TNF receptor-associated factor

Overview
NameTNF receptor-associated factor
Smed IDSMED30024587
Length (bp)1356
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TNF receptor-associated factor (SMED30024587) t-SNE clustered cells

Violin plots show distribution of expression levels for TNF receptor-associated factor (SMED30024587) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TNF receptor-associated factor (SMED30024587) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TNF receptor-associated factor (SMED30024587) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024587

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30024587SMESG000011147.1 SmedASXL_000072SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30024587SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000079250.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000073618.1 SMESG000073174.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000065567.1 SMESG000061192.1 SMESG000060952.1 SMESG000060260.1 SMESG000059623.1 SMESG000050492.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000048159.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000034716.1 SMESG000033763.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000011147.1 SMESG000007021.1 SMESG000006554.1 SMESG000001897.1 SMESG000070487.1 SMESG000068881.1 SMESG000064552.1 SMESG000063831.1 SMESG000056926.1 SMESG000050300.1 SMESG000047318.1 SMESG000047014.1 SMESG000043279.1 SMESG000030931.1 SMESG000023641.1 SMESG000018675.1 SMESG000017256.1 SMESG000013665.1 SMESG000013089.1 SMESG000011196.1 SMESG000009621.1 SMESG000008519.1 SMESG000005066.1 dd_Smed_v4_129_2_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30024587SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000079250.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000073618.1 SMESG000073174.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000065567.1 SMESG000061192.1 SMESG000060952.1 SMESG000060260.1 SMESG000059623.1 SMESG000050492.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000048159.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000034716.1 SMESG000033763.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000011147.1 SMESG000007021.1 SMESG000006554.1 SMESG000001897.1 SMESG000070487.1 SMESG000068881.1 SMESG000064552.1 SMESG000063831.1 SMESG000056926.1 SMESG000050300.1 SMESG000047318.1 SMESG000047014.1 SMESG000043279.1 SMESG000030931.1 SMESG000023641.1 SMESG000018675.1 SMESG000017256.1 SMESG000013665.1 SMESG000013089.1 SMESG000011196.1 SMESG000009621.1 SMESG000008519.1 SMESG000005066.1 dd_Smed_v4_129_2_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30024587SMESG000011147.1 OX_Smed_1.0.07125ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
neuronSMED30024587SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000079250.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000073618.1 SMESG000073174.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000065567.1 SMESG000061192.1 SMESG000060952.1 SMESG000060260.1 SMESG000059623.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000048159.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000034716.1 SMESG000033763.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000011147.1 SMESG000007021.1 SMESG000001897.1 SMESG000068881.1 SMESG000064552.1 SMESG000056926.1 SMESG000050300.1 SMESG000043279.1 SMESG000018675.1 SMESG000017256.1 SMESG000013089.1 SMESG000011196.1 SMESG000009621.1 SMESG000006554.1 SMESG000005066.1 SMESG000050492.1 SMESG000070487.1 SMESG000063831.1 SMESG000047318.1 SMESG000047014.1 SMESG000030931.1 SMESG000023641.1 SMESG000013665.1 SMESG000008519.1 dd_Smed_v6_129_2dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cholinergic neuronSMED30024587SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000079250.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000073618.1 SMESG000073174.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000065567.1 SMESG000061192.1 SMESG000060952.1 SMESG000060260.1 SMESG000059623.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000048159.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000034716.1 SMESG000033763.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000011147.1 SMESG000007021.1 SMESG000001897.1 SMESG000068881.1 SMESG000064552.1 SMESG000056926.1 SMESG000050300.1 SMESG000043279.1 SMESG000018675.1 SMESG000017256.1 SMESG000013089.1 SMESG000011196.1 SMESG000009621.1 SMESG000006554.1 SMESG000005066.1 SMESG000050492.1 SMESG000070487.1 SMESG000063831.1 SMESG000047318.1 SMESG000047014.1 SMESG000030931.1 SMESG000023641.1 SMESG000013665.1 SMESG000008519.1 dd_Smed_v6_129_2dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
GABAergic neuronSMED30024587SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000079250.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000073618.1 SMESG000073174.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000065567.1 SMESG000061192.1 SMESG000060952.1 SMESG000060260.1 SMESG000059623.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000048159.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000034716.1 SMESG000033763.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000011147.1 SMESG000007021.1 SMESG000001897.1 SMESG000068881.1 SMESG000064552.1 SMESG000056926.1 SMESG000050300.1 SMESG000043279.1 SMESG000018675.1 SMESG000017256.1 SMESG000013089.1 SMESG000011196.1 SMESG000009621.1 SMESG000006554.1 SMESG000005066.1 SMESG000050492.1 SMESG000070487.1 SMESG000063831.1 SMESG000047318.1 SMESG000047014.1 SMESG000030931.1 SMESG000023641.1 SMESG000013665.1 SMESG000008519.1 dd_Smed_v6_129_2dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pigment cellSMED30024587SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000079250.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000073618.1 SMESG000073174.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000065567.1 SMESG000061192.1 SMESG000060952.1 SMESG000060260.1 SMESG000059623.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000048159.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000034716.1 SMESG000033763.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000011147.1 SMESG000007021.1 SMESG000001897.1 SMESG000068881.1 SMESG000064552.1 SMESG000056926.1 SMESG000050300.1 SMESG000043279.1 SMESG000018675.1 SMESG000017256.1 SMESG000013089.1 SMESG000011196.1 SMESG000009621.1 SMESG000006554.1 SMESG000005066.1 SMESG000050492.1 SMESG000070487.1 SMESG000063831.1 SMESG000047318.1 SMESG000047014.1 SMESG000030931.1 SMESG000023641.1 SMESG000013665.1 SMESG000008519.1 dd_Smed_v6_129_2dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30024587SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000079250.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000073618.1 SMESG000073174.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000065567.1 SMESG000061192.1 SMESG000060952.1 SMESG000060260.1 SMESG000059623.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000048159.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000034716.1 SMESG000033763.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000011147.1 SMESG000007021.1 SMESG000001897.1 SMESG000068881.1 SMESG000064552.1 SMESG000056926.1 SMESG000050300.1 SMESG000043279.1 SMESG000018675.1 SMESG000017256.1 SMESG000013089.1 SMESG000011196.1 SMESG000009621.1 SMESG000006554.1 SMESG000005066.1 SMESG000050492.1 SMESG000070487.1 SMESG000063831.1 SMESG000047318.1 SMESG000047014.1 SMESG000030931.1 SMESG000023641.1 SMESG000013665.1 SMESG000008519.1 dd_Smed_v6_129_2dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF2 (TNF receptor associated factor 2 [Source:HGNC Symbol;Acc:HGNC:12032])

HSP 1 Score: 87.0409 bits (214), Expect = 9.891e-18
Identity = 71/263 (27.00%), Postives = 115/263 (43.73%), Query Frame = 2
Query:  443 LNICEKKDKCVYSLENITGII-ENLQKYAFRSMEIEEQHKTDFEFLKTNLKSRDQELVNMRRLISENQESIQTLEEAVNCLLEENETLKRLIXXXXXXXXXXXXXXYAILKTKPFIWKINHFSEKQLEFEFDTDGSVFSEAFYTHDNGYKLCLGINPNGANQYLGKYLFTFFCIMKGPYDDNLPWPMKLEVVLSIVDQISLXXXXXXXXXXXXXXEMLQHSFSKPKFERNEGIGDNEFISFKELHLLNNILRNDSILLRCSIN 1228
            L  CE  +K   + ENI  ++   +++ A  +     QH+ D + ++  L S+ Q+L    R I     ++  LE+ V  L  E  T   +                       FIWKI+ F+ K+ E       ++FS AFYT   GYK+CL I  NG     G +L  FF +MKGP D  L WP   +V L ++DQ             +   ++   SF +P  + N   G   F    ++   N+ +R+D+I ++  ++
Sbjct:  269 LQRCESLEKKTATFENIVCVLNREVERVAMTAEACSRQHRLDQDKIEA-LSSKVQQL---ERSIGLKDLAMADLEQKV--LEMEASTYDGV-----------------------FIWKISDFARKRQEAVAGRIPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLFFVVMKGPNDALLRWPFNQKVTLMLLDQ-----NNREHVIDAFRPDVTSSSFQRPVNDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVD 497          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 76.2554 bits (186), Expect = 3.723e-14
Identity = 48/162 (29.63%), Postives = 77/162 (47.53%), Query Frame = 2
Query:  758 YAILKTKPF----IWKINHFSEKQLEFEFDTDGSVFSEAFYTHDNGYKLCLGINPNGANQYLGKYLFTFFCIMKGPYDDNLPWPMKLEVVLSIVDQISLXXXXXXXXXXXXXXEMLQHSFSKPKFERNEGIGDNEFISFKELHLLNNILRNDSILLRCSINA 1231
            + +L+T  +    IWKI  +  ++ E       S++S+ FYT   GYK+C  +  NG     G +L  FF IM+G YD  LPWP K +V L ++DQ S           +   +    SF KP  E N   G   F++   L      +++D+I ++  ++ 
Sbjct:  381 FQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGS----SRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQTVLE-NGTYIKDDTIFIKVIVDT 537          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 76.2554 bits (186), Expect = 3.723e-14
Identity = 48/162 (29.63%), Postives = 77/162 (47.53%), Query Frame = 2
Query:  758 YAILKTKPF----IWKINHFSEKQLEFEFDTDGSVFSEAFYTHDNGYKLCLGINPNGANQYLGKYLFTFFCIMKGPYDDNLPWPMKLEVVLSIVDQISLXXXXXXXXXXXXXXEMLQHSFSKPKFERNEGIGDNEFISFKELHLLNNILRNDSILLRCSINA 1231
            + +L+T  +    IWKI  +  ++ E       S++S+ FYT   GYK+C  +  NG     G +L  FF IM+G YD  LPWP K +V L ++DQ S           +   +    SF KP  E N   G   F++   L      +++D+I ++  ++ 
Sbjct:  381 FQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGS----SRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQTVLE-NGTYIKDDTIFIKVIVDT 537          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 75.8702 bits (185), Expect = 3.799e-14
Identity = 48/162 (29.63%), Postives = 77/162 (47.53%), Query Frame = 2
Query:  758 YAILKTKPF----IWKINHFSEKQLEFEFDTDGSVFSEAFYTHDNGYKLCLGINPNGANQYLGKYLFTFFCIMKGPYDDNLPWPMKLEVVLSIVDQISLXXXXXXXXXXXXXXEMLQHSFSKPKFERNEGIGDNEFISFKELHLLNNILRNDSILLRCSINA 1231
            + +L+T  +    IWKI  +  ++ E       S++S+ FYT   GYK+C  +  NG     G +L  FF IM+G YD  LPWP K +V L ++DQ S           +   +    SF KP  E N   G   F++   L      +++D+I ++  ++ 
Sbjct:  323 FQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGS----SRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQTVLE-NGTYIKDDTIFIKVIVDT 479          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 75.8702 bits (185), Expect = 4.104e-14
Identity = 48/162 (29.63%), Postives = 77/162 (47.53%), Query Frame = 2
Query:  758 YAILKTKPF----IWKINHFSEKQLEFEFDTDGSVFSEAFYTHDNGYKLCLGINPNGANQYLGKYLFTFFCIMKGPYDDNLPWPMKLEVVLSIVDQISLXXXXXXXXXXXXXXEMLQHSFSKPKFERNEGIGDNEFISFKELHLLNNILRNDSILLRCSINA 1231
            + +L+T  +    IWKI  +  ++ E       S++S+ FYT   GYK+C  +  NG     G +L  FF IM+G YD  LPWP K +V L ++DQ S           +   +    SF KP  E N   G   F++   L      +++D+I ++  ++ 
Sbjct:  406 FQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGS----SRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQTVLE-NGTYIKDDTIFIKVIVDT 562          
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Match: trf-1 (TNF Receptor Associated Factor (TRAF) homolog; TRF-1 [Source:UniProtKB/TrEMBL;Acc:G5EG80])

HSP 1 Score: 65.4698 bits (158), Expect = 3.221e-11
Identity = 37/151 (24.50%), Postives = 70/151 (46.36%), Query Frame = 2
Query:  782 FIWKINHFSEKQLEFEFDTDGSVFSEAFYTHDNGYKLCLGINPNGANQYLGKYLFTFFCIMKGPYDDNLPWPMKLEVVLSIVDQISLXXXXXXXXXXXXXXEMLQHS--FSKPKFERNEGIGDNEFISFKELHLLNNILRNDSILLRCSIN 1228
             IWKI+   ++  E +   D ++FS  F +H  GYK+       G     GK +  +  ++KG +D  L WP    + +S++DQ    + +          ++  +    ++P+ ERN   G   F S   L +L N +++D I ++  ++
Sbjct:  265 LIWKIDKLQQRTNEAKSGADTTIFSVPFMSHRFGYKMMACACLFGDGSSAGKSISLYVLLLKGEFDPTLEWPFHRAIKISLLDQNPRPEDRVNITYVIDPRKLKANEKFLARPRGERNAAFGSQSFCS---LAILQNYVKDDKIYVQIDVD 412          
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Match: trf-2 (TNF Receptor Associated Factor (TRAF) homolog [Source:UniProtKB/TrEMBL;Acc:Q9N586])

HSP 1 Score: 57.7658 bits (138), Expect = 6.109e-9
Identity = 24/61 (39.34%), Postives = 35/61 (57.38%), Query Frame = 2
Query:  845 SVFSEAFYTHDNGYKLCLGINPNGANQYLGKYLFTFFCIMKGPYDDNLPWPMKLEVVLSIV 1027
            S++S+ FY+H  GYK+     P G      +Y   F C+MKG +DD L WP + +V  SI+
Sbjct:  182 SIYSQPFYSHGYGYKMMAVAAPYGDGLAFREYFSVFVCLMKGEWDDILEWPFRCDVTFSIL 242          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf4 (gene:FBgn0026319 transcript:FBtr0334401)

HSP 1 Score: 54.299 bits (129), Expect = 1.541e-7
Identity = 38/153 (24.84%), Postives = 64/153 (41.83%), Query Frame = 2
Query:  773 TKPFIWKINHFSEKQLEFEFDTDGSVFSEAFYTHDNGYKLCLGINPNGANQYLGKYLFTFFCIMKGPYDDNLPWPMKLEVVLSIVDQISLXXXXXXXXXXXXXXEMLQHSFSKPKFERNE-GIGDNEFISFKELHLLNNILRNDSILLRCSIN 1228
            T   +WKI  +S K  E        + S  FYT   GYKL   +  NG       ++  +  ++ G YD  L WP    +  ++ +Q +           S   +    +F +P  E ++ G G   FIS + LH     ++ D++ LR  ++
Sbjct:  321 TGTLLWKITDWSAKMAEARGKDGLELVSPPFYTSQYGYKLQASMFLNGNGPGENTHVSVYIKVLPGEYDALLKWPFSHSITFTLFEQGA--QSGQGGVAESFVPDPTWENFQRPSNEPDQLGFGFPRFISHELLH-SRPFIKGDTVFLRVKVD 470          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf4 (gene:FBgn0026319 transcript:FBtr0077429)

HSP 1 Score: 53.9138 bits (128), Expect = 1.844e-7
Identity = 38/153 (24.84%), Postives = 64/153 (41.83%), Query Frame = 2
Query:  773 TKPFIWKINHFSEKQLEFEFDTDGSVFSEAFYTHDNGYKLCLGINPNGANQYLGKYLFTFFCIMKGPYDDNLPWPMKLEVVLSIVDQISLXXXXXXXXXXXXXXEMLQHSFSKPKFERNE-GIGDNEFISFKELHLLNNILRNDSILLRCSIN 1228
            T   +WKI  +S K  E        + S  FYT   GYKL   +  NG       ++  +  ++ G YD  L WP    +  ++ +Q +           S   +    +F +P  E ++ G G   FIS + LH     ++ D++ LR  ++
Sbjct:  330 TGTLLWKITDWSAKMAEARGKDGLELVSPPFYTSQYGYKLQASMFLNGNGPGENTHVSVYIKVLPGEYDALLKWPFSHSITFTLFEQGA--QSGQGGVAESFVPDPTWENFQRPSNEPDQLGFGFPRFISHELLH-SRPFIKGDTVFLRVKVD 479          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf-like (gene:FBgn0030748 transcript:FBtr0074275)

HSP 1 Score: 51.2174 bits (121), Expect = 1.472e-6
Identity = 36/155 (23.23%), Postives = 70/155 (45.16%), Query Frame = 2
Query:  569 EFLKTNLKSRDQELVNMRRLISENQESIQTLEEAVNCLLEENETLKRLIXXXXXXXXXXXXXXYAILKTKPFIWKINHFSEKQLEFEFDTDGSVFSEAFYTHDNGYKLCLGINPNGANQYLGKYLFTFFCIMKGPYDDNLPWPMKLEVVLSIVDQ 1033
            +++ +   + D E+ N++ ++ E +E    L+ A++  ++    L+  +      +++     +        IW+I  +S K+LE     D  + S  F     GY L L I  NG   + G+ +     ++ G YD  L WP +L+  + I DQ
Sbjct:  272 DYVTSKQATLDYEVKNVKNIVCETEERCDKLDRALHQTMQNISDLETQMAMQQRIASVQNIRGH-------LIWRIKDYS-KKLEESKQYDTILHSAMFSNKAFGYALRLDIYLNGKGTWKGRNMIACLNVLSGEYDPLLAWPCRLQAEIIIRDQ 418          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf-like (gene:FBgn0030748 transcript:FBtr0074273)

HSP 1 Score: 50.8322 bits (120), Expect = 1.684e-6
Identity = 36/155 (23.23%), Postives = 70/155 (45.16%), Query Frame = 2
Query:  569 EFLKTNLKSRDQELVNMRRLISENQESIQTLEEAVNCLLEENETLKRLIXXXXXXXXXXXXXXYAILKTKPFIWKINHFSEKQLEFEFDTDGSVFSEAFYTHDNGYKLCLGINPNGANQYLGKYLFTFFCIMKGPYDDNLPWPMKLEVVLSIVDQ 1033
            +++ +   + D E+ N++ ++ E +E    L+ A++  ++    L+  +      +++     +        IW+I  +S K+LE     D  + S  F     GY L L I  NG   + G+ +     ++ G YD  L WP +L+  + I DQ
Sbjct:  250 DYVTSKQATLDYEVKNVKNIVCETEERCDKLDRALHQTMQNISDLETQMAMQQRIASVQNIRGH-------LIWRIKDYS-KKLEESKQYDTILHSAMFSNKAFGYALRLDIYLNGKGTWKGRNMIACLNVLSGEYDPLLAWPCRLQAEIIIRDQ 396          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf-like (gene:FBgn0030748 transcript:FBtr0308606)

HSP 1 Score: 50.447 bits (119), Expect = 2.140e-6
Identity = 28/84 (33.33%), Postives = 40/84 (47.62%), Query Frame = 2
Query:  782 FIWKINHFSEKQLEFEFDTDGSVFSEAFYTHDNGYKLCLGINPNGANQYLGKYLFTFFCIMKGPYDDNLPWPMKLEVVLSIVDQ 1033
             IW+I  +S K+LE     D  + S  F     GY L L I  NG   + G+ +     ++ G YD  L WP +L+  + I DQ
Sbjct:  257 LIWRIKDYS-KKLEESKQYDTILHSAMFSNKAFGYALRLDIYLNGKGTWKGRNMIACLNVLSGEYDPLLAWPCRLQAEIIIRDQ 339          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf2b (Tnf receptor-associated factor 2b [Source:ZFIN;Acc:ZDB-GENE-030131-5345])

HSP 1 Score: 82.0333 bits (201), Expect = 2.946e-16
Identity = 70/258 (27.13%), Postives = 114/258 (44.19%), Query Frame = 2
Query:  467 KCVYSLENITGII-ENLQKYAFRSMEIEEQHKTDFEFLKTNLKSRDQELVNMRRLISEN---QESIQTLEEAVNCLLEENETLKRLIXXXXXXXXXXXXXXYAILKTKPFIWKINHFSEKQLEFEFDTDGSVFSEAFYTHDNGYKLCLGINPNGANQYLGKYLFTFFCIMKGPYDDNLPWPMKLEVVLSIVDQISLXXXXXXXXXXXXXXEMLQHSFSKPKFERNEGIGDNEFISFKELHLLNNILRNDSILLRCSIN 1228
            K V +LENI  ++ + +++ A     I  QH+ D E ++ NL ++ ++L   R L + +    ES Q+L E   C  +                               FIWKI  FS ++ +       ++FS AFY+   GYK+CL +  NG     G +L  FF +MKG YD  L WP   +V L ++DQ             +   ++   SF +P  E N   G   F    +L   ++ LR+D+I ++  ++
Sbjct:  308 KKVTTLENIVCVLNKEVERSALTMEAISRQHRLDQEKIE-NLSNKVRQL--ERTLTTRDLQLAESEQSLRELQFCTYD-----------------------------GVFIWKIAEFSRRRQDAVAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMKGKYDALLKWPFSQKVTLMLLDQ-----NNREHIIDAFRPDVSSTSFQRPISEMNIASGCPLFCPLAKLAGKSSYLRDDTIFIKAIVD 528          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf2b (Tnf receptor-associated factor 2b [Source:ZFIN;Acc:ZDB-GENE-030131-5345])

HSP 1 Score: 82.0333 bits (201), Expect = 2.946e-16
Identity = 70/258 (27.13%), Postives = 114/258 (44.19%), Query Frame = 2
Query:  467 KCVYSLENITGII-ENLQKYAFRSMEIEEQHKTDFEFLKTNLKSRDQELVNMRRLISEN---QESIQTLEEAVNCLLEENETLKRLIXXXXXXXXXXXXXXYAILKTKPFIWKINHFSEKQLEFEFDTDGSVFSEAFYTHDNGYKLCLGINPNGANQYLGKYLFTFFCIMKGPYDDNLPWPMKLEVVLSIVDQISLXXXXXXXXXXXXXXEMLQHSFSKPKFERNEGIGDNEFISFKELHLLNNILRNDSILLRCSIN 1228
            K V +LENI  ++ + +++ A     I  QH+ D E ++ NL ++ ++L   R L + +    ES Q+L E   C  +                               FIWKI  FS ++ +       ++FS AFY+   GYK+CL +  NG     G +L  FF +MKG YD  L WP   +V L ++DQ             +   ++   SF +P  E N   G   F    +L   ++ LR+D+I ++  ++
Sbjct:  308 KKVTTLENIVCVLNKEVERSALTMEAISRQHRLDQEKIE-NLSNKVRQL--ERTLTTRDLQLAESEQSLRELQFCTYD-----------------------------GVFIWKIAEFSRRRQDAVAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMKGKYDALLKWPFSQKVTLMLLDQ-----NNREHIIDAFRPDVSSTSFQRPISEMNIASGCPLFCPLAKLAGKSSYLRDDTIFIKAIVD 528          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: unm_sa808 (un-named sa808 [Source:ZFIN;Acc:ZDB-GENE-120727-21])

HSP 1 Score: 79.337 bits (194), Expect = 3.725e-16
Identity = 46/149 (30.87%), Postives = 74/149 (49.66%), Query Frame = 2
Query:  782 FIWKINHFSEKQLEFEFDTDGSVFSEAFYTHDNGYKLCLGINPNGANQYLGKYLFTFFCIMKGPYDDNLPWPMKLEVVLSIVDQISLXXXXXXXXXXXXXXEMLQHSFSKPKFERNEGIGDNEFISFKELHLLNNILRNDSILLRCSIN 1228
            FIW+I+ F++K+ +       ++FS AFYT   GYK+CL I  NG     G +L  FF +M+G  D  L WP   +V L ++DQ             +   ++   SF +P  E N   G   F    +L   N+ +R+D+I ++  ++
Sbjct:  134 FIWRISDFTKKRQDAIAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGMSDALLKWPFNQKVTLMLLDQ-----SNREHIIDAFRPDITSSSFQRPVSEMNIASGCPLFCPLAKLEGKNSYIRDDTIFIKAIVD 277          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf2b (Tnf receptor-associated factor 2b [Source:ZFIN;Acc:ZDB-GENE-030131-5345])

HSP 1 Score: 81.6481 bits (200), Expect = 3.895e-16
Identity = 70/258 (27.13%), Postives = 114/258 (44.19%), Query Frame = 2
Query:  467 KCVYSLENITGII-ENLQKYAFRSMEIEEQHKTDFEFLKTNLKSRDQELVNMRRLISEN---QESIQTLEEAVNCLLEENETLKRLIXXXXXXXXXXXXXXYAILKTKPFIWKINHFSEKQLEFEFDTDGSVFSEAFYTHDNGYKLCLGINPNGANQYLGKYLFTFFCIMKGPYDDNLPWPMKLEVVLSIVDQISLXXXXXXXXXXXXXXEMLQHSFSKPKFERNEGIGDNEFISFKELHLLNNILRNDSILLRCSIN 1228
            K V +LENI  ++ + +++ A     I  QH+ D E ++ NL ++ ++L   R L + +    ES Q+L E   C  +                               FIWKI  FS ++ +       ++FS AFY+   GYK+CL +  NG     G +L  FF +MKG YD  L WP   +V L ++DQ             +   ++   SF +P  E N   G   F    +L   ++ LR+D+I ++  ++
Sbjct:  321 KKVTTLENIVCVLNKEVERSALTMEAISRQHRLDQEKIE-NLSNKVRQL--ERTLTTRDLQLAESEQSLRELQFCTYD-----------------------------GVFIWKIAEFSRRRQDAVAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMKGKYDALLKWPFSQKVTLMLLDQ-----NNREHIIDAFRPDVSSTSFQRPISEMNIASGCPLFCPLAKLAGKSSYLRDDTIFIKAIVD 541          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: BX901915.1 (pep chromosome:GRCz11:CHR_ALT_CTG5_1_18:28764891:28768979:-1 gene:ENSDARG00000109857.1 transcript:ENSDART00000191629.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX901915.1)

HSP 1 Score: 78.5666 bits (192), Expect = 6.760e-16
Identity = 46/149 (30.87%), Postives = 74/149 (49.66%), Query Frame = 2
Query:  782 FIWKINHFSEKQLEFEFDTDGSVFSEAFYTHDNGYKLCLGINPNGANQYLGKYLFTFFCIMKGPYDDNLPWPMKLEVVLSIVDQISLXXXXXXXXXXXXXXEMLQHSFSKPKFERNEGIGDNEFISFKELHLLNNILRNDSILLRCSIN 1228
            F+WKI+ FS+K+ +       ++FS AFYT   GYK+CL I  NG     G +L  FF +M+G  D  L WP   +V L ++DQ             +   ++   SF +P  + N   G   F    +L   N+ +R+D+I ++  ++
Sbjct:  128 FVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQ-----NNREHIIDAFRPDISSSSFQRPVSDMNIASGCPLFCPLSKLDSKNSYIRDDTIFIKAIVD 271          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: egf (epidermal growth factor [Source:Xenbase;Acc:XB-GENE-951823])

HSP 1 Score: 82.4185 bits (202), Expect = 2.994e-16
Identity = 50/154 (32.47%), Postives = 80/154 (51.95%), Query Frame = 2
Query:  782 FIWKINHFSEKQLEFEFDTDGSVFSEAFYTHDNGYKLCLGINPN-GANQYLGKYLFTFFCIMKGPYDDNLPWPMKLEVVLSIVDQISLXXXXXXXXXXXXXXEMLQHSFSKPKFERN-EGIGDNEFISFKELHLL--NNILRNDSILLRCSINA 1231
            FIW+IN+F+      E +    + S+ FYT   GYKLCL ++    + Q    Y+  F   M+G YD  LPWP++  + LSI+DQ      +  +       E+L  +F +P   RN +G G   +++F  L  L     ++ND++L+RCS+  
Sbjct:  389 FIWRINNFNSLLKNQEEERPVVIHSQGFYTGKPGYKLCLRLHLQLPSAQRCANYISLFVHTMQGEYDSLLPWPLQGTIRLSILDQSEGVAMQDQEEVMDTKPELL--AFQRPTVARNPKGFG---YVTFMHLQALKQRQYVKNDTLLVRCSVTT 537          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: sytl2 (synaptotagmin like 2 [Source:Xenbase;Acc:XB-GENE-945155])

HSP 1 Score: 79.337 bits (194), Expect = 2.632e-15
Identity = 50/157 (31.85%), Postives = 73/157 (46.50%), Query Frame = 2
Query:  782 FIWKINHFSEKQLEFEFDTDGSVFSEAFYTHDNGYKLCLGINPNGANQYLGKYLFTFFCIMKGPYDDNLPWPMKLEVVLSIVDQISLXXXXXXXXXXXXXXEMLQHSFSKPKFERNE------GIGDNEFISFKELHLLNNILRNDSILLRCSINAP 1234
             IWKI+ +S K  E +   +   FS  FYTH  GYKL +    NG     G YL  +  ++ G YD+ L WP    V  S++DQ      K      +   +    +F KP   RN       G G  +FIS +++    N +R+++I LR S+  P
Sbjct:  310 LIWKISDYSRKVQEAKVRGNFESFSPPFYTHKYGYKLQVSAFLNGNGSGEGSYLSVYIRVLPGEYDNLLEWPFSYRVTFSLLDQSDPSLSKPQHITETFNPDPNWKNFQKPTGSRNSLDESTLGFGYPKFISHEDIR-KRNYVRDNAIFLRASVEIP 465          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: hspb6 (heat shock protein family B (small) member 6 [Source:Xenbase;Acc:XB-GENE-876273])

HSP 1 Score: 73.9442 bits (180), Expect = 8.528e-14
Identity = 46/151 (30.46%), Postives = 72/151 (47.68%), Query Frame = 2
Query:  782 FIWKINHFSEKQLEFEFDTDGSVFSEAFYTHDNGYKLCLGINPNGANQYLGKYLFTFFCIMKGPYDDNLPWPMKLEVVLSIVDQISLXXXXXXXXXXXXXXEMLQHSFSKPKFERNEGIGDNEFISFKELHLLNNI-LRNDSILLRCSINA 1231
            F+WKI+  + K  +       S++S AFYT   GYK+CL I  NG     G ++  FF +MKG YD  LPWP K +V   +VD              +   ++   SF +P  + N   G   F    +L+   +  +R +++ +RC I+ 
Sbjct:  232 FLWKISDLTNKSHDAVTGRAISLYSPAFYTAKYGYKVCLRIYLNGDGAGKGTHVSLFFTVMKGEYDALLPWPFKHKVTFVLVDH-----NNRDSVFDAFRPDVTSASFQRPINDMNVASGCPLFCPIAKLNSPKHAYIRENTLYIRCIIDT 377          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: ssh2 (slingshot protein phosphatase 2 [Source:Xenbase;Acc:XB-GENE-993093])

HSP 1 Score: 73.9442 bits (180), Expect = 1.850e-13
Identity = 47/162 (29.01%), Postives = 76/162 (46.91%), Query Frame = 2
Query:  758 YAILKTKPF----IWKINHFSEKQLEFEFDTDGSVFSEAFYTHDNGYKLCLGINPNGANQYLGKYLFTFFCIMKGPYDDNLPWPMKLEVVLSIVDQISLXXXXXXXXXXXXXXEMLQHSFSKPKFERNEGIGDNEFISFKELHLLNNILRNDSILLRCSINA 1231
            + +L+T  +    IWKI  +  ++ E       S++S+ FYT   GYK+C  +  NG     G +L  FF IM+G YD  LPWP K +V L ++DQ             +   +    SF KP  E N   G   F++   L      +++D+I ++  ++ 
Sbjct:  399 FQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVSLMLMDQ----GPSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQTVLE-NGTYIKDDTIFIKVIVDT 555          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: ssh2 (slingshot protein phosphatase 2 [Source:Xenbase;Acc:XB-GENE-993093])

HSP 1 Score: 73.559 bits (179), Expect = 1.970e-13
Identity = 47/162 (29.01%), Postives = 76/162 (46.91%), Query Frame = 2
Query:  758 YAILKTKPF----IWKINHFSEKQLEFEFDTDGSVFSEAFYTHDNGYKLCLGINPNGANQYLGKYLFTFFCIMKGPYDDNLPWPMKLEVVLSIVDQISLXXXXXXXXXXXXXXEMLQHSFSKPKFERNEGIGDNEFISFKELHLLNNILRNDSILLRCSINA 1231
            + +L+T  +    IWKI  +  ++ E       S++S+ FYT   GYK+C  +  NG     G +L  FF IM+G YD  LPWP K +V L ++DQ             +   +    SF KP  E N   G   F++   L      +++D+I ++  ++ 
Sbjct:  374 FQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVSLMLMDQ----GPSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQTVLE-NGTYIKDDTIFIKVIVDT 530          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf2 (TNF receptor-associated factor 2 [Source:MGI Symbol;Acc:MGI:101835])

HSP 1 Score: 84.3445 bits (207), Expect = 4.533e-17
Identity = 46/149 (30.87%), Postives = 73/149 (48.99%), Query Frame = 2
Query:  782 FIWKINHFSEKQLEFEFDTDGSVFSEAFYTHDNGYKLCLGINPNGANQYLGKYLFTFFCIMKGPYDDNLPWPMKLEVVLSIVDQISLXXXXXXXXXXXXXXEMLQHSFSKPKFERNEGIGDNEFISFKELHLLNNILRNDSILLRCSIN 1228
            FIWKI+ F+ K+ E       ++FS AFYT   GYK+CL +  NG     G +L  FF +MKGP D  L WP   +V L ++D              +   ++   SF +P  + N   G   F    ++   N+ +R+D+I ++  ++
Sbjct:  361 FIWKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLQWPFNQKVTLMLLDH-----NNREHVIDAFRPDVTSSSFQRPVSDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVD 504          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf2 (TNF receptor-associated factor 2 [Source:MGI Symbol;Acc:MGI:101835])

HSP 1 Score: 84.3445 bits (207), Expect = 4.770e-17
Identity = 46/149 (30.87%), Postives = 73/149 (48.99%), Query Frame = 2
Query:  782 FIWKINHFSEKQLEFEFDTDGSVFSEAFYTHDNGYKLCLGINPNGANQYLGKYLFTFFCIMKGPYDDNLPWPMKLEVVLSIVDQISLXXXXXXXXXXXXXXEMLQHSFSKPKFERNEGIGDNEFISFKELHLLNNILRNDSILLRCSIN 1228
            FIWKI+ F+ K+ E       ++FS AFYT   GYK+CL +  NG     G +L  FF +MKGP D  L WP   +V L ++D              +   ++   SF +P  + N   G   F    ++   N+ +R+D+I ++  ++
Sbjct:  354 FIWKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLQWPFNQKVTLMLLDH-----NNREHVIDAFRPDVTSSSFQRPVSDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVD 497          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 75.8702 bits (185), Expect = 2.993e-14
Identity = 48/162 (29.63%), Postives = 77/162 (47.53%), Query Frame = 2
Query:  758 YAILKTKPF----IWKINHFSEKQLEFEFDTDGSVFSEAFYTHDNGYKLCLGINPNGANQYLGKYLFTFFCIMKGPYDDNLPWPMKLEVVLSIVDQISLXXXXXXXXXXXXXXEMLQHSFSKPKFERNEGIGDNEFISFKELHLLNNILRNDSILLRCSINA 1231
            + +L+T  +    IWKI  +  ++ E       S++S+ FYT   GYK+C  +  NG     G +L  FF IM+G YD  LPWP K +V L ++DQ S           +   +    SF KP  E N   G   F++   L      +++D+I ++  ++ 
Sbjct:  405 FQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGS----SRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQTVLE-NGTYIKDDTIFIKVIVDT 561          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 75.8702 bits (185), Expect = 2.994e-14
Identity = 48/162 (29.63%), Postives = 77/162 (47.53%), Query Frame = 2
Query:  758 YAILKTKPF----IWKINHFSEKQLEFEFDTDGSVFSEAFYTHDNGYKLCLGINPNGANQYLGKYLFTFFCIMKGPYDDNLPWPMKLEVVLSIVDQISLXXXXXXXXXXXXXXEMLQHSFSKPKFERNEGIGDNEFISFKELHLLNNILRNDSILLRCSINA 1231
            + +L+T  +    IWKI  +  ++ E       S++S+ FYT   GYK+C  +  NG     G +L  FF IM+G YD  LPWP K +V L ++DQ S           +   +    SF KP  E N   G   F++   L      +++D+I ++  ++ 
Sbjct:  380 FQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGS----SRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQTVLE-NGTYIKDDTIFIKVIVDT 536          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 75.8702 bits (185), Expect = 2.994e-14
Identity = 48/162 (29.63%), Postives = 77/162 (47.53%), Query Frame = 2
Query:  758 YAILKTKPF----IWKINHFSEKQLEFEFDTDGSVFSEAFYTHDNGYKLCLGINPNGANQYLGKYLFTFFCIMKGPYDDNLPWPMKLEVVLSIVDQISLXXXXXXXXXXXXXXEMLQHSFSKPKFERNEGIGDNEFISFKELHLLNNILRNDSILLRCSINA 1231
            + +L+T  +    IWKI  +  ++ E       S++S+ FYT   GYK+C  +  NG     G +L  FF IM+G YD  LPWP K +V L ++DQ S           +   +    SF KP  E N   G   F++   L      +++D+I ++  ++ 
Sbjct:  380 FQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGS----SRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQTVLE-NGTYIKDDTIFIKVIVDT 536          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q12933|TRAF2_HUMAN (TNF receptor-associated factor 2 OS=Homo sapiens OX=9606 GN=TRAF2 PE=1 SV=2)

HSP 1 Score: 87.0409 bits (214), Expect = 4.750e-17
Identity = 71/263 (27.00%), Postives = 115/263 (43.73%), Query Frame = 2
Query:  443 LNICEKKDKCVYSLENITGII-ENLQKYAFRSMEIEEQHKTDFEFLKTNLKSRDQELVNMRRLISENQESIQTLEEAVNCLLEENETLKRLIXXXXXXXXXXXXXXYAILKTKPFIWKINHFSEKQLEFEFDTDGSVFSEAFYTHDNGYKLCLGINPNGANQYLGKYLFTFFCIMKGPYDDNLPWPMKLEVVLSIVDQISLXXXXXXXXXXXXXXEMLQHSFSKPKFERNEGIGDNEFISFKELHLLNNILRNDSILLRCSIN 1228
            L  CE  +K   + ENI  ++   +++ A  +     QH+ D + ++  L S+ Q+L    R I     ++  LE+ V  L  E  T   +                       FIWKI+ F+ K+ E       ++FS AFYT   GYK+CL I  NG     G +L  FF +MKGP D  L WP   +V L ++DQ             +   ++   SF +P  + N   G   F    ++   N+ +R+D+I ++  ++
Sbjct:  269 LQRCESLEKKTATFENIVCVLNREVERVAMTAEACSRQHRLDQDKIEA-LSSKVQQL---ERSIGLKDLAMADLEQKV--LEMEASTYDGV-----------------------FIWKISDFARKRQEAVAGRIPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLFFVVMKGPNDALLRWPFNQKVTLMLLDQ-----NNREHVIDAFRPDVTSSSFQRPVNDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVD 497          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q3MV19|TRF6A_XENLA (TNF receptor-associated factor 6-A OS=Xenopus laevis OX=8355 GN=traf6-a PE=1 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 1.380e-16
Identity = 52/153 (33.99%), Postives = 80/153 (52.29%), Query Frame = 2
Query:  782 FIWKINHFSEKQLEFEFDTDGSVFSEAFYTHDNGYKLCLGINPN-GANQYLGKYLFTFFCIMKGPYDDNLPWPMKLEVVLSIVDQISLXXXXXXXXXXXXXXEMLQHSFSKPKFERN-EGIGDNEFISFKELHLL--NNILRNDSILLRCSIN 1228
            FIW+I  FS  Q   E +    + S  FYT D GYKLCL ++    + Q    Y+  F   M+G YD  LPWP++  + LSI+DQ      +          ++L  +F +P   RN +G G   +++F  L+ L     ++ND++L+RCS+N
Sbjct:  387 FIWRIKGFSGLQKSQEEEKPVVIHSPGFYTGDPGYKLCLRLHLQLPSAQRCANYISLFVHTMQGDYDSLLPWPLQGTIRLSILDQSESTARQDQVEVMDTKPDLL--AFQRPTAPRNPKGFG---YVTFMHLNTLKQRQYVKNDTLLVRCSVN 534          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|P39429|TRAF2_MOUSE (TNF receptor-associated factor 2 OS=Mus musculus OX=10090 GN=Traf2 PE=1 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 3.336e-16
Identity = 46/149 (30.87%), Postives = 73/149 (48.99%), Query Frame = 2
Query:  782 FIWKINHFSEKQLEFEFDTDGSVFSEAFYTHDNGYKLCLGINPNGANQYLGKYLFTFFCIMKGPYDDNLPWPMKLEVVLSIVDQISLXXXXXXXXXXXXXXEMLQHSFSKPKFERNEGIGDNEFISFKELHLLNNILRNDSILLRCSIN 1228
            FIWKI+ F+ K+ E       ++FS AFYT   GYK+CL +  NG     G +L  FF +MKGP D  L WP   +V L ++D              +   ++   SF +P  + N   G   F    ++   N+ +R+D+I ++  ++
Sbjct:  354 FIWKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLQWPFNQKVTLMLLDH-----NNREHVIDAFRPDVTSSSFQRPVSDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVD 497          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q28DL4|TRAF6_XENTR (TNF receptor-associated factor 6 OS=Xenopus tropicalis OX=8364 GN=traf6 PE=2 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 1.503e-15
Identity = 50/154 (32.47%), Postives = 80/154 (51.95%), Query Frame = 2
Query:  782 FIWKINHFSEKQLEFEFDTDGSVFSEAFYTHDNGYKLCLGINPN-GANQYLGKYLFTFFCIMKGPYDDNLPWPMKLEVVLSIVDQISLXXXXXXXXXXXXXXEMLQHSFSKPKFERN-EGIGDNEFISFKELHLL--NNILRNDSILLRCSINA 1231
            FIW+IN+F+      E +    + S+ FYT   GYKLCL ++    + Q    Y+  F   M+G YD  LPWP++  + LSI+DQ      +  +       E+L  +F +P   RN +G G   +++F  L  L     ++ND++L+RCS+  
Sbjct:  389 FIWRINNFNSLLKNQEEERPVVIHSQGFYTGKPGYKLCLRLHLQLPSAQRCANYISLFVHTMQGEYDSLLPWPLQGTIRLSILDQSEGVAMQDQEEVMDTKPELL--AFQRPTVARNPKGFG---YVTFMHLQALKQRQYVKNDTLLVRCSVTT 537          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q6DJN2|TRF6B_XENLA (TNF receptor-associated factor 6-B OS=Xenopus laevis OX=8355 GN=traf6-b PE=2 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 6.901e-15
Identity = 50/153 (32.68%), Postives = 79/153 (51.63%), Query Frame = 2
Query:  782 FIWKINHFSEKQLEFEFDTDGSVFSEAFYTHDNGYKLCLGINPN-GANQYLGKYLFTFFCIMKGPYDDNLPWPMKLEVVLSIVDQISLXXXXXXXXXXXXXXEMLQHSFSKPKFERN-EGIGDNEFISFKELHLL--NNILRNDSILLRCSIN 1228
            FIWKI  FS  Q   E +    + S  FYT   GYKLCL ++    + Q    Y+  F   M+G YD  LPWP+   + LSI+DQ      +  +       ++L  +F +P  +RN +G G   +++F  L+ L     ++ND++ +RC++N
Sbjct:  387 FIWKIKGFSGLQKTQEEEKPVVIHSPGFYTGKPGYKLCLRLHLQLPSAQRCANYISLFVHTMQGEYDSLLPWPLHGTIRLSILDQSEGAIIQDQEEVMDTKPDLL--AFQRPTTQRNPKGFG---YVTFMHLNTLKQRQYVKNDTLFVRCAVN 534          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: A0A2D4HS59 (TNF receptor-associated factor OS=Micrurus lemniscatus lemniscatus OX=129467 PE=3 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 2.132e-20
Identity = 90/366 (24.59%), Postives = 167/366 (45.63%), Query Frame = 2
Query:  176 LLCTCCRKLIIDPRKASCGCRFCENCSQKPSKTDNK------CPNFHLASKLHSNIVTFNFQVDLETSLKVAHLEVFCPNNECQFICKLRFLADHLNICEKKDKCVYSLENITGIIE----NLQKYAFRSM--EIEEQHKTDFEFLKTNLKSRDQELVNMRRLISENQESIQTLEEAVNCLLEENETLKRLIXXXXXXXXXXXXXXYA---ILKTKPFIWKINHFSEKQLEFEFDTDGSVFSEAFYTHDNGYKLCLGINPNGANQYLGKYLFTFFCIMKGPYDDNLPWPMKLEVVLSIVDQISLXXXXXXXXXXXXXXEMLQHSFSKPKFERNEGIGDNEFISFKELHLLNNILRNDSILLRCSIN 1228
            LLC  C  L+++P++A CG R+C  C +   +   +      C N     + HS+    N  +D +         + CPN +C++   L+   +HL  C   +  + + +N T I E    N +K A  S+   I      + E +   +++ +  + ++RR +++   +++TL+   +C  +  E LK    + N+      +   A          IWK+ +FS+   + +     S+FS AF TH  GY+L + + P+G     G +L  F  + KGPYDD LPWP + +V  S++D       +      +   +    SF +P  + N   G   F +  E   + N L++D++ L+ +++
Sbjct:    9 LLCQACGFLLVNPQQAECGHRYCRRCVKGLFRDSERIVSCLTCKNVLHLKEFHSDKAAENDALDTQ---------IACPNFDCRWTGTLKSYQEHL--CHP-EVPIGTTKNATLIPEDQNENKEKEAHWSVTAPIMGGPSLNIEAVHLRMEALELMVASLRRQLNQQVSNVKTLQ---HCCSQYEELLKISQETQNSPHGTKGSGPSAQELASTDGTLIWKVENFSKLLKDAKSGKRHSIFSLAFATHPFGYRLYVRLYPDGDGVGKGSHLSVFLALAKGPYDDILPWPFRQKVTFSLLDPT----RRKSPLTETFLPDPHSTSFQQPHQKLNVASGSPLFANHVE---IPNYLKDDTLFLKIAVD 352          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: A0A402FGI5 (TNF receptor-associated factor OS=Paroedura picta OX=143630 GN=parPi_0017878 PE=3 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 1.139e-19
Identity = 74/298 (24.83%), Postives = 128/298 (42.95%), Query Frame = 2
Query:  152 PIQPIDNV-LLCTCCRKLIIDPRKASCGCRFCENCSQKPSKTDNKCPNFHLASKLHSNIVTFNFQVDLETSLKVAHLEVFCPNNECQFICKLRFLADHLNICEK----KDKCVYSLENITGIIENLQKYAFRSMEIEEQHKTDFEFLKTNLKSRDQELVNMRRLISENQESIQTLEEAVNCLLEENETLKRLIXXXXXXXXXXXXXXYAILKTKPFIWKINHFSEKQLEFEFDTDGSVFSEAFYTHDNGYKLCLGINPNGANQYLGKYLFTFFCIMKGPYDDNLPWPMKLEVVLSIVD 1030
            P+ P+ N  LLC  C  L+I P++A CG R+C  C ++  +  +K     L       +    F  D          EV CPN  C +   L+   DH+   E       +   +L +   + E    +  ++   E       E +   ++S +  +V++RR ++     +++L+    C  +  + LK       +    +   S  I      +WK+ +FS+   +       SV+S  F TH  GY LC+ + P+G     G +L  F  + +GPYDD LPWP + +V   ++D
Sbjct:    2 PVDPVANAGLLCQACGFLLIAPQQAECGHRYCLGCVKRLFRDTDKV----LCHACRQELSPRQFHSDKAAENDALATEVACPNFGCAWSGTLKSYQDHVCPPEAPFGTAKESALALRDQEAVEEKGLTWTSKNSS-EGGSSLTTEAVVLRVESLELMVVSLRRQLNNQVAMVKSLQR---CCSQYEKLLKTTPEGHRSPKGSIPTSSELISTNGMLVWKVENFSKLLRDATSGKKRSVYSPVFATHPFGYHLCVRMYPDGDGIGKGSHLSLFLAVARGPYDDVLPWPFQQKVTFVLLD 291          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: T1DBK6 (TRAF-4 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 8.096e-19
Identity = 67/218 (30.73%), Postives = 110/218 (50.46%), Query Frame = 2
Query:  608 LVNMRRLISENQESIQTLEEAVNCLLEENETLKRLIXXXX----------XXXXXXXXXXYAILKTKPFIWKINHFSEKQLEFEFDTDGSVFSEAFYTHDNGYKLCLGINPNGANQYLGKYLFTFFCIMKGPYDDNLPWPMKLEVVLSIVDQISLXXXXXXXXXXXXXXEMLQHSFSKPKFERNEGIGDNEFISFKELHLLNNILRNDSILLRCSINA 1231
            +  +R+L  +N+     +EE +N L+EEN+ LK  +  +           +    +   +  I +   ++WKI  FS+ +       + ++ SEAFYT D GYK+C+ I P G     G +L  FF IMKG YDD LPWP K +V+++I D  S    K+     +   +     + +P+ E N   G  +FISF E   L N L+ D++ ++ ++ A
Sbjct:  242 VTELRKLEKQNKH----MEERMNILIEENQLLKATLEVMKLDLPKNSGSISRDTSLKRANKTIFRNGKYMWKIKSFSKLRENAMRGKNPTILSEAFYTSDFGYKMCMKIYPCGDGVGKGTHLSIFFVIMKGDYDDILPWPFKNKVIITIFDDFS----KSTNLSDTFKPDPKSICYQRPEEEYNIASGSPKFISFSE---LKNFLKKDTLYIQINVIA 448          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: A0A0R3TIB8 (Uncharacterized protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS6805 PE=4 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 1.956e-18
Identity = 48/141 (34.04%), Postives = 77/141 (54.61%), Query Frame = 2
Query:  782 FIWKINHFSEKQLEFEFDTDGSVFSEAFYTHDNGYKLCLGINPNGANQYLGKYLFTFFCIMKGPYDDNLPWPMKLEVVLSIVDQISLXXXXXXXXXXXXXXEMLQHS--FSKPKFERNEGIGDNEFISFKELHLLNNILRN 1198
            FIW+I+ + +K  E +     ++FS  FY+H NGY++CL I PNG  +  GKYL  F CI +G YD  L WP  L + L ++DQ    D +       + + +  ++    +P  ERN+  G   F+  ++LHL + ++ N
Sbjct:  145 FIWRIDGYGKKVEEAQQGRKATLFSSPFYSHRNGYRVCLSICPNGEQRVRGKYLSVFICICRGEYDALLSWPFSLPITLKLLDQNINPDLRQDHQVTIRPNPIPSNNAYLKRPSSERNQCFGSPRFLELEQLHLRDYVVDN 285          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: A0A2I0LIG5 (TNF receptor-associated factor 2 OS=Columba livia OX=8932 GN=TRAF2 PE=4 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 1.022e-17
Identity = 91/360 (25.28%), Postives = 149/360 (41.39%), Query Frame = 2
Query:  179 LCTCCRKLIIDPRKASCGCRFCENCSQKP-SKTDNKCPNFHLASKLHSNIVTFNFQVDLETS---------LKVAHLEVFCPNNECQFICKLRFLADHLNICEKKDKCVYSLENITGIIENLQKYAFRSMEIEEQHKTDFEFLKTNLKSRDQELVNMRRLISENQESIQTLEEAVNCLLEENETLKRLIXXXXXXXXXXXXXXYAILKTKPFIWKINHFSEKQLEFEFDTDGSVFSEAFYTHDNGYKLCLGINPNGANQYLGKYLFTFFCIMKGPYDDNLPWPMKLEVVLSIVDQISLXXXXXXXXXXXXXXEMLQHSFSKPKFERNEGIGDNEFISFKELHLLNNILRNDSILLRCSIN 1228
            LC+ C+ ++  P +A CG R+C  C +K  S    KC     AS +   I      + LETS          +V  L   C N+ C +   ++    H  +C +     + L    G  + + +    +     QH+ D E ++T L ++ ++L    R I     ++  +EE +  +  E  T   +                       FIWKI  F+ K+ E       ++FS AFYT   GYK+CL +  NG     G +L  FF +MKGP D  L WP   +V L ++DQ             +   ++   SF +P  E N   G   F     +   N+ +R+D+I ++  ++
Sbjct:   33 LCSDCKNILRRPFQAQCGHRYCSYCLKKIISAGPQKC-----ASCIQEGIYEEGISI-LETSSAFPDNAARREVESLPAVCINSGCTWKGTIKEYEAHDEVCPE-----FPL-TCEGCGKKVPREKVPTEAYSRQHRLDQEKIET-LSNKVRQL---ERSIGLKDLAMAEMEEKIRNM--EASTYDGV-----------------------FIWKITEFARKRQEAITGRSPAIFSPAFYTSKYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLRWPFNQKVTLMLLDQ-----NNREHIIDAFRPDVTSSSFQRPVTEMNIASGCPLFCPVSVMEAKNSYVRDDAIFIKAIVD 346          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf2a (TNF receptor-associated factor 2-like [Source:NCBI gene;Acc:103036375])

HSP 1 Score: 80.4925 bits (197), Expect = 6.696e-16
Identity = 46/149 (30.87%), Postives = 74/149 (49.66%), Query Frame = 2
Query:  782 FIWKINHFSEKQLEFEFDTDGSVFSEAFYTHDNGYKLCLGINPNGANQYLGKYLFTFFCIMKGPYDDNLPWPMKLEVVLSIVDQISLXXXXXXXXXXXXXXEMLQHSFSKPKFERNEGIGDNEFISFKELHLLNNILRNDSILLRCSIN 1228
            F+WKI+ FS+K+ +       ++FS AFYT   GYK+CL I  NG     G +L  FF +M+G  D  L WP   +V L ++DQ             +   ++   SF +P  + N   G   F    +L   N+ +R+D+I ++  ++
Sbjct:  312 FVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQ-----NNREHIIDAFRPDISSSSFQRPVSDMNIASGCPLFCPLSKLDSKNSYIRDDTIFIKAIVD 455          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:103028261])

HSP 1 Score: 80.4925 bits (197), Expect = 7.355e-16
Identity = 45/149 (30.20%), Postives = 74/149 (49.66%), Query Frame = 2
Query:  782 FIWKINHFSEKQLEFEFDTDGSVFSEAFYTHDNGYKLCLGINPNGANQYLGKYLFTFFCIMKGPYDDNLPWPMKLEVVLSIVDQISLXXXXXXXXXXXXXXEMLQHSFSKPKFERNEGIGDNEFISFKELHLLNNILRNDSILLRCSIN 1228
            F+WKI+ FS ++ +       ++FS AFY+   GYK+CL +  NG     G +L  FF +M+G YD  L WP   +V L ++DQ             +   ++   SF +P  E N   G   F    +L   ++ LR+D+I ++  ++
Sbjct:  384 FVWKISDFSRRRQDALAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMRGKYDALLKWPFSQKVTLMLLDQ-----NNREHIIDAFRPDISSTSFQRPISEMNIASGCPLFCPLAKLAGKSSYLRDDTIFIKAIVD 527          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf2a (TNF receptor-associated factor 2-like [Source:NCBI gene;Acc:103036375])

HSP 1 Score: 80.4925 bits (197), Expect = 8.494e-16
Identity = 46/149 (30.87%), Postives = 74/149 (49.66%), Query Frame = 2
Query:  782 FIWKINHFSEKQLEFEFDTDGSVFSEAFYTHDNGYKLCLGINPNGANQYLGKYLFTFFCIMKGPYDDNLPWPMKLEVVLSIVDQISLXXXXXXXXXXXXXXEMLQHSFSKPKFERNEGIGDNEFISFKELHLLNNILRNDSILLRCSIN 1228
            F+WKI+ FS+K+ +       ++FS AFYT   GYK+CL I  NG     G +L  FF +M+G  D  L WP   +V L ++DQ             +   ++   SF +P  + N   G   F    +L   N+ +R+D+I ++  ++
Sbjct:  425 FVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQ-----NNREHIIDAFRPDISSSSFQRPVSDMNIASGCPLFCPLSKLDSKNSYIRDDTIFIKAIVD 568          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf4a (TNF receptor associated factor 4 [Source:NCBI gene;Acc:103024022])

HSP 1 Score: 79.7221 bits (195), Expect = 1.093e-15
Identity = 51/157 (32.48%), Postives = 73/157 (46.50%), Query Frame = 2
Query:  782 FIWKINHFSEKQLEFEFDTDGSVFSEAFYTHDNGYKLCLGINPNGANQYLGKYLFTFFCIMKGPYDDNLPWPMKLEVVLSIVDQISLXXXXXXXXXXXXXXEMLQHSFSKPKFERNE------GIGDNEFISFKELHLLNNILRNDSILLRCSINAP 1234
             IWK+N +S K  E +   +   FS  FYTH  GYKL +    NG     G +L  +  ++ G YD+ L WP   +V  SI+DQ      K      +   +    +F KP   RN       G G  +FIS  E+    N +R+++I L+ SI  P
Sbjct:  310 LIWKLNDYSRKLQEAKLHNNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSIYIRVLPGEYDNLLEWPFAYKVTFSILDQSDPSLSKPQHITETFNPDPNWKNFQKPSSSRNSLDESTLGFGYPKFISHDEIR-KRNYIRDNAIFLKASIEIP 465          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: ENSAMXT00000035169.1 (pep primary_assembly:Astyanax_mexicanus-2.0:9:3354744:3362219:1 gene:ENSAMXG00000029095.1 transcript:ENSAMXT00000035169.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 68.9366 bits (167), Expect = 1.432e-13
Identity = 43/148 (29.05%), Postives = 71/148 (47.97%), Query Frame = 2
Query:  785 IWKINHFSEKQLEFEFDTDGSVFSEAFYTHDNGYKLCLGINPNGANQYLGKYLFTFFCIMKGPYDDNLPWPMKLEVVLSIVDQISLXXXXXXXXXXXXXXEMLQHSFSKPKFERNEGIGDNEFISFKELHLLNNILRNDSILLRCSIN 1228
            IWKI  +  ++ E       S++S+ FYT   GYK+C  +  NG     G +L  FF +M+G YD  LPWP K +V L ++DQ             +   +    SF +P  E N   G   F++   L      +++D+I ++ +++
Sbjct:    7 IWKIRDYKRRKAEAVASKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDALLPWPFKQKVTLMLMDQ----GPARKHLGDAFKPDPNSSSFRRPTGEMNIASGCPLFVAQTVLE-NGTYIKDDTIFIKVTVD 149          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002130.1 (pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 gene:ENSPMAG00000001936.1 transcript:ENSPMAT00000002130.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 78.9518 bits (193), Expect = 3.712e-16
Identity = 70/296 (23.65%), Postives = 130/296 (43.92%), Query Frame = 2
Query:  377 LEVFCPNNECQFICKLRFLADHLNICEKKDKCVYSLE----NITGIIENLQKYAFRSMEIEEQHKTDFEFLKTNLKS--RDQELVNMRRLISENQESIQTLEEAVN--CLLEENETLKRLIXXXXXXXXXXXXXXYAILKTKPF----IWKINHFSEKQLEFEFDTDGSVFSEAFYTHDNGYKLCLGINPNGANQYLGKYLFTFFCIMKGPYDDNLPWPMKLEVVLSIVDQISLXXXXXXXXXXXXXXEMLQHSFSKPKFERNEGIGDNEFISFKELHLLNNILRNDSILLRCSIN 1228
            LE+ C   +C        + DH N+ E   + V  LE    + + +  +       ++E+  QH    + L    ++  RD +   +RR ++  +E ++ LE A+      EE   +     ++++           +L+T  +    +WKI  ++ ++ E       S++S+ FYT   GYK+C     NG     G +L  FF +M+G YD  L WP +  V LS++DQ +           + T +    SF +P  + N   G   F+S   L   ++ L +D++ +R  ++
Sbjct:  130 LELQCARLQCS-------IEDHTNMSEMLTQRVAQLEQDLSHWSTLTGSNNTRLGSTLEMLTQHNEQLQSLHVAQRAPQRDADTAALRRDMATLRERLRALEAALGNPGPCEERCHMHEQRLTMHDGLLDTAERRLQVLETAGYSGKLVWKIRDYARRKQEAASGRTLSLYSQPFYTSPFGYKMCARAYLNGDGVGRGTHLSLFFVVMRGEYDALLEWPFRRRVTLSLLDQGA----ARRHLSDTFTPDPASGSFRRPDGDMNVASGCPLFVSHVALE-GSSYLVDDTVFVRVVVD 413          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000074.1 (pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-1 gene:ENSPMAG00000000066.1 transcript:ENSPMAT00000000074.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.559 bits (179), Expect = 2.158e-14
Identity = 42/161 (26.09%), Postives = 79/161 (49.07%), Query Frame = 2
Query:  758 YAILKTKPF----IWKINHFSEKQLEFEFDTDGSVFSEAFYTHDNGYKLCLGINPNGANQYLGKYLFTFFCIMKGPYDDNLPWPMKLEVVLSIVDQISLXXXXXXXXXXXXXXEMLQHSFSKPKFERNEGIGDNEFISFKELHLLNNILRNDSILLRCSIN 1228
            + +L+T  +    +WKI  ++ ++ +       S++S+ FYT   GY++C     NG     G +L  FF +M+G YD  LPWP +  V L+++DQ +       +   +   +    SF +P  + N   G   F+S   L    + L++D+I ++  ++
Sbjct:  315 FQVLETASYNGKLVWKIRDYARRKQDAVSGRTLSLYSQPFYTSPFGYRMCARAYLNGDGVGRGTHLSLFFVVMRGEYDALLPWPFRQRVTLTLLDQGA----ARRQLSDTFKPDPASSSFRRPTSDMNIASGCPLFVSHVALE-SASYLQDDTIFIKVVVD 470          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 67.781 bits (164), Expect = 1.979e-12
Identity = 51/177 (28.81%), Postives = 77/177 (43.50%), Query Frame = 2
Query:  782 FIWKINHFSE---KQLEFEFDTDG-------SVFSEAFYTHDNGYKLCLGIN-------PNGANQ----YLGK--YLFTFFCIMKGPYDDNLPWPMKLEVVLSIVDQISLXXXXXXXXXXXXXXEMLQ-----HSFSKPKFERN-EGIGDNEFISFKELHLLNNILRNDSILLRCSI 1225
            F W++  FS      L   F +DG        + S  FYT   GY+LCL +        P GA        G+  +L  F  +++G YD  LPWP K  + +S+VDQ                +EM+       +F +P   RN +G G   F+    LH   + LR+D +++RC +
Sbjct:  395 FTWRVERFSRLLPGGLASGFASDGMHPDAPAVMHSSGFYTGVPGYRLCLRLQVLSGREVPAGAASPSVLLAGRQPHLALFVHLLQGDYDHRLPWPFKGRIRISVVDQCE--------RDSVHVTEMMDADPQLSAFQRPSVHRNPKGFGYMNFMDINTLH-HRSYLRDDCLVVRCEV 562          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO35237 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM27])

HSP 1 Score: 82.8037 bits (203), Expect = 4.211e-17
Identity = 36/91 (39.56%), Postives = 52/91 (57.14%), Query Frame = 2
Query:  761 AILKTKPFIWKINHFSEKQLEFEFDTDGSVFSEAFYTHDNGYKLCLGINPNGANQYLGKYLFTFFCIMKGPYDDNLPWPMKLEVVLSIVDQ 1033
            AI     F+WKI+ F+E+  E +     S++S  FYTH  GYKLC  + PNG       YL  F  +M+G YD  LPWP +  + ++++DQ
Sbjct:  375 AISYDGTFLWKIDKFTERYAEAKSGNATSIYSSPFYTHRFGYKLCARLFPNGDGSARDNYLSIFIALMRGEYDSILPWPFQETITITLIDQ 465          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO49464 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG36])

HSP 1 Score: 75.485 bits (184), Expect = 1.097e-14
Identity = 41/149 (27.52%), Postives = 70/149 (46.98%), Query Frame = 2
Query:  782 FIWKINHFSEKQLEFEFDTDGSVFSEAFYTHDNGYKLCLGINPNGANQYLGKYLFTFFCIMKGPYDDNLPWPMKLEVVLSIVDQISLXXXXXXXXXXXXXXEMLQHSFSKPKFERNEGIGDNEFISFKELHLLNNILRNDSILLRCSIN 1228
            +IWKI+ ++ +  E       S++S  FY    GYK C  + PNG     G +L  FF +M+G +D  LPWP + +V   ++DQ  +          +   +    SF +P    N   G   FIS   L      +R+D++ ++ +++
Sbjct:  380 YIWKIDEYTRRYQEGVSGKTPSIYSPPFYVGRYGYKACARVYPNGDGMGKGSHLSLFFVLMRGEFDALLPWPFRQKVTFKLLDQDRV-----HDIGDTFRPDPTSSSFKRPTSNMNIASGCPLFISHTNLQ-TRAYVRDDTMFIKIAVD 522          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO48773 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI91])

HSP 1 Score: 73.9442 bits (180), Expect = 3.537e-14
Identity = 48/150 (32.00%), Postives = 77/150 (51.33%), Query Frame = 2
Query:  782 FIWKINHFSEKQLEFEFDTDGSVFSEAFYTHDNGYKLCLGINPNGANQYLGKYLFTFFCIMKGPYDDNLPWPMKLEVVLSIVDQISLXXXXXXXXXXXXXXEMLQHSFSKPKFERN-EGIGDNEFISFKELHLLNNILRNDSILLRCSIN 1228
            FIWK+++F + +         ++ S  FYT   GYK+CL +N NG +  LG+++  F  +M+G +D  L WP    + LSI+DQ    D +    +       L  +F +P   RN +G G  EF    +L      ++N+SIL+R  I+
Sbjct:  334 FIWKLDNFRQCREGSIAGLTAAIHSPPFYTSMYGYKMCLRMNLNGVDGGLGEHVSLFIHMMQGDWDGILEWPFIGRITLSILDQSDQIDSRRPISETLVAKPNLL-AFQRPTSPRNHKGYGYVEFCPIDQL-TEGQYIKNNSILVRIQIS 481          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO32851 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STV5])

HSP 1 Score: 70.0922 bits (170), Expect = 4.785e-13
Identity = 38/151 (25.17%), Postives = 71/151 (47.02%), Query Frame = 2
Query:  782 FIWKINHFSEKQLEFEFDTDGSVFSEAFYTHDNGYKLCLGINPNGANQYLGKYLFTFFCIMKGPYDDNLPWPMKLEVVLSIVDQISLXXXXXXXXXXXXXXEMLQHS--FSKPKFERNEGIGDNEFISFKELHLLNNILRNDSILLRCSIN 1228
             IW+I  ++ K  E +     ++FS  F T  +GY+LC  +  NG  +  G ++  F  ++KG +D  L WP    V   ++DQ      +       K +    +     +P+ E+N   G  +F   +E+ +  N ++ D+I L+ S++
Sbjct:  304 LIWRIEDYTRKMKEAKAGNTDTLFSPTFTTSKHGYRLCASVCLNGDGKGKGTHMSVFISVLKGAFDALLKWPFDYRVTFVLLDQNDDPAQRKHIRFSIKPNPCADNEPFLGRPRLEKNASFGGAKFAKHEEI-VSRNYIKEDTIFLKISVD 453          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO38873 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBN4])

HSP 1 Score: 68.9366 bits (167), Expect = 1.177e-12
Identity = 43/151 (28.48%), Postives = 75/151 (49.67%), Query Frame = 2
Query:  782 FIWKINHFSEKQLEFEFDTDGSVFSEAFYTHDNGYKLCLGINPNGANQYLGKYLFTFFCIMKGPYDDNLPWPMKLEVVLSIVDQISLXXXXXXXXXXXXXXEMLQHSFSKPKFERNEGIGDNEFISFKELHLLNNILRNDSILLRCSINAP 1234
             +WKI + + K+ E       S +S  F+T  +GYK+C  I  NG       ++  FF IM+G +D  L WP + +V L ++DQ +++           +S     SF +P+ E N   G   F S ++L   +  +R+D++ L+  ++ P
Sbjct:  335 LLWKITNVANKRSEATSGRVTSFYSPCFFTGPHGYKMCARIYLNGDGMGRNHHVSLFFVIMRGEFDALLRWPFRQKVTLMLLDQDNVEHVIDAFRPDPSSS-----SFQRPRAEMNIASGCPLFCSHEQL-TQHAYIRDDTMFLKIIVDKP 479          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf3 (TNF receptor associated factor 3 [Source:NCBI gene;Acc:101161601])

HSP 1 Score: 82.8037 bits (203), Expect = 9.533e-17
Identity = 97/408 (23.77%), Postives = 167/408 (40.93%), Query Frame = 2
Query:  182 CTCCRKLIIDPRKASCGCRFCENCSQKPSKTDNKCPNFHLASKLHSNIVTFNFQVDLETSLKVAHLEVFCPN--NECQFICKLRFLADHLNICE----------------KKD-------KCVYSLENITGIIEN------LQKY------AF--------------RSMEIEEQHKTDFEFLKTNLKSRDQ---ELVNMRRLISENQESIQTLEEAVNCLLEENETLKRLIXXXXXXXXXXXXXXYAILKTKPF----IWKINHFSEKQLEFEFDTDGSVFSEAFYTHDNGYKLCLGINPNGANQYLGKYLFTFFCIMKGPYDDNLPWPMKLEVVLSIVDQISLXXXXXXXXXXXXXXEMLQHSFSKPKFERNEGIGDNEFISFKELHLLNNILRNDSILLRCSINA 1231
            C  CR ++  PR+  CG RFC +C          CPN    + +        F+ D+    ++  L+V+C +  N CQ    L+ + DH+N+C                 +K+       KC Y  E+     +N      LQK+      AF              RS ++   H      L+  L+S  Q   E+ ++R  +   +  +  LE+     LE        + S++      ++  + +L+T  +    IWKI  +  ++ +       S++S+ FYT   GYK+C  +  NG     G +L  FF +M+G YD  LPWP K +V L ++DQ             +   +    SF +P  E N   G   F+S   L      +++D+I ++ +++ 
Sbjct:   48 CEACRLVLCQPRQTECGHRFCYSCIND----ILSCPNPVCPADMEPLFKDKIFR-DVCCHREIMALKVYCRSEANGCQEQMSLQQIPDHVNVCPFFEVPCPLGKCKERMMRKEIPEHLAWKCKYR-ESTCEFCKNKMPLTELQKHKETVCPAFPVSCPNHCTSSSLPRSEKLMSSHTEKLLELELELRSLRQLRDEMESLRGTLDTVRTRLSALEQGGRASLETQLNRHDDMLSVHEIRLADMDLRFQVLETASYNGTLIWKIRDYKRRKQDAVAGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDALLPWPFKQKVTLMLMDQ----GPSRKHLGDAFKPDPSSSSFRRPVAEMNIASGCPLFVSQSVLE-SGTYIKDDTIFIKVTVDT 444          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: unm_sa808 (TNF receptor-associated factor 2 [Source:NCBI gene;Acc:101155367])

HSP 1 Score: 81.2629 bits (199), Expect = 4.460e-16
Identity = 46/149 (30.87%), Postives = 74/149 (49.66%), Query Frame = 2
Query:  782 FIWKINHFSEKQLEFEFDTDGSVFSEAFYTHDNGYKLCLGINPNGANQYLGKYLFTFFCIMKGPYDDNLPWPMKLEVVLSIVDQISLXXXXXXXXXXXXXXEMLQHSFSKPKFERNEGIGDNEFISFKELHLLNNILRNDSILLRCSIN 1228
            FIW+I+ F++K+ +       ++FS AFYT   GYK+CL I  NG     G +L  FF +M+G  D  L WP   +V L ++DQ             +   ++   SF +P  E N   G   F    +L   N+ +R+D+I ++  ++
Sbjct:  449 FIWRISDFAKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGLSDALLKWPFNQKVTLMLLDQ-----SNREHIIDAFRPDVTSSSFQRPVSEMNIASGCPLFCPLSKLDAKNSYIRDDTIFIKAIVD 592          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: ENSORLT00000020861.2 (TNF receptor-associated factor 2 [Source:NCBI gene;Acc:101167626])

HSP 1 Score: 78.5666 bits (192), Expect = 3.168e-15
Identity = 45/149 (30.20%), Postives = 74/149 (49.66%), Query Frame = 2
Query:  782 FIWKINHFSEKQLEFEFDTDGSVFSEAFYTHDNGYKLCLGINPNGANQYLGKYLFTFFCIMKGPYDDNLPWPMKLEVVLSIVDQISLXXXXXXXXXXXXXXEMLQHSFSKPKFERNEGIGDNEFISFKELHLLNNILRNDSILLRCSIN 1228
            FIWKI+ F++K+ +       ++FS AFYT   GYK+CL I  NG     G +L  FF +M+G  D  L WP   +V L ++DQ             +   ++   SF +P  + N   G   F    +L   N+ +R+++I ++  ++
Sbjct:  422 FIWKISDFTKKRQDAMAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQ-----NNREHIIDAFRPDISSSSFQRPVSDMNIASGCPLFCPLSKLDSKNSYIRDETIFIKAIVD 565          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:101159764])

HSP 1 Score: 78.5666 bits (192), Expect = 3.198e-15
Identity = 45/149 (30.20%), Postives = 71/149 (47.65%), Query Frame = 2
Query:  782 FIWKINHFSEKQLEFEFDTDGSVFSEAFYTHDNGYKLCLGINPNGANQYLGKYLFTFFCIMKGPYDDNLPWPMKLEVVLSIVDQISLXXXXXXXXXXXXXXEMLQHSFSKPKFERNEGIGDNEFISFKELHLLNNILRNDSILLRCSIN 1228
            F+WKI  FS ++ E       ++FS AFY+   GYK+CL +  NG     G +L  FF +M+  YD  L WP   +V L ++DQ             +   ++   SF +P  E N   G   F    +L   +  LR+D+I ++  ++
Sbjct:  369 FVWKITDFSHRRQEAVSGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGTHLSLFFVVMRSKYDALLKWPFSQKVTLMLLDQ-----NNREHIIDAFRPDITSTSFQRPVSEMNIASGCPLFCPLAKLAGKSPYLRDDTIFIKAIVD 512          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:101159764])

HSP 1 Score: 78.5666 bits (192), Expect = 3.459e-15
Identity = 45/149 (30.20%), Postives = 71/149 (47.65%), Query Frame = 2
Query:  782 FIWKINHFSEKQLEFEFDTDGSVFSEAFYTHDNGYKLCLGINPNGANQYLGKYLFTFFCIMKGPYDDNLPWPMKLEVVLSIVDQISLXXXXXXXXXXXXXXEMLQHSFSKPKFERNEGIGDNEFISFKELHLLNNILRNDSILLRCSIN 1228
            F+WKI  FS ++ E       ++FS AFY+   GYK+CL +  NG     G +L  FF +M+  YD  L WP   +V L ++DQ             +   ++   SF +P  E N   G   F    +L   +  LR+D+I ++  ++
Sbjct:  376 FVWKITDFSHRRQEAVSGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGTHLSLFFVVMRSKYDALLKWPFSQKVTLMLLDQ-----NNREHIIDAFRPDITSTSFQRPVSEMNIASGCPLFCPLAKLAGKSPYLRDDTIFIKAIVD 519          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000011147.1 (SMESG000011147.1)

HSP 1 Score: 711.835 bits (1836), Expect = 0.000e+0
Identity = 377/382 (98.69%), Postives = 379/382 (99.21%), Query Frame = 2
Query:   89 MSVTTAQLSAIWGLLKKYEIRPIQPIDNVLLCTCCRKLIIDPRKASCGCRFCENCSQKPSKTDNKCPNFHLASKLHSNIVTFNFQVDLETSLKVAHLEVFCPNNECQFICKLRFLADHLNICEKKDKCVYSLENITGIIENLQKYAFRSMEIEEQHKTDFEFLKTNLKSRDQELVNMRRLISENQESIQTLEEAVNCLLEENETLKRLIXXXXXXXXXXXXXXYAILKTKPFIWKINHFSEKQLEFEFDTDGSVFSEAFYTHDNGYKLCLGINPNGANQYLGKYLFTFFCIMKGPYDDNLPWPMKLEVVLSIVDQISLXXXXXXXXXXXXXXEMLQHSFSKPKFERNEGIGDNEFISFKELHLLNNILRNDSILLRCSINAP 1234
            MSVTTAQLSAIWGLLKKYEIRPIQPIDNVLLCTCCRKLIIDPRKASCGCRFCENCS+KPSK DNKCPNFHLASKLHSNIVTFNFQVDLETSLKVAHLEVFCPNNECQFICKLRFLADHLNICEKKDKCVYSLENITGIIENLQKYAFRSMEIEEQHKTDFEFLKTNLKSRDQELVN RRLISENQESIQTLEEAVNCLLEENETLKRLINSLNNSSALVVNHSYAILKTKPFIWKINHFSEKQLEFEFDTDGSVFSEAFYTHDNGYKLCLGINPNGANQYLGKYLF FFCIMKGPYDDNLPWPMKLEVVLSIVDQISLKD+KTFKFKYSKTSEMLQHSFSKPKFERNEGIGDNEFISFKELHLLNNILRNDSILLRCSINAP
Sbjct:    1 MSVTTAQLSAIWGLLKKYEIRPIQPIDNVLLCTCCRKLIIDPRKASCGCRFCENCSRKPSKIDNKCPNFHLASKLHSNIVTFNFQVDLETSLKVAHLEVFCPNNECQFICKLRFLADHLNICEKKDKCVYSLENITGIIENLQKYAFRSMEIEEQHKTDFEFLKTNLKSRDQELVNTRRLISENQESIQTLEEAVNCLLEENETLKRLINSLNNSSALVVNHSYAILKTKPFIWKINHFSEKQLEFEFDTDGSVFSEAFYTHDNGYKLCLGINPNGANQYLGKYLFMFFCIMKGPYDDNLPWPMKLEVVLSIVDQISLKDYKTFKFKYSKTSEMLQHSFSKPKFERNEGIGDNEFISFKELHLLNNILRNDSILLRCSINAP 382          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000015041.1 (SMESG000015041.1)

HSP 1 Score: 230.335 bits (586), Expect = 2.680e-71
Identity = 144/383 (37.60%), Postives = 220/383 (57.44%), Query Frame = 2
Query:  110 LSAIWGLLKKYEIRPIQPIDNVLLCTCCRKLIIDPRKASCGCRFCENCSQK-PSKTDNKCPNFHLASKLHSNIVTFNFQVDLETSLKVAHLEVFCPNNECQFICKLRFLADHLNICEKKDKCVYSLENITGIIENLQ-KYAFRSM--------EIEEQHKTDFEFLKTNLKSRDQELVNMRRLISENQESIQTLEEAVNCLLEENETLKRLIXXXXXXXXXXXXXXYAILKTKPFIWKINHFSEKQLEFEFDTDGSVFSEAFYTHDNGYKLCLGINPNGANQYLGKYLFTFFCIMKGPYDDNLPWPMKLEVVLSIVDQISLXXXXXXXXXXXXXXEMLQHSFSKPKFERNEGIGDNEFISFKELHLLNNILRNDSILLRCSIN 1228
            +S +    K + I     +D  LLC  C++++I+  +ASCGC+ C NC ++   K  + CP        +      +F+ +   + KV  + V CPN  C + C+L  + DH+  C    +   +  N+    ENL      R +        E E+Q K + + LK  L++ +QEL   ++ +  N+  +++L+E V  L +EN+ LKRLI+    S   +    Y I K KPF+W++  FS KQ + + D    +FS+ FY++ NGYKLCLG+ PNG + + GK+LF FFCI+    D NL WPM+ +V LSI+D  +LKD K +KF Y   S+  +HSFSKP+ +RN+GIGDNEFISFKEL  + NI +ND+IL++C I+
Sbjct:    1 MSHVQPTQKPFNIISSTQVDEKLLCMLCQRILINADRASCGCKLCLNCCKEFMEKNRDHCPTCGFLKIENGK----DFEANHSVNSKVWRIVVKCPNIFCDYECELGAMNDHVEECFLLQQSKGATNNVDKTFENLDLANIVRGLNNKISILAENEKQGKIEMDELKQKLENCNQELNYFKKQLDTNELFLESLQETVENLKDENKDLKRLIDKQGLSVITLTPT-YDIHKPKPFLWRVTEFSRKQQDAKLDRKTIIFSDPFYSNYNGYKLCLGMYPNGVSNFEGKFLFVFFCILPSQNDGNLSWPMRHQVALSILDHNTLKDHKVYKFAYFSESKSCEHSFSKPESDRNDGIGDNEFISFKELSSMKNIFKNDTILIKCVID 378          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000026004.1 (SMESG000026004.1)

HSP 1 Score: 144.05 bits (362), Expect = 1.034e-38
Identity = 112/393 (28.50%), Postives = 189/393 (48.09%), Query Frame = 2
Query:   95 VTTAQLSAIWGLLKKYEIRPIQPIDNVLLCTCCRKLIIDPRKASCGCRFCENCSQKPSKTDNK-CPNFHLASKLHSNIVTFNFQVDLETSLKVAHLEVFCPNNECQFICKLRFLADHLNICEKK-----------DKCVYSLENITGIIENLQKYAFRSMEIEEQHK---TDFEFLKTNLKSRDQELVNMRRLISENQESIQTLEEAVNCLLEENETLKRLIXXXXXXXXXXXXXXYAILKTKPFIWKINHFSEKQLEFEFDTDGSVFSEAFYTHDNGYKLCLGINPNGANQYLGKYLFTFFCIMKGPYDDNLPWPMKLEVVLSIVDQISLXXXXXXXXXXXXXXEMLQHSFSKPKFERNEGIGDNEFISFKELHLLNNILRNDSILLRCSIN 1228
            ++ ++L  +W ++K +    ++ I N +LC  C+ ++I+   A CGCRFC +C  +     NK C       +L    +  N  VD   ++K+  L+V CP   C+ + +LR + DH  IC+ +           DKC  S E +  +   ++       E+  ++K    D   LK+N + R              QE I  L+   +   EEN  +K+L     N  +     +Y       FIWKI  FSEK    +   + S++SE F TH NGYK+CL ++P+G+    G +L   FC+MKG +D+ L WP +  V+ S+++Q +     +   K        +   S+PK +RN G+G+  FI+ KE+    ++  ND I ++C ++
Sbjct:    1 MSGSKLENVWQVVKNHNYDYVKEISNEMLCLLCKNVLINAHFAPCGCRFCLSCISEFLGGQNKMCLGNTEECQLEMLNLAENIFVDHPMNVKILKLKVKCPQRFCESVEELRKMEDHSRICKYRSVPSPFSNFGSDKCSKSEEKVDQMNNEIKLMKTHIFELRAENKLLRNDINKLKSNEEKR--------------QEEIAVLQCKCD---EENLKIKQL---NVNMISFNTKVTYG-----EFIWKIEKFSEKITHAKNGINHSIYSEPFITHRNGYKMCLELHPDGSGTGTGTHLSMCFCLMKGDFDEILEWPFRHSVIFSLLNQRTHLPHVSLIAKCRDFPNYKE--LSQPK-DRNYGMGNQLFITQKEISSNPDLANNDQIFIKCFVD 365          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000070126.1 (SMESG000070126.1)

HSP 1 Score: 141.354 bits (355), Expect = 3.700e-37
Identity = 122/436 (27.98%), Postives = 189/436 (43.35%), Query Frame = 2
Query:   95 VTTAQLSAIWGLLKKYEIRPIQPIDNVLLCTCCRKLIIDPRKASCGCRFCENC-SQKPSKTDNKCPNFHLASKLHSNIVTFN--FQVDLETSLKVAHLEVFCPNNECQFICKLRFLADHLNICEKKDKCVYS-------LENITGIIENLQKYAFRSMEIEEQH----KTDFEFLKTNLKSRDQELVN-----------MRRLISENQESIQTLEEAVNCLLEEN-------ETLK--------------------------RLIXXXXXXXXXXXXXXYAILKTKPFIWKINHFSEKQLEFEFDTDGSVFSEAFYTHDNGYKLCLGINPNGANQYLGKYLFTFFCIMKGPYDDNLPWPMKLEVVLSIVDQISLXXXXXXXXXXXXXXEMLQHSFSKPKFERNEGIGDNEFISFKELHLLNNILRNDSILLRCSIN 1228
            +  A+   IW LL +YE      + +  LC  C  ++ +P ++ CGCRFC  C     +  +  CP    +      ++ FN     D   S K++ ++V CP   C +  +L+ + +H  I   K+ C Y+         ++  I+E+L    +   ++  +     K +   L   LK   QEL N           +  L    +  IQ L E ++   EEN        TLK                          ++I+        +   S   +   PF WKI  F  K L+        V S  FY+H NGYKLC+ I+P+G    LG Y+  F  +MKG +D NL WPMKL++ + +VDQIS   F   KF YS      +H +S+P   +N GIG+++FI    L   + I   DSI+L+C + 
Sbjct:    1 MANAKYERIWKLLDEYEFAYDSLLSDEFLCVICNSILKNPYQSPCGCRFCMECIVDYLNDKETHCPGS--SEDCKDQLINFNGDLHADYVISRKISQVKVKCPKALCDYRSELQNIGNH--ISSHKESCPYTNIGCQYPSAHMGLIVEHLHDQIYEHGKLVTESFANLKNEVASLTLALKHSKQELENKDNLLIDLENRLNELQGTREIKIQELTETLDKCKEENVQLSSELRTLKSVSEVFSSNQKPKKGEKVQDEDLEKYKVISKNITQLIPMKPISTDHISYAPFEWKIRDF--KALKASTVIPTYVISRPFYSHVNGYKLCMTIHPSGTGIGLGSYISVFIHVMKGEFDSNLAWPMKLDLRICLVDQISDSYFVDKKFDYSSAILRNKHKYSRPFCVKNIGIGESQFIQLNALFNNSRIYLEDSIILKCFVG 430          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000070126.1 (SMESG000070126.1)

HSP 1 Score: 141.354 bits (355), Expect = 4.629e-37
Identity = 122/436 (27.98%), Postives = 189/436 (43.35%), Query Frame = 2
Query:   95 VTTAQLSAIWGLLKKYEIRPIQPIDNVLLCTCCRKLIIDPRKASCGCRFCENC-SQKPSKTDNKCPNFHLASKLHSNIVTFN--FQVDLETSLKVAHLEVFCPNNECQFICKLRFLADHLNICEKKDKCVYS-------LENITGIIENLQKYAFRSMEIEEQH----KTDFEFLKTNLKSRDQELVN-----------MRRLISENQESIQTLEEAVNCLLEEN-------ETLK--------------------------RLIXXXXXXXXXXXXXXYAILKTKPFIWKINHFSEKQLEFEFDTDGSVFSEAFYTHDNGYKLCLGINPNGANQYLGKYLFTFFCIMKGPYDDNLPWPMKLEVVLSIVDQISLXXXXXXXXXXXXXXEMLQHSFSKPKFERNEGIGDNEFISFKELHLLNNILRNDSILLRCSIN 1228
            +  A+   IW LL +YE      + +  LC  C  ++ +P ++ CGCRFC  C     +  +  CP    +      ++ FN     D   S K++ ++V CP   C +  +L+ + +H  I   K+ C Y+         ++  I+E+L    +   ++  +     K +   L   LK   QEL N           +  L    +  IQ L E ++   EEN        TLK                          ++I+        +   S   +   PF WKI  F  K L+        V S  FY+H NGYKLC+ I+P+G    LG Y+  F  +MKG +D NL WPMKL++ + +VDQIS   F   KF YS      +H +S+P   +N GIG+++FI    L   + I   DSI+L+C + 
Sbjct:   27 MANAKYERIWKLLDEYEFAYDSLLSDEFLCVICNSILKNPYQSPCGCRFCMECIVDYLNDKETHCPGS--SEDCKDQLINFNGDLHADYVISRKISQVKVKCPKALCDYRSELQNIGNH--ISSHKESCPYTNIGCQYPSAHMGLIVEHLHDQIYEHGKLVTESFANLKNEVASLTLALKHSKQELENKDNLLIDLENRLNELQGTREIKIQELTETLDKCKEENVQLSSELRTLKSVSEVFSSNQKPKKGEKVQDEDLEKYKVISKNITQLIPMKPISTDHISYAPFEWKIRDF--KALKASTVIPTYVISRPFYSHVNGYKLCMTIHPSGTGIGLGSYISVFIHVMKGEFDSNLAWPMKLDLRICLVDQISDSYFVDKKFDYSSAILRNKHKYSRPFCVKNIGIGESQFIQLNALFNNSRIYLEDSIILKCFVG 456          
The following BLAST results are available for this feature:
BLAST of TNF receptor-associated factor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRAF29.891e-1827.00TNF receptor associated factor 2 [Source:HGNC Symb... [more]
TRAF33.723e-1429.63TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF33.723e-1429.63TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF33.799e-1429.63TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF34.104e-1429.63TNF receptor associated factor 3 [Source:HGNC Symb... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
trf-13.221e-1124.50TNF Receptor Associated Factor (TRAF) homolog; TRF... [more]
trf-26.109e-939.34TNF Receptor Associated Factor (TRAF) homolog [So... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Traf41.541e-724.84gene:FBgn0026319 transcript:FBtr0334401[more]
Traf41.844e-724.84gene:FBgn0026319 transcript:FBtr0077429[more]
Traf-like1.472e-623.23gene:FBgn0030748 transcript:FBtr0074275[more]
Traf-like1.684e-623.23gene:FBgn0030748 transcript:FBtr0074273[more]
Traf-like2.140e-633.33gene:FBgn0030748 transcript:FBtr0308606[more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf2b2.946e-1627.13Tnf receptor-associated factor 2b [Source:ZFIN;Acc... [more]
traf2b2.946e-1627.13Tnf receptor-associated factor 2b [Source:ZFIN;Acc... [more]
unm_sa8083.725e-1630.87un-named sa808 [Source:ZFIN;Acc:ZDB-GENE-120727-21... [more]
traf2b3.895e-1627.13Tnf receptor-associated factor 2b [Source:ZFIN;Acc... [more]
BX901915.16.760e-1630.87pep chromosome:GRCz11:CHR_ALT_CTG5_1_18:28764891:2... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
egf2.994e-1632.47epidermal growth factor [Source:Xenbase;Acc:XB-GEN... [more]
sytl22.632e-1531.85synaptotagmin like 2 [Source:Xenbase;Acc:XB-GENE-9... [more]
hspb68.528e-1430.46heat shock protein family B (small) member 6 [Sour... [more]
ssh21.850e-1329.01slingshot protein phosphatase 2 [Source:Xenbase;Ac... [more]
ssh21.970e-1329.01slingshot protein phosphatase 2 [Source:Xenbase;Ac... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Traf24.533e-1730.87TNF receptor-associated factor 2 [Source:MGI Symbo... [more]
Traf24.770e-1730.87TNF receptor-associated factor 2 [Source:MGI Symbo... [more]
Traf32.993e-1429.63TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
Traf32.994e-1429.63TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
Traf32.994e-1429.63TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
back to top
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q12933|TRAF2_HUMAN4.750e-1727.00TNF receptor-associated factor 2 OS=Homo sapiens O... [more]
sp|Q3MV19|TRF6A_XENLA1.380e-1633.99TNF receptor-associated factor 6-A OS=Xenopus laev... [more]
sp|P39429|TRAF2_MOUSE3.336e-1630.87TNF receptor-associated factor 2 OS=Mus musculus O... [more]
sp|Q28DL4|TRAF6_XENTR1.503e-1532.47TNF receptor-associated factor 6 OS=Xenopus tropic... [more]
sp|Q6DJN2|TRF6B_XENLA6.901e-1532.68TNF receptor-associated factor 6-B OS=Xenopus laev... [more]
back to top
BLAST of TNF receptor-associated factor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2D4HS592.132e-2024.59TNF receptor-associated factor OS=Micrurus lemnisc... [more]
A0A402FGI51.139e-1924.83TNF receptor-associated factor OS=Paroedura picta ... [more]
T1DBK68.096e-1930.73TRAF-4 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
A0A0R3TIB81.956e-1834.04Uncharacterized protein OS=Rodentolepis nana OX=10... [more]
A0A2I0LIG51.022e-1725.28TNF receptor-associated factor 2 OS=Columba livia ... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf2a6.696e-1630.87TNF receptor-associated factor 2-like [Source:NCBI... [more]
traf2b7.355e-1630.20TNF receptor associated factor 2 [Source:NCBI gene... [more]
traf2a8.494e-1630.87TNF receptor-associated factor 2-like [Source:NCBI... [more]
traf4a1.093e-1532.48TNF receptor associated factor 4 [Source:NCBI gene... [more]
ENSAMXT00000035169.11.432e-1329.05pep primary_assembly:Astyanax_mexicanus-2.0:9:3354... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000002130.13.712e-1623.65pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 g... [more]
ENSPMAT00000000074.12.158e-1426.09pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-... [more]
traf61.979e-1228.81TNF receptor-associated factor 6 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO352374.211e-1739.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO494641.097e-1427.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO487733.537e-1432.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO328514.785e-1325.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO388731.177e-1228.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf39.533e-1723.77TNF receptor associated factor 3 [Source:NCBI gene... [more]
unm_sa8084.460e-1630.87TNF receptor-associated factor 2 [Source:NCBI gene... [more]
ENSORLT00000020861.23.168e-1530.20TNF receptor-associated factor 2 [Source:NCBI gene... [more]
traf2b3.198e-1530.20TNF receptor associated factor 2 [Source:NCBI gene... [more]
traf2b3.459e-1530.20TNF receptor associated factor 2 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000011147.10.000e+098.69SMESG000011147.1[more]
SMESG000015041.12.680e-7137.60SMESG000015041.1[more]
SMESG000026004.11.034e-3828.50SMESG000026004.1[more]
SMESG000070126.13.700e-3727.98SMESG000070126.1[more]
SMESG000070126.14.629e-3727.98SMESG000070126.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024587 ID=SMED30024587|Name=TNF receptor-associated factor|organism=Schmidtea mediterranea sexual|type=transcript|length=1356bp
TTCTTAGAATTTTATAAAGAAATATTGATTAAAAATTTCTTAAGCTTGGC
ATTGTCAATTTGTTTTTCGTTTTTCGAAGAGTAAGCCAATGTCCGTTACA
ACTGCCCAGCTTAGCGCTATCTGGGGACTATTGAAGAAATACGAAATCAG
ACCCATACAACCAATAGATAATGTCCTTTTGTGCACTTGCTGTCGGAAAT
TAATCATCGACCCTAGAAAGGCTTCCTGTGGCTGTAGATTTTGTGAAAAT
TGTTCCCAAAAACCCTCAAAAACTGATAATAAATGTCCGAACTTTCATTT
GGCTTCAAAACTCCATTCTAATATAGTAACTTTCAACTTTCAAGTCGACC
TCGAAACGAGTTTAAAAGTTGCCCACTTAGAGGTATTCTGTCCGAATAAT
GAATGTCAATTTATTTGCAAGCTTCGCTTCCTTGCAGACCACCTCAATAT
TTGTGAGAAAAAAGATAAATGTGTTTACTCACTCGAGAATATAACTGGGA
TTATAGAAAATCTACAAAAATATGCATTTCGGTCGATGGAGATTGAAGAA
CAGCATAAGACTGACTTTGAATTTTTAAAGACCAATTTGAAATCGCGAGA
CCAGGAACTAGTAAACATGCGAAGACTTATCAGTGAAAATCAGGAGTCGA
TACAAACATTAGAGGAGGCCGTTAATTGTTTATTAGAGGAAAACGAAACC
CTGAAAAGGTTGATCAATTCATTAAATAACAGCTCAGCATTGGTTGTAAA
TCATTCCTACGCAATTCTGAAAACAAAACCTTTCATTTGGAAAATTAATC
ATTTCTCAGAAAAACAACTTGAATTCGAATTTGACACGGATGGCTCGGTT
TTCAGTGAGGCTTTTTACACTCATGACAACGGCTACAAATTGTGCTTGGG
TATAAATCCCAATGGCGCCAATCAGTACCTTGGGAAATATCTGTTCACGT
TCTTTTGCATAATGAAAGGACCTTATGATGACAACCTGCCTTGGCCAATG
AAATTGGAAGTTGTTCTTAGCATCGTTGATCAGATCTCATTGAAAGACTT
CAAGACATTTAAATTTAAATATTCTAAAACTTCAGAAATGTTACAACATT
CATTTTCCAAGCCAAAGTTCGAGAGAAATGAAGGAATCGGTGACAATGAA
TTTATAAGCTTCAAAGAACTACATTTATTGAATAACATTTTGAGGAATGA
TTCCATTCTTCTTAGGTGTTCCATCAACGCTCCTTGATGATTCCATATAT
TTCATGACCATTAGGATTTTGATTGGATTTCATGATTTGAACATTTTTTA
TTTTTTTCCAATTTCCAGTTAGGAGATTTATCAGAGTTCGTTTTAGAGAT
TTTATA
back to top

protein sequence of SMED30024587-orf-1

>SMED30024587-orf-1 ID=SMED30024587-orf-1|Name=SMED30024587-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=383bp
MSVTTAQLSAIWGLLKKYEIRPIQPIDNVLLCTCCRKLIIDPRKASCGCR
FCENCSQKPSKTDNKCPNFHLASKLHSNIVTFNFQVDLETSLKVAHLEVF
CPNNECQFICKLRFLADHLNICEKKDKCVYSLENITGIIENLQKYAFRSM
EIEEQHKTDFEFLKTNLKSRDQELVNMRRLISENQESIQTLEEAVNCLLE
ENETLKRLINSLNNSSALVVNHSYAILKTKPFIWKINHFSEKQLEFEFDT
DGSVFSEAFYTHDNGYKLCLGINPNGANQYLGKYLFTFFCIMKGPYDDNL
PWPMKLEVVLSIVDQISLKDFKTFKFKYSKTSEMLQHSFSKPKFERNEGI
GDNEFISFKELHLLNNILRNDSILLRCSINAP*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0042981regulation of apoptotic process
GO:0007165signal transduction
GO:0007250activation of NF-kappaB-inducing kinase activity
GO:0016567protein ubiquitination
GO:0046330positive regulation of JNK cascade
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
PLANA:0000463cholinergic neuron
PLANA:0000464GABAergic neuron
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR043211TNF_rcpt-assoc_TRAF
IPR002083MATH/TRAF_dom
IPR013083Znf_RING/FYVE/PHD
IPR008974TRAF-like
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0004842ubiquitin-protein transferase activity
GO:0008270zinc ion binding
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 181..215
NoneNo IPR availablePANTHERPTHR10131:SF127coord: 28..377
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 24..68
IPR002083MATH/TRAF domainSMARTSM00061math_3coord: 234..361
e-value: 7.1E-4
score: 28.9
IPR002083MATH/TRAF domainPROSITEPS50144MATHcoord: 229..379
score: 18.729
IPR008974TRAF-likeGENE3DG3DSA:2.60.210.10coord: 166..381
e-value: 8.3E-43
score: 148.2
IPR008974TRAF-likeSUPERFAMILYSSF49599TRAF domain-likecoord: 231..380
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 14..130
e-value: 2.2E-8
score: 36.1
IPR043211TNF receptor-associated factor TRAFPANTHERPTHR10131TNF RECEPTOR ASSOCIATED FACTORcoord: 28..377