150          
BLAST of Serine/arginine repetitive matrix protein 1 vs. Ensembl Human
Match: SRRM1 (serine and arginine repetitive matrix 1 [Source:HGNC Symbol;Acc:HGNC:16638])

HSP 1 Score: 169.474 bits (428), Expect = 9.050e-43
Identity = 81/150 (54.00%), Postives = 116/150 (77.33%), Query Frame = 3
Query:   63 MDGGFFKGTTTEQDSRFSDKQSKLMRQMKFSDILDNKIDMSKIDLKIIKPWINKRLTELLGFDDDVVVAYVFNQLETKHPNPKEIQVNLTGFLNAKNSRMFLAELWELLISASLTDKGVPLNMIEAQLTELKNFEDEE---AKIKNQLED 503
            MD GFF+GT+ EQD+RFS+KQ KL++Q+KF++ L+ K+DMSK++L++IKPWI KR+TE+LGF+DDVV+ ++FNQLE K+P+ K +Q+NLTGFLN KN+R F+ ELW LL+SA     G+P   +E +  E+K  + E+   A +K Q ED
Sbjct:    1 MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEILGFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIPSAFLELKKEEIKQRQIEQEKLASMKKQDED 150          
BLAST of Serine/arginine repetitive matrix protein 1 vs. Ensembl Human
Match: SRRM1 (serine and arginine repetitive matrix 1 [Source:HGNC Symbol;Acc:HGNC:16638])

HSP 1 Score: 169.474 bits (428), Expect = 9.314e-43
Identity = 81/150 (54.00%), Postives = 116/150 (77.33%), Query Frame = 3
Query:   63 MDGGFFKGTTTEQDSRFSDKQSKLMRQMKFSDILDNKIDMSKIDLKIIKPWINKRLTELLGFDDDVVVAYVFNQLETKHPNPKEIQVNLTGFLNAKNSRMFLAELWELLISASLTDKGVPLNMIEAQLTELKNFEDEE---AKIKNQLED 503
            MD GFF+GT+ EQD+RFS+KQ KL++Q+KF++ L+ K+DMSK++L++IKPWI KR+TE+LGF+DDVV+ ++FNQLE K+P+ K +Q+NLTGFLN KN+R F+ ELW LL+SA     G+P   +E +  E+K  + E+   A +K Q ED
Sbjct:    1 MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEILGFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIPSAFLELKKEEIKQRQIEQEKLASMKKQDED 150          
BLAST of Serine/arginine repetitive matrix protein 1 vs. Ensembl Human
Match: SRRM1 (serine and arginine repetitive matrix 1 [Source:HGNC Symbol;Acc:HGNC:16638])

HSP 1 Score: 119.398 bits (298), Expect = 3.084e-31
Identity = 54/101 (53.47%), Postives = 77/101 (76.24%), Query Frame = 3
Query:  180 MSKIDLKIIKPWINKRLTELLGFDDDVVVAYVFNQLETKHPNPKEIQVNLTGFLNAKNSRMFLAELWELLISASLTDKGVPLNMIEAQLTELKNFEDEEAK 482
            MSK++L++IKPWI KR+TE+LGF+DDVV+ ++FNQLE K+P+ K +Q+NLTGFLN KN+R F+ ELW LL+SA     G+P   +E +  E+K  + E+ K
Sbjct:    1 MSKVNLEVIKPWITKRVTEILGFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIPSAFLELKKEEIKQRQIEQEK 101          
BLAST of Serine/arginine repetitive matrix protein 1 vs. Ensembl Human
Match: SRRM1 (serine and arginine repetitive matrix 1 [Source:HGNC Symbol;Acc:HGNC:16638])

HSP 1 Score: 128.257 bits (321), Expect = 5.366e-30
Identity = 58/111 (52.25%), Postives = 82/111 (73.87%), Query Frame = 3
Query:  180 MSKIDLKIIKPWINKRLTELLGFDDDVVVAYVFNQLETKHPNPKEIQVNLTGFLNAKNSRMFLAELWELLISASLTDKGVPLNMIEAQLTELKNFEDEE---AKIKNQLED 503
            MSK++L++IKPWI KR+TE+LGF+DDVV+ ++FNQLE K+P+ K +Q+NLTGFLN KN+R F+ ELW LL+SA     G+P   +E +  E+K  + E+   A +K Q ED
Sbjct:    1 MSKVNLEVIKPWITKRVTEILGFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIPSAFLELKKEEIKQRQIEQEKLASMKKQDED 111          
BLAST of Serine/arginine repetitive matrix protein 1 vs. Ensembl Celegans
Match: rsr-1 (SR protein related [Source:UniProtKB/TrEMBL;Acc:O62185])

HSP 1 Score: 156.762 bits (395), Expect = 6.041e-40
Identity = 62/138 (44.93%), Postives = 103/138 (74.64%), Query Frame = 3
Query:   63 MDGGFFKGTTTEQDSRFSDKQSKLMRQMKFSDILDNKIDMSKIDLKIIKPWINKRLTELLGFDDDVVVAYVFNQLETKHPNPKEIQVNLTGFLNAKNSRMFLAELWELLISASLTDKGVPLNMIEAQLTELKNFEDEE 476
            MD G+F+G  +EQD RFSDK+ KL++ MKF   L+ KID+++ ++ +IKPWI  R+ ++LG +DDVVV Y+ +Q++ K+ NPK +Q+N+TGFLNA+ +R F+ +LW LLI A+ ++ G+P +++  ++ E+K  + +E
Sbjct:    1 MDAGYFRGANSEQDGRFSDKEKKLLKTMKFEPQLEQKIDLNRCNMDVIKPWITARVNDILGMEDDVVVEYILSQIDDKNLNPKLLQINVTGFLNARRAREFVGDLWNLLIEANASEDGIPASLVNQKMAEMKTNDRDE 138          
BLAST of Serine/arginine repetitive matrix protein 1 vs. Ensembl Celegans
Match: rsr-1 (SR protein related [Source:UniProtKB/TrEMBL;Acc:O62185])

HSP 1 Score: 156.762 bits (395), Expect = 6.041e-40
Identity = 62/138 (44.93%), Postives = 103/138 (74.64%), Query Frame = 3
Query:   63 MDGGFFKGTTTEQDSRFSDKQSKLMRQMKFSDILDNKIDMSKIDLKIIKPWINKRLTELLGFDDDVVVAYVFNQLETKHPNPKEIQVNLTGFLNAKNSRMFLAELWELLISASLTDKGVPLNMIEAQLTELKNFEDEE 476
            MD G+F+G  +EQD RFSDK+ KL++ MKF   L+ KID+++ ++ +IKPWI  R+ ++LG +DDVVV Y+ +Q++ K+ NPK +Q+N+TGFLNA+ +R F+ +LW LLI A+ ++ G+P +++  ++ E+K  + +E
Sbjct:    1 MDAGYFRGANSEQDGRFSDKEKKLLKTMKFEPQLEQKIDLNRCNMDVIKPWITARVNDILGMEDDVVVEYILSQIDDKNLNPKLLQINVTGFLNARRAREFVGDLWNLLIEANASEDGIPASLVNQKMAEMKTNDRDE 138          
BLAST of Serine/arginine repetitive matrix protein 1 vs. Ensembl Fly
Match: SRm160 (gene:FBgn0036340 transcript:FBtr0075883)

HSP 1 Score: 161.77 bits (408), Expect = 1.545e-40
Identity = 68/134 (50.75%), Postives = 102/134 (76.12%), Query Frame = 3
Query:   75 FFKGTTTEQDSRFSDKQSKLMRQMKFSDILDNKIDMSKIDLKIIKPWINKRLTELLGFDDDVVVAYVFNQL-ETKHPNPKEIQVNLTGFLNAKNSRMFLAELWELLISASLTDKGVPLNMIEAQLTELKNFEDE 473
             F GT  +QD+RFSDK+ KLM+QMKF D L+ ++DMSK+ L +++PWI+K++T++L  +DDVVV +V+NQL E K+P PK++Q+N+TGFLN +N+R F+ ELW LL+SA  +D G+P   I+ +  E+   E+E
Sbjct:    2 MFTGTNQQQDTRFSDKEKKLMKQMKFGDCLNKRVDMSKVKLDVLRPWISKKITDILHIEDDVVVEFVYNQLEEEKYPCPKKMQINMTGFLNGRNARQFMGELWALLLSAQESDSGIPAEFIQQKKDEILKREEE 135          
BLAST of Serine/arginine repetitive matrix protein 1 vs. Ensembl Zebrafish
Match: srrm1 (serine/arginine repetitive matrix 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2789])

HSP 1 Score: 157.918 bits (398), Expect = 2.487e-43
Identity = 74/141 (52.48%), Postives = 111/141 (78.72%), Query Frame = 3
Query:   63 MDGGFFKGTTTEQDSRFSDKQSKLMRQMKFSDILDNKIDMSKIDLKIIKPWINKRLTELLGFDDDVVVAYVFNQLETKHPNPKEIQVNLTGFLNAKNSRMFLAELWELLISASLTDKGVPLNMIEAQLTELKNFEDEEAKI 485
            MD GFF+GT+ EQD+RFS+K  KL++Q+KF++ L+ K+DM+K++L++IKPWI +R+TE+LGF+DDVV+ +VFNQLE K+P+ K +Q+NLTGFLN KN+R F+ +LW LL+SA     G+P   +E +  E+K  + E+ K+
Sbjct:    1 MDAGFFRGTSAEQDNRFSNKHKKLLKQLKFAECLEKKVDMTKVNLEVIKPWITQRVTEILGFEDDVVIEFVFNQLEEKNPDGKMMQINLTGFLNGKNAREFMKDLWPLLLSAQENIAGIPSAFLEQKKEEIKQRQIEQEKL 141          
BLAST of Serine/arginine repetitive matrix protein 1 vs. Ensembl Zebrafish
Match: srrm1 (serine/arginine repetitive matrix 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2789])

HSP 1 Score: 163.696 bits (413), Expect = 4.273e-41
Identity = 74/141 (52.48%), Postives = 111/141 (78.72%), Query Frame = 3
Query:   63 MDGGFFKGTTTEQDSRFSDKQSKLMRQMKFSDILDNKIDMSKIDLKIIKPWINKRLTELLGFDDDVVVAYVFNQLETKHPNPKEIQVNLTGFLNAKNSRMFLAELWELLISASLTDKGVPLNMIEAQLTELKNFEDEEAKI 485
            MD GFF+GT+ EQD+RFS+K  KL++Q+KF++ L+ K+DM+K++L++IKPWI +R+TE+LGF+DDVV+ +VFNQLE K+P+ K +Q+NLTGFLN KN+R F+ +LW LL+SA     G+P   +E +  E+K  + E+ K+
Sbjct:    1 MDAGFFRGTSAEQDNRFSNKHKKLLKQLKFAECLEKKVDMTKVNLEVIKPWITQRVTEILGFEDDVVIEFVFNQLEEKNPDGKMMQINLTGFLNGKNAREFMKDLWPLLLSAQENIAGIPSAFLEQKKEEIKQRQIEQEKL 141          
BLAST of Serine/arginine repetitive matrix protein 1 vs. Ensembl Zebrafish
Match: srrm1 (serine/arginine repetitive matrix 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2789])

HSP 1 Score: 163.696 bits (413), Expect = 4.303e-41
Identity = 74/141 (52.48%), Postives = 111/141 (78.72%), Query Frame = 3
Query:   63 MDGGFFKGTTTEQDSRFSDKQSKLMRQMKFSDILDNKIDMSKIDLKIIKPWINKRLTELLGFDDDVVVAYVFNQLETKHPNPKEIQVNLTGFLNAKNSRMFLAELWELLISASLTDKGVPLNMIEAQLTELKNFEDEEAKI 485
            MD GFF+GT+ EQD+RFS+K  KL++Q+KF++ L+ K+DM+K++L++IKPWI +R+TE+LGF+DDVV+ +VFNQLE K+P+ K +Q+NLTGFLN KN+R F+ +LW LL+SA     G+P   +E +  E+K  + E+ K+
Sbjct:    1 MDAGFFRGTSAEQDNRFSNKHKKLLKQLKFAECLEKKVDMTKVNLEVIKPWITQRVTEILGFEDDVVIEFVFNQLEEKNPDGKMMQINLTGFLNGKNAREFMKDLWPLLLSAQENIAGIPSAFLEQKKEEIKQRQIEQEKL 141          
BLAST of Serine/arginine repetitive matrix protein 1 vs. Ensembl Zebrafish
Match: srrm1 (serine/arginine repetitive matrix 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2789])

HSP 1 Score: 101.679 bits (252), Expect = 1.424e-25
Identity = 47/78 (60.26%), Postives = 69/78 (88.46%), Query Frame = 3
Query:   63 MDGGFFKGTTTEQDSRFSDKQSKLMRQMKFSDILDNKIDMSKIDLKIIKPWINKRLTELLGFDDDVVVAYVFNQLETK 296
            MD GFF+GT+ EQD+RFS+K  KL++Q+KF++ L+ K+DM+K++L++IKPWI +R+TE+LGF+DDVV+ +VFNQLE K
Sbjct:    1 MDAGFFRGTSAEQDNRFSNKHKKLLKQLKFAECLEKKVDMTKVNLEVIKPWITQRVTEILGFEDDVVIEFVFNQLEEK 78          
BLAST of Serine/arginine repetitive matrix protein 1 vs. Ensembl Xenopus
Match: srrm1 (serine and arginine repetitive matrix 1 [Source:NCBI gene;Acc:448115])

HSP 1 Score: 164.851 bits (416), Expect = 1.935e-41
Identity = 76/141 (53.90%), Postives = 111/141 (78.72%), Query Frame = 3
Query:   63 MDGGFFKGTTTEQDSRFSDKQSKLMRQMKFSDILDNKIDMSKIDLKIIKPWINKRLTELLGFDDDVVVAYVFNQLETKHPNPKEIQVNLTGFLNAKNSRMFLAELWELLISASLTDKGVPLNMIEAQLTELKNFEDEEAKI 485
            MD GFF+GT+ EQD+RFS+KQ KL++Q+KF++ L+ K+DM K++L++IKPWI KR+TE+LGF+DDVV+ ++FNQLE K+P+ K +Q+NLTGFLN KN+R F+ ELW LL+SA     G+P   +E +  E+K  + E+ K+
Sbjct:    1 MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMGKVNLEVIKPWITKRVTEILGFEDDVVIDFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIPSAFLELKKEEIKQRQIEQEKL 141          
BLAST of Serine/arginine repetitive matrix protein 1 vs. Ensembl Xenopus
Match: srrm1 (serine and arginine repetitive matrix 1 [Source:NCBI gene;Acc:448115])

HSP 1 Score: 150.214 bits (378), Expect = 9.284e-37
Identity = 71/138 (51.45%), Postives = 105/138 (76.09%), Query Frame = 3
Query:   84 GTTTEQDSRFSDKQSKLMRQMKFSDILDNKIDMSKIDLKIIKPWINKRLTELLGFDDDVVVAYVFNQLETKHPNPKEIQVNLTGFLNAKNSRMFLAELWELLISASLTDKGVPLNMIEAQLTELKNFEDEEAKIKNQL 497
            GT+ EQD+RFS+KQ KL++Q+KF++ L+ K+DM K++L++IKPWI KR+TE+LGF+DDVV+ ++FNQLE K+P+ K +Q+NLTGFLN KN+R F+ ELW LL+SA     G+P   +E +  E+K  + +   + N L
Sbjct:    3 GTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMGKVNLEVIKPWITKRVTEILGFEDDVVIDFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIPSAFLELKKEEIKQRQHDRLSLLNHL 140          
BLAST of Serine/arginine repetitive matrix protein 1 vs. Ensembl Mouse
Match: Srrm1 (serine/arginine repetitive matrix 1 [Source:MGI Symbol;Acc:MGI:1858303])

HSP 1 Score: 163.31 bits (412), Expect = 1.245e-45
Identity = 81/150 (54.00%), Postives = 116/150 (77.33%), Query Frame = 3
Query:   63 MDGGFFKGTTTEQDSRFSDKQSKLMRQMKFSDILDNKIDMSKIDLKIIKPWINKRLTELLGFDDDVVVAYVFNQLETKHPNPKEIQVNLTGFLNAKNSRMFLAELWELLISASLTDKGVPLNMIEAQLTELKNFEDEE---AKIKNQLED 503
            MD GFF+GT+ EQD+RFS+KQ KL++Q+KF++ L+ K+DMSK++L++IKPWI KR+TE+LGF+DDVV+ ++FNQLE K+P+ K +Q+NLTGFLN KN+R F+ ELW LL+SA     G+P   +E +  E+K  + E+   A +K Q ED
Sbjct:    1 MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEILGFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIPSAFLELKKEEIKQRQIEQEKLASLKKQDED 150          
BLAST of Serine/arginine repetitive matrix protein 1 vs. Ensembl Mouse
Match: Srrm1 (serine/arginine repetitive matrix 1 [Source:MGI Symbol;Acc:MGI:1858303])

HSP 1 Score: 169.859 bits (429), Expect = 4.143e-43
Identity = 81/150 (54.00%), Postives = 116/150 (77.33%), Query Frame = 3
Query:   63 MDGGFFKGTTTEQDSRFSDKQSKLMRQMKFSDILDNKIDMSKIDLKIIKPWINKRLTELLGFDDDVVVAYVFNQLETKHPNPKEIQVNLTGFLNAKNSRMFLAELWELLISASLTDKGVPLNMIEAQLTELKNFEDEE---AKIKNQLED 503
            MD GFF+GT+ EQD+RFS+KQ KL++Q+KF++ L+ K+DMSK++L++IKPWI KR+TE+LGF+DDVV+ ++FNQLE K+P+ K +Q+NLTGFLN KN+R F+ ELW LL+SA     G+P   +E +  E+K  + E+   A +K Q ED
Sbjct:    1 MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEILGFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIPSAFLELKKEEIKQRQIEQEKLASLKKQDED 150          
BLAST of Serine/arginine repetitive matrix protein 1 vs. Ensembl Mouse
Match: Srrm1 (serine/arginine repetitive matrix 1 [Source:MGI Symbol;Acc:MGI:1858303])

HSP 1 Score: 169.859 bits (429), Expect = 4.554e-43
Identity = 81/150 (54.00%), Postives = 116/150 (77.33%), Query Frame = 3
Query:   63 MDGGFFKGTTTEQDSRFSDKQSKLMRQMKFSDILDNKIDMSKIDLKIIKPWINKRLTELLGFDDDVVVAYVFNQLETKHPNPKEIQVNLTGFLNAKNSRMFLAELWELLISASLTDKGVPLNMIEAQLTELKNFEDEE---AKIKNQLED 503
            MD GFF+GT+ EQD+RFS+KQ KL++Q+KF++ L+ K+DMSK++L++IKPWI KR+TE+LGF+DDVV+ ++FNQLE K+P+ K +Q+NLTGFLN KN+R F+ ELW LL+SA     G+P   +E +  E+K  + E+   A +K Q ED
Sbjct:    1 MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEILGFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIPSAFLELKKEEIKQRQIEQEKLASLKKQDED 150          
BLAST of Serine/arginine repetitive matrix protein 1 vs. Ensembl Mouse
Match: Srrm1 (serine/arginine repetitive matrix 1 [Source:MGI Symbol;Acc:MGI:1858303])

HSP 1 Score: 169.474 bits (428), Expect = 5.477e-43
Identity = 81/150 (54.00%), Postives = 116/150 (77.33%), Query Frame = 3
Query:   63 MDGGFFKGTTTEQDSRFSDKQSKLMRQMKFSDILDNKIDMSKIDLKIIKPWINKRLTELLGFDDDVVVAYVFNQLETKHPNPKEIQVNLTGFLNAKNSRMFLAELWELLISASLTDKGVPLNMIEAQLTELKNFEDEE---AKIKNQLED 503
            MD GFF+GT+ EQD+RFS+KQ KL++Q+KF++ L+ K+DMSK++L++IKPWI KR+TE+LGF+DDVV+ ++FNQLE K+P+ K +Q+NLTGFLN KN+R F+ ELW LL+SA     G+P   +E +  E+K  + E+   A +K Q ED
Sbjct:    1 MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEILGFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIPSAFLELKKEEIKQRQIEQEKLASLKKQDED 150          
BLAST of Serine/arginine repetitive matrix protein 1 vs. Ensembl Mouse
Match: Srrm1 (serine/arginine repetitive matrix 1 [Source:MGI Symbol;Acc:MGI:1858303])

HSP 1 Score: 169.474 bits (428), Expect = 5.560e-43
Identity = 81/150 (54.00%), Postives = 116/150 (77.33%), Query Frame = 3
Query:   63 MDGGFFKGTTTEQDSRFSDKQSKLMRQMKFSDILDNKIDMSKIDLKIIKPWINKRLTELLGFDDDVVVAYVFNQLETKHPNPKEIQVNLTGFLNAKNSRMFLAELWELLISASLTDKGVPLNMIEAQLTELKNFEDEE---AKIKNQLED 503
            MD GFF+GT+ EQD+RFS+KQ KL++Q+KF++ L+ K+DMSK++L++IKPWI KR+TE+LGF+DDVV+ ++FNQLE K+P+ K +Q+NLTGFLN KN+R F+ ELW LL+SA     G+P   +E +  E+K  + E+   A +K Q ED
Sbjct:    1 MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEILGFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIPSAFLELKKEEIKQRQIEQEKLASLKKQDED 150          
BLAST of Serine/arginine repetitive matrix protein 1 vs. UniProt/SwissProt
Match: sp|Q5ZMJ9|SRRM1_CHICK (Serine/arginine repetitive matrix protein 1 OS=Gallus gallus OX=9031 GN=SRRM1 PE=2 SV=1)

HSP 1 Score: 170.629 bits (431), Expect = 1.736e-42
Identity = 81/150 (54.00%), Postives = 116/150 (77.33%), Query Frame = 3
Query:   63 MDGGFFKGTTTEQDSRFSDKQSKLMRQMKFSDILDNKIDMSKIDLKIIKPWINKRLTELLGFDDDVVVAYVFNQLETKHPNPKEIQVNLTGFLNAKNSRMFLAELWELLISASLTDKGVPLNMIEAQLTELKNFEDEE---AKIKNQLED 503
            MD GFF+GT+ EQD+RFS+KQ KL++Q+KF++ L+ K+DMSK++L++IKPWI KR+TE+LGF+DDVV+ ++FNQLE K+P+ K +Q+NLTGFLN KN+R F+ ELW LL+SA     G+P   +E +  E+K  + E+   A +K Q ED
Sbjct:    1 MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEILGFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIPTAFLELKKEEIKQRQIEQEKLASMKKQDED 150          
BLAST of Serine/arginine repetitive matrix protein 1 vs. UniProt/SwissProt
Match: sp|Q52KI8|SRRM1_MOUSE (Serine/arginine repetitive matrix protein 1 OS=Mus musculus OX=10090 GN=Srrm1 PE=1 SV=2)

HSP 1 Score: 169.859 bits (429), Expect = 3.406e-42
Identity = 81/150 (54.00%), Postives = 116/150 (77.33%), Query Frame = 3
Query:   63 MDGGFFKGTTTEQDSRFSDKQSKLMRQMKFSDILDNKIDMSKIDLKIIKPWINKRLTELLGFDDDVVVAYVFNQLETKHPNPKEIQVNLTGFLNAKNSRMFLAELWELLISASLTDKGVPLNMIEAQLTELKNFEDEE---AKIKNQLED 503
            MD GFF+GT+ EQD+RFS+KQ KL++Q+KF++ L+ K+DMSK++L++IKPWI KR+TE+LGF+DDVV+ ++FNQLE K+P+ K +Q+NLTGFLN KN+R F+ ELW LL+SA     G+P   +E +  E+K  + E+   A +K Q ED
Sbjct:    1 MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEILGFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIPSAFLELKKEEIKQRQIEQEKLASLKKQDED 150          
BLAST of Serine/arginine repetitive matrix protein 1 vs. UniProt/SwissProt
Match: sp|Q5R5Q2|SRRM1_PONAB (Serine/arginine repetitive matrix protein 1 OS=Pongo abelii OX=9601 GN=SRRM1 PE=2 SV=1)

HSP 1 Score: 169.474 bits (428), Expect = 4.215e-42
Identity = 81/150 (54.00%), Postives = 116/150 (77.33%), Query Frame = 3
Query:   63 MDGGFFKGTTTEQDSRFSDKQSKLMRQMKFSDILDNKIDMSKIDLKIIKPWINKRLTELLGFDDDVVVAYVFNQLETKHPNPKEIQVNLTGFLNAKNSRMFLAELWELLISASLTDKGVPLNMIEAQLTELKNFEDEE---AKIKNQLED 503
            MD GFF+GT+ EQD+RFS+KQ KL++Q+KF++ L+ K+DMSK++L++IKPWI KR+TE+LGF+DDVV+ ++FNQLE K+P+ K +Q+NLTGFLN KN+R F+ ELW LL+SA     G+P   +E +  E+K  + E+   A +K Q ED
Sbjct:    1 MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEILGFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIPSAFLELKKEEIKQRQIEQEKLASMKKQDED 150          
BLAST of Serine/arginine repetitive matrix protein 1 vs. UniProt/SwissProt
Match: sp|Q8IYB3|SRRM1_HUMAN (Serine/arginine repetitive matrix protein 1 OS=Homo sapiens OX=9606 GN=SRRM1 PE=1 SV=2)

HSP 1 Score: 169.474 bits (428), Expect = 4.346e-42
Identity = 81/150 (54.00%), Postives = 116/150 (77.33%), Query Frame = 3
Query:   63 MDGGFFKGTTTEQDSRFSDKQSKLMRQMKFSDILDNKIDMSKIDLKIIKPWINKRLTELLGFDDDVVVAYVFNQLETKHPNPKEIQVNLTGFLNAKNSRMFLAELWELLISASLTDKGVPLNMIEAQLTELKNFEDEE---AKIKNQLED 503
            MD GFF+GT+ EQD+RFS+KQ KL++Q+KF++ L+ K+DMSK++L++IKPWI KR+TE+LGF+DDVV+ ++FNQLE K+P+ K +Q+NLTGFLN KN+R F+ ELW LL+SA     G+P   +E +  E+K  + E+   A +K Q ED
Sbjct:    1 MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEILGFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIPSAFLELKKEEIKQRQIEQEKLASMKKQDED 150          
BLAST of Serine/arginine repetitive matrix protein 1 vs. UniProt/SwissProt
Match: sp|Q9USH5|YJQ5_SCHPO (PWI domain-containing protein C825.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC825.05c PE=1 SV=1)

HSP 1 Score: 116.701 bits (291), Expect = 2.055e-27
Identity = 57/146 (39.04%), Postives = 86/146 (58.90%), Query Frame = 3
Query:   72 GFFKGTTTEQDSRFSDKQSKLMRQMKFSDILDNKIDMSKIDLKIIKPWINKRLTELLGFDDDVVVAYVFNQLE-------------TKHPNPKEIQVNLTGFLNAKNSRMFLAELWELLISASLTDKGVPLNMIEAQLTELKNFED 470
            GF+KG   EQ++ F+    KLMR  KF    D K+DM K++++++KPWI  RL EL+GF+D+VV+ +V+  LE                 +P+++Q+NLTGFL + N+  F  ELW L+ISAS    G+P   I  +  E+   +D
Sbjct:    3 GFYKGVAAEQETLFTTADKKLMRSTKFPASYDTKVDMKKVNIEVLKPWIATRLNELIGFEDEVVINFVYGMLEEAVEASKTSDSQNESTLDPRKVQLNLTGFLES-NATAFTEELWSLIISASQNQYGIPEKFILEKKEEISKLKD 147          
BLAST of Serine/arginine repetitive matrix protein 1 vs. TrEMBL
Match: H3B4H5 (Serine and arginine repetitive matrix 1 OS=Latimeria chalumnae OX=7897 GN=SRRM1 PE=4 SV=1)

HSP 1 Score: 188.348 bits (477), Expect = 9.618e-46
Identity = 80/144 (55.56%), Postives = 114/144 (79.17%), Query Frame = 3
Query:   63 MDGGFFKGTTTEQDSRFSDKQSKLMRQMKFSDILDNKIDMSKIDLKIIKPWINKRLTELLGFDDDVVVAYVFNQLETKHPNPKEIQVNLTGFLNAKNSRMFLAELWELLISASLTDKGVPLNMIEAQLTELKNFEDEEAKIKNQ 494
            MD GFF+GT+ EQD+RFS+KQ KL+RQ+KF++ L+ K+DMSK++L++IKPWI KR+TE+LGF+DDV+V ++FNQLE K+P+ K +Q+NLTGFLN KN+R FL ELW LL+SA     G+P   +E +  E+K  + E+ K+ +Q
Sbjct:    1 MDAGFFRGTSAEQDNRFSNKQKKLLRQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEILGFEDDVIVEFIFNQLEEKNPDAKMMQINLTGFLNGKNAREFLGELWPLLLSAQENIAGIPSAFLEQKKEEIKQRQIEQEKLASQ 144          
BLAST of Serine/arginine repetitive matrix protein 1 vs. TrEMBL
Match: H2XTZ8 (PWI domain-containing protein OS=Ciona intestinalis OX=7719 GN=LOC100186689 PE=4 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 9.678e-46
Identity = 77/132 (58.33%), Postives = 104/132 (78.79%), Query Frame = 3
Query:   63 MDGGFFKGTTTEQDSRFSDKQSKLMRQMKFSDILDNKIDMSKIDLKIIKPWINKRLTELLGFDDDVVVAYVFNQLETKHPNPKEIQVNLTGFLNAKNSRMFLAELWELLISASLTDKGVPLNMIEAQLTELK 458
            MD GFF+GT+T+QD+RF++KQ KL++ MKF+D L  K+DM KI L  IKPWI+KR+TE+LGF+DDVV+A+V+N LE + P+PK +Q+NLTGFLN KNSR+FL ELWE L SA   D G+P   +E +  E++
Sbjct:    1 MDAGFFRGTSTDQDNRFANKQKKLLKSMKFADGLGVKVDMRKIQLDTIKPWISKRITEMLGFEDDVVIAFVYNSLEEQFPDPKVLQINLTGFLNGKNSRIFLGELWEHLASAQDNDMGIPQVFLEEKKEEIR 132          
BLAST of Serine/arginine repetitive matrix protein 1 vs. TrEMBL
Match: H2YMJ4 (PWI domain-containing protein OS=Ciona savignyi OX=51511 PE=4 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 3.826e-45
Identity = 74/120 (61.67%), Postives = 99/120 (82.50%), Query Frame = 3
Query:   63 MDGGFFKGTTTEQDSRFSDKQSKLMRQMKFSDILDNKIDMSKIDLKIIKPWINKRLTELLGFDDDVVVAYVFNQLETKHPNPKEIQVNLTGFLNAKNSRMFLAELWELLISASLTDKGVP 422
            MD GFF+GT+T+QD+RF++KQ KL++ MKF++ LD K+DM K+ L  +KPWI+KR+TE+LGF+DDVV+ +VFN LE +HP+PK +Q+NLTGFLN KNSR+FL ELWELL SA     G+P
Sbjct:    1 MDAGFFRGTSTDQDNRFANKQKKLLKSMKFAEGLDVKVDMKKVRLDTMKPWISKRITEILGFEDDVVIEFVFNSLEEQHPDPKVLQINLTGFLNGKNSRLFLGELWELLASAQANGAGIP 120          
BLAST of Serine/arginine repetitive matrix protein 1 vs. TrEMBL
Match: A0A1W2W961 (serine/arginine repetitive matrix protein 1-like OS=Ciona intestinalis OX=7719 GN=LOC100186689 PE=4 SV=1)

HSP 1 Score: 171.014 bits (432), Expect = 3.954e-45
Identity = 77/132 (58.33%), Postives = 104/132 (78.79%), Query Frame = 3
Query:   63 MDGGFFKGTTTEQDSRFSDKQSKLMRQMKFSDILDNKIDMSKIDLKIIKPWINKRLTELLGFDDDVVVAYVFNQLETKHPNPKEIQVNLTGFLNAKNSRMFLAELWELLISASLTDKGVPLNMIEAQLTELK 458
            MD GFF+GT+T+QD+RF++KQ KL++ MKF+D L  K+DM KI L  IKPWI+KR+TE+LGF+DDVV+A+V+N LE + P+PK +Q+NLTGFLN KNSR+FL ELWE L SA   D G+P   +E +  E++
Sbjct:    1 MDAGFFRGTSTDQDNRFANKQKKLLKSMKFADGLGVKVDMRKIQLDTIKPWISKRITEMLGFEDDVVIAFVYNSLEEQFPDPKVLQINLTGFLNGKNSRIFLGELWEHLASAQDNDMGIPQVFLEEKKEEIR 132          
BLAST of Serine/arginine repetitive matrix protein 1 vs. TrEMBL
Match: A0A183CGY1 (PWI domain-containing protein OS=Globodera pallida OX=36090 PE=4 SV=1)

HSP 1 Score: 175.637 bits (444), Expect = 6.604e-45
Identity = 73/134 (54.48%), Postives = 107/134 (79.85%), Query Frame = 3
Query:   57 VTMDGGFFKGTTTEQDSRFSDKQSKLMRQMKFSDILDNKIDMSKIDLKIIKPWINKRLTELLGFDDDVVVAYVFNQLETKHPNPKEIQVNLTGFLNAKNSRMFLAELWELLISASLTDKGVPLNMIEAQLTELK 458
            + MD GF++GT+T+QD RF+DK+ KL+RQMKF ++LD KID++KI+L +IKPWI  +L E+LG +DDVVV YVF QLE K  NPK++Q+NLTGFLNA+ +R F+ ELW++ + A  + +G+P +++E ++ ELK
Sbjct:   42 IAMDAGFYRGTSTDQDIRFTDKERKLLRQMKFENVLDTKIDLAKINLDVIKPWITLKLNEILGMEDDVVVEYVFTQLEEKELNPKKMQINLTGFLNARRAREFMGELWQMFVEAQSSPEGIPTSLVEKKVQELK 175          
BLAST of Serine/arginine repetitive matrix protein 1 vs. Ensembl Cavefish
Match: ENSAMXT00000054963.1 (pep primary_assembly:Astyanax_mexicanus-2.0:9:7602066:7607564:-1 gene:ENSAMXG00000040320.1 transcript:ENSAMXT00000054963.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 159.458 bits (402), Expect = 5.743e-44
Identity = 73/141 (51.77%), Postives = 111/141 (78.72%), Query Frame = 3
Query:   63 MDGGFFKGTTTEQDSRFSDKQSKLMRQMKFSDILDNKIDMSKIDLKIIKPWINKRLTELLGFDDDVVVAYVFNQLETKHPNPKEIQVNLTGFLNAKNSRMFLAELWELLISASLTDKGVPLNMIEAQLTELKNFEDEEAKI 485
            MD GFF+GT+ EQD+RFS+K  KL++Q+KF++ L+ K+DM+K++L++IKPWI +R+TE+LGF+DDVV+ ++FNQLE K+P+ K +Q+NLTGFLN KN+R F+ +LW LL+SA     G+P   +E +  E+K  + E+ K+
Sbjct:    1 MDAGFFRGTSAEQDNRFSNKHKKLLKQLKFAECLEKKVDMTKVNLEVIKPWITQRVTEILGFEDDVVIEFIFNQLEEKNPDSKMMQINLTGFLNGKNAREFMKDLWPLLLSAQENIAGIPSAFLEQKKEEIKQRQIEQEKL 141          
BLAST of Serine/arginine repetitive matrix protein 1 vs. Ensembl Cavefish
Match: ENSAMXT00000046927.1 (pep primary_assembly:Astyanax_mexicanus-2.0:9:7604744:7607564:-1 gene:ENSAMXG00000040320.1 transcript:ENSAMXT00000046927.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 100.138 bits (248), Expect = 8.352e-25
Identity = 46/78 (58.97%), Postives = 69/78 (88.46%), Query Frame = 3
Query:   63 MDGGFFKGTTTEQDSRFSDKQSKLMRQMKFSDILDNKIDMSKIDLKIIKPWINKRLTELLGFDDDVVVAYVFNQLETK 296
            MD GFF+GT+ EQD+RFS+K  KL++Q+KF++ L+ K+DM+K++L++IKPWI +R+TE+LGF+DDVV+ ++FNQLE K
Sbjct:    1 MDAGFFRGTSAEQDNRFSNKHKKLLKQLKFAECLEKKVDMTKVNLEVIKPWITQRVTEILGFEDDVVIEFIFNQLEEK 78          
BLAST of Serine/arginine repetitive matrix protein 1 vs. Ensembl Nematostella
Match: EDO32561 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUQ0])

HSP 1 Score: 160.999 bits (406), Expect = 3.700e-46
Identity = 71/127 (55.91%), Postives = 101/127 (79.53%), Query Frame = 3
Query:   81 KGTTTEQDSRFSDKQSKLMRQMKFSDILDNKIDMSKIDLKIIKPWINKRLTELLGFDDDVVVAYVFNQLET-KHPNPKEIQVNLTGFLNAKNSRMFLAELWELLISASLTDKGVPLNMIEAQLTELK 458
            KGT+ EQD+RF DKQ KL++ ++F D+LD K+DM KI+L ++KPWI KR+T++LGF+DDVV+ +VFN LE+ KHP+PK +Q+N+TGFL AKN+R+F+ ELWELL+SA     G+P   +E +  E+K
Sbjct:    2 KGTSAEQDNRFRDKQKKLLKSIRFEDVLDKKVDMEKINLDVLKPWITKRITDMLGFEDDVVLEFVFNMLESEKHPDPKVMQINITGFLQAKNARIFMGELWELLVSAQENIGGIPTEFLEKKKEEIK 128          
BLAST of Serine/arginine repetitive matrix protein 1 vs. Ensembl Nematostella
Match: EDO28181 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T770])

HSP 1 Score: 67.0106 bits (162), Expect = 3.228e-14
Identity = 28/54 (51.85%), Postives = 40/54 (74.07%), Query Frame = 3
Query:  297 HPNPKEIQVNLTGFLNAKNSRMFLAELWELLISASLTDKGVPLNMIEAQLTELK 458
            HP+PK +Q+N+TGFL AKN+R+F+ ELWELL+SA     G+P   +E +  E+K
Sbjct:    1 HPDPKVMQINITGFLQAKNARIFMGELWELLVSAQENIGGIPTEFLEKKKEEIK 54          
BLAST of Serine/arginine repetitive matrix protein 1 vs. Ensembl Medaka
Match: ENSORLT00000021894.2 (pep primary_assembly:ASM223467v1:22:16875116:16883660:1 gene:ENSORLG00000017510.2 transcript:ENSORLT00000021894.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 162.54 bits (410), Expect = 5.011e-45
Identity = 76/141 (53.90%), Postives = 112/141 (79.43%), Query Frame = 3
Query:   63 MDGGFFKGTTTEQDSRFSDKQSKLMRQMKFSDILDNKIDMSKIDLKIIKPWINKRLTELLGFDDDVVVAYVFNQLETKHPNPKEIQVNLTGFLNAKNSRMFLAELWELLISASLTDKGVPLNMIEAQLTELKNFEDEEAKI 485
            MD GFF+GT+ EQD+RFS+KQ KL++Q+KF++ LD K+DM+K++L++IKPWI +R+TE+LGF+DDVV+ ++FNQLE KHP+ K +Q+NLTGFLN KN+R F+ +LW LL+SA     G+P   +E +  E++  + E+ KI
Sbjct:    1 MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLDKKVDMTKVNLEVIKPWITQRVTEILGFEDDVVIEFIFNQLEEKHPDSKMMQINLTGFLNGKNAREFMKDLWPLLLSAQENIAGIPSAFLEQKKEEIRQRQIEQEKI 141          
BLAST of Serine/arginine repetitive matrix protein 1 vs. Planmine SMEST
Match: SMESG000023657.1 (SMESG000023657.1)

HSP 1 Score: 682.559 bits (1760), Expect = 0.000e+0
Identity = 586/591 (99.15%), Postives = 588/591 (99.49%), Query Frame = 3
Query:   63 MDGGFFKGTTTEQDSRFSDKQSKLMRQMKFSDILDNKIDMSKIDLKIIKPWINKRLTELLGFDDDVVVAYVFNQLETKHPNPKEIQVNLTGFLNAKNSRMFLAELWELLISASLTDKGVPLNMIEAQLTELKNFEDEEAKIKNQLEDESAKFVKLLKIEPAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKHSTEKXXXXXXXXXXXXXXXXXXXXGKPXXXXXXXXXXXXXXXXXXXXXXGSRRRSNEKVKRREVSETKRDSLQMKKENKSPKLQEVXXXXXXXXXXXXXXIDSDNKNILNLDYRDNSEEIPKEDVXXXXXXXXXXXXXXXXXWRDASGDSKRNERRKSNEGXXXXXXXXXXXXXXXXXEEIPHGKPRAREEFVDEKQXXXXXXXXXXXXXXEEYNDGXXXXXXXXXXXXSPVDXXXXXXXXXXXXXXXXXXXXXGNRKYEXXXXXXXXXXXXXXXXESKERYVEEKHRREVSXXXXXXXXXXXXXXXXNESESPKEAPANRKRYSESSPDRQRGRNAVNDNKKRFESSNSSEEILRKHKIGSMYADRMNDDKSRVRKEIVKTRERPDTKLY 1835
            MDGGFFKGTTTEQDSRFSDKQSKLMRQMKFSDILDNKIDMSKIDLKIIKPWINKRLTELLGFDDDVVVAYVFNQLETKHPNPKEIQVNLTGFLNAKNSRMFLAELWELLISASLTDKGVPLNMIEAQLTELKNFEDEEAKIKNQLEDESAKFVKLLKIEPADEKEKEKDLKKKDRERSPRRNNSPRNDDRNRRRSNERKHSTEKRSNDRRRSGSRRRSNERRHSGKPRSNDKISRRRSRSRQSIERKRSGSRRRSNEKVKRREVSETKRD+LQMKKENKSPKLQEVKKRERSEEKKRKKSIDSDNKNILNLDYRDNSEEIPKEDVKS EEKKRESSMESKGKWRDASGDSKRNERRKSNEGRMRNRDDNNDNRRQRRREEIPHGKPRAREEFVDEKQR +DDNFDDKRKRREEYNDGRQRGRENRRRSRSPV KRERHRVERERSRRKHSRSREGNRKYERYNDNGLNRGRRDRRDESKERYVEEKHRREVSEEKKEWKQEIIKETWKNESESPKEAPANRKRYSESSPDRQRGRNAVNDNKKRFESSNSSEEILRKHKIGSMYADRMNDDKSRVRKEIVKTRERPDTKLY
Sbjct:    1 MDGGFFKGTTTEQDSRFSDKQSKLMRQMKFSDILDNKIDMSKIDLKIIKPWINKRLTELLGFDDDVVVAYVFNQLETKHPNPKEIQVNLTGFLNAKNSRMFLAELWELLISASLTDKGVPLNMIEAQLTELKNFEDEEAKIKNQLEDESAKFVKLLKIEPADEKEKEKDLKKKDRERSPRRNNSPRNDDRNRRRSNERKHSTEKRSNDRRRSGSRRRSNERRHSGKPRSNDKISRRRSRSRQSIERKRSGSRRRSNEKVKRREVSETKRDTLQMKKENKSPKLQEVKKRERSEEKKRKKSIDSDNKNILNLDYRDNSEEIPKEDVKSVEEKKRESSMESKGKWRDASGDSKRNERRKSNEGRMRNRDDNNDNRRQRRREEIPHGKPRAREEFVDEKQRERDDNFDDKRKRREEYNDGRQRGRENRRRSRSPVGKRERHRVERERSRRKHSRSREGNRKYERYNDNGLNRGRRDRRDESKERYVEEKHRREVSEEKKEWKQEIIKETWKNESESPKEAPANRKRYSESSPDRQRGRNAVNDNKKRFESSNSSEEILRKHKIGSMYADRMNDDKSRVRKEIVKTRERPDTKLY 591          

HSP 2 Score: 75.0998 bits (183), Expect = 1.141e-13
Identity = 35/35 (100.00%), Postives = 35/35 (100.00%), Query Frame = 1
Query: 1885 LRDAEMAETSRLKAGPITADRLRQSNDQKARIVRH 1989
            LRDAEMAETSRLKAGPITADRLRQSNDQKARIVRH
Sbjct:  608 LRDAEMAETSRLKAGPITADRLRQSNDQKARIVRH 642          
BLAST of Serine/arginine repetitive matrix protein 1 vs. Planmine SMEST
Match: SMESG000013292.1 (SMESG000013292.1)

HSP 1 Score: 121.324 bits (303), Expect = 6.530e-29
Identity = 51/90 (56.67%), Postives = 74/90 (82.22%), Query Frame = 3
Query:  129 KLMRQMKFSDILDNKIDMSKIDLKIIKPWINKRLTELLGFDDDVVVAYVFNQLETKHPNPKEIQVNLTGFLNAKNSRMFLAELWELLISA 398
            KLM++MKF DIL+N++DM  +DL  +KPWI+KR+TEL   +D+V++ Y++NQLE K P+PKEIQ NL+GFL+ KNSR+F  ELW+ L+++
Sbjct:    3 KLMKEMKFDDILNNRVDMENVDLTFVKPWISKRITELTKDEDEVLIDYIYNQLEPKFPDPKEIQTNLSGFLSYKNSRIFTGELWKQLLNS 92          
BLAST of Serine/arginine repetitive matrix protein 1 vs. Planmine SMEST
Match: SMESG000013292.1 (SMESG000013292.1)

HSP 1 Score: 111.694 bits (278), Expect = 1.287e-25
Identity = 51/104 (49.04%), Postives = 75/104 (72.12%), Query Frame = 3
Query:  126 SKLMRQMKFSDILDNKIDMSKIDLKIIKPWINKRLTELLGFDDDVVVAYVFNQLETK-------------HPNPKEIQVNLTGFLNAKNSRMFLAELWELLISA 398
            +KLM++MKF DIL+N++DM  +DL  +KPWI+KR+TEL   +D+V++ Y++NQLE K              P+PKEIQ NL+GFL+ KNSR+F  ELW+ L+++
Sbjct:    2 NKLMKEMKFDDILNNRVDMENVDLTFVKPWISKRITELTKDEDEVLIDYIYNQLEPKVVNFFYWQIVQPMFPDPKEIQTNLSGFLSYKNSRIFTGELWKQLLNS 105          
The following BLAST results are available for this feature:
BLAST of Serine/arginine repetitive matrix protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SRRM15.613e-4354.00serine and arginine repetitive matrix 1 [Source:HG... [more]
SRRM19.050e-4354.00serine and arginine repetitive matrix 1 [Source:HG... [more]
SRRM19.314e-4354.00serine and arginine repetitive matrix 1 [Source:HG... [more]
SRRM13.084e-3153.47serine and arginine repetitive matrix 1 [Source:HG... [more]
SRRM15.366e-3052.25serine and arginine repetitive matrix 1 [Source:HG... [more]
back to top
BLAST of Serine/arginine repetitive matrix protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rsr-16.041e-4044.93SR protein related [Source:UniProtKB/TrEMBL;Acc:O... [more]
rsr-16.041e-4044.93SR protein related [Source:UniProtKB/TrEMBL;Acc:O... [more]
back to top
BLAST of Serine/arginine repetitive matrix protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
SRm1601.545e-4050.75gene:FBgn0036340 transcript:FBtr0075883[more]
back to top
BLAST of Serine/arginine repetitive matrix protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
srrm12.487e-4352.48serine/arginine repetitive matrix 1 [Source:ZFIN;A... [more]
srrm14.273e-4152.48serine/arginine repetitive matrix 1 [Source:ZFIN;A... [more]
srrm14.303e-4152.48serine/arginine repetitive matrix 1 [Source:ZFIN;A... [more]
srrm11.424e-2560.26serine/arginine repetitive matrix 1 [Source:ZFIN;A... [more]
back to top
BLAST of Serine/arginine repetitive matrix protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
srrm11.935e-4153.90serine and arginine repetitive matrix 1 [Source:NC... [more]
srrm19.284e-3751.45serine and arginine repetitive matrix 1 [Source:NC... [more]
back to top
BLAST of Serine/arginine repetitive matrix protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Srrm11.245e-4554.00serine/arginine repetitive matrix 1 [Source:MGI Sy... [more]
Srrm14.143e-4354.00serine/arginine repetitive matrix 1 [Source:MGI Sy... [more]
Srrm14.554e-4354.00serine/arginine repetitive matrix 1 [Source:MGI Sy... [more]
Srrm15.477e-4354.00serine/arginine repetitive matrix 1 [Source:MGI Sy... [more]
Srrm15.560e-4354.00serine/arginine repetitive matrix 1 [Source:MGI Sy... [more]
back to top
BLAST of Serine/arginine repetitive matrix protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5ZMJ9|SRRM1_CHICK1.736e-4254.00Serine/arginine repetitive matrix protein 1 OS=Gal... [more]
sp|Q52KI8|SRRM1_MOUSE3.406e-4254.00Serine/arginine repetitive matrix protein 1 OS=Mus... [more]
sp|Q5R5Q2|SRRM1_PONAB4.215e-4254.00Serine/arginine repetitive matrix protein 1 OS=Pon... [more]
sp|Q8IYB3|SRRM1_HUMAN4.346e-4254.00Serine/arginine repetitive matrix protein 1 OS=Hom... [more]
sp|Q9USH5|YJQ5_SCHPO2.055e-2739.04PWI domain-containing protein C825.05c OS=Schizosa... [more]
back to top
BLAST of Serine/arginine repetitive matrix protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
H3B4H59.618e-4655.56Serine and arginine repetitive matrix 1 OS=Latimer... [more]
H2XTZ89.678e-4658.33PWI domain-containing protein OS=Ciona intestinali... [more]
H2YMJ43.826e-4561.67PWI domain-containing protein OS=Ciona savignyi OX... [more]
A0A1W2W9613.954e-4558.33serine/arginine repetitive matrix protein 1-like O... [more]
A0A183CGY16.604e-4554.48PWI domain-containing protein OS=Globodera pallida... [more]
back to top
BLAST of Serine/arginine repetitive matrix protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSAMXT00000054963.15.743e-4451.77pep primary_assembly:Astyanax_mexicanus-2.0:9:7602... [more]
ENSAMXT00000046927.18.352e-2558.97pep primary_assembly:Astyanax_mexicanus-2.0:9:7604... [more]
back to top
BLAST of Serine/arginine repetitive matrix protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Serine/arginine repetitive matrix protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Serine/arginine repetitive matrix protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO325613.700e-4655.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO281813.228e-1451.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Serine/arginine repetitive matrix protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSORLT00000021894.25.011e-4553.90pep primary_assembly:ASM223467v1:22:16875116:16883... [more]
back to top
BLAST of Serine/arginine repetitive matrix protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000023657.11.141e-1399.15SMESG000023657.1[more]
SMESG000013292.16.530e-2956.67SMESG000013292.1[more]
SMESG000013292.11.287e-2549.04SMESG000013292.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024600 ID=SMED30024600|Name=Serine/arginine repetitive matrix protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=2434bp
TGTTTAAGTAATCGACATAATAAGCTATTTTTCAATTTATAGATATTAAT
ATATCTGTTACAATGGACGGTGGATTTTTTAAAGGTACAACTACAGAACA
GGATTCTAGATTTTCTGATAAGCAATCTAAATTAATGAGACAAATGAAGT
TTAGCGATATTCTTGATAACAAGATTGATATGAGCAAAATTGATCTAAAA
ATAATTAAACCGTGGATCAATAAACGCCTTACCGAATTACTCGGTTTTGA
TGATGATGTCGTCGTGGCTTATGTATTTAATCAATTGGAAACTAAACATC
CAAATCCAAAAGAAATTCAAGTGAATTTGACTGGATTTTTAAATGCAAAA
AATTCTAGAATGTTTTTAGCCGAGCTTTGGGAATTGTTAATTTCTGCTTC
ATTAACAGATAAAGGTGTCCCATTAAATATGATTGAAGCTCAATTAACAG
AGTTGAAAAATTTCGAGGACGAAGAAGCTAAAATTAAAAACCAATTAGAA
GATGAATCTGCAAAATTTGTTAAGTTGCTTAAAATCGAACCAGCCGATGA
AAAAGAGAAAGAAAAGGATTTAAAGAAAAAGGATCGAGAAAGATCTCCCA
GAAGAAATAATTCCCCACGTAATGATGATAGGAATCGTCGAAGATCCAAT
GAAAGGAAACATTCGACTGAAAAGCGATCAAATGATCGTAGGCGTTCCGG
AAGCAGGCGACGCTCCAATGAACGACGACATTCAGGGAAACCGCGATCCA
ATGATAAAATCAGTAGACGGCGATCCAGAAGCAGACAATCGATTGAAAGG
AAGCGCTCAGGAAGCAGGAGGCGCTCAAATGAAAAAGTCAAAAGAAGAGA
AGTGTCAGAAACAAAAAGAGATTCTTTGCAAATGAAGAAAGAAAACAAAT
CTCCAAAACTACAGGAAGTTAAGAAGCGTGAAAGATCGGAAGAAAAGAAA
AGAAAAAAATCAATCGATAGCGATAATAAGAATATATTAAATCTCGATTA
TAGGGATAATTCAGAAGAAATACCGAAAGAAGATGTGAAAAGTGGGGAAG
AAAAGAAAAGAGAAAGCAGCATGGAGAGTAAAGGGAAATGGAGAGATGCG
AGTGGCGATAGCAAGCGAAATGAGCGTAGGAAGAGTAATGAGGGAAGAAT
GCGAAATAGAGATGATAATAATGATAATAGAAGGCAAAGAAGACGAGAAG
AAATTCCTCATGGAAAGCCAAGAGCGAGAGAGGAATTTGTAGACGAGAAG
CAAAGGGGAAAAGATGACAACTTTGACGACAAGCGAAAACGAAGAGAAGA
GTATAATGATGGCCGACAGCGTGGCAGAGAAAACAGAAGACGCAGTCGTA
GCCCTGTGGATAAGCGTGAGAGACACCGAGTGGAACGGGAAAGAAGCAGA
AGGAAGCATAGTCGAAGTCGCGAAGGAAATCGAAAGTATGAGAGATATAA
TGACAACGGTTTGAATAGAGGAAGACGGGATCGAAGAGACGAGTCTAAGG
AGCGTTATGTTGAAGAGAAGCATCGAAGAGAAGTATCAGAAGAAAAAAAA
GAGTGGAAACAGGAAATCATCAAAGAAACCTGGAAAAACGAGTCAGAAAG
TCCCAAGGAAGCCCCAGCCAATAGAAAACGCTATTCCGAATCCTCTCCCG
ATCGACAGAGAGGAAGAAATGCGGTCAATGACAACAAGAAACGATTTGAG
TCATCCAATTCCTCAGAAGAAATTCTGAGAAAACACAAAATCGGATCGAT
GTATGCCGATAGGATGAATGACGACAAATCTCGAGTCAGAAAGGAAATCG
TCAAGACCCGAGAGAGGCCCGACACGAAGCTCTATAATAAACGGAATCAA
AACCGAAGAAGGAGTTCGGAAGAGAAACGACCGGTTGAGAGACGCCGAGA
TGGCCGAGACGAGCAGGTTAAAGGCTGGCCCAATCACAGCCGATCGTCTT
CGACAGTCAAACGATCAGAAGGCAAGAATCGTCCGACACTAGCGGTTGAA
CGCAATCAGAAGTTCCGACGCAGTCAGTCTTCATCCAGCAGTTCCAGTAG
CAGTTCAGGCTCGTCTGACAGCAGCTCATCGAGTTCGTCGAGTTCTTCGT
CTGATAGCAGTTCATCTTCCAGCTCTTCATCGGACGAGGAAGAAACGAAA
AAACCAGACGAGTCCGATCGAAGACTCGTGAAGAAAAGGAGATCGGCAGA
GAACGATGAACGAGACAGAGATGATAGCTTCTTGAAGGAAGAAGAAAAAA
GATTAAGACAGAAAGCTTTGGAATCTTTACAAAGACGAAAATAATAATAA
TAAATAAATCTCGGCTGATGCAGTGAAGCAATGATTTATTTTATGTTTCA
ATTTTTATTGTAAATGAAAGTTTGAAGTTTTAGAATTTGTCTTCATTCAA
ATATATGTAAATATCACGCTTTTGTACTTTCTTT
back to top

protein sequence of SMED30024600-orf-1

>SMED30024600-orf-1 ID=SMED30024600-orf-1|Name=SMED30024600-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=744bp
MDGGFFKGTTTEQDSRFSDKQSKLMRQMKFSDILDNKIDMSKIDLKIIKP
WINKRLTELLGFDDDVVVAYVFNQLETKHPNPKEIQVNLTGFLNAKNSRM
FLAELWELLISASLTDKGVPLNMIEAQLTELKNFEDEEAKIKNQLEDESA
KFVKLLKIEPADEKEKEKDLKKKDRERSPRRNNSPRNDDRNRRRSNERKH
STEKRSNDRRRSGSRRRSNERRHSGKPRSNDKISRRRSRSRQSIERKRSG
SRRRSNEKVKRREVSETKRDSLQMKKENKSPKLQEVKKRERSEEKKRKKS
IDSDNKNILNLDYRDNSEEIPKEDVKSGEEKKRESSMESKGKWRDASGDS
KRNERRKSNEGRMRNRDDNNDNRRQRRREEIPHGKPRAREEFVDEKQRGK
DDNFDDKRKRREEYNDGRQRGRENRRRSRSPVDKRERHRVERERSRRKHS
RSREGNRKYERYNDNGLNRGRRDRRDESKERYVEEKHRREVSEEKKEWKQ
EIIKETWKNESESPKEAPANRKRYSESSPDRQRGRNAVNDNKKRFESSNS
SEEILRKHKIGSMYADRMNDDKSRVRKEIVKTRERPDTKLYNKRNQNRRR
SSEEKRPVERRRDGRDEQVKGWPNHSRSSSTVKRSEGKNRPTLAVERNQK
FRRSQSSSSSSSSSSGSSDSSSSSSSSSSSDSSSSSSSSSDEEETKKPDE
SDRRLVKKRRSAENDERDRDDSFLKEEEKRLRQKALESLQRRK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0003723RNA binding
Vocabulary: cellular component
TermDefinition
GO:0005681spliceosomal complex
GO:0005634nucleus
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR002483PWI_dom
Vocabulary: biological process
TermDefinition
GO:0006397mRNA processing
GO:0008380RNA splicing