Pax6A

Overview
NamePax6A (AFJ24746.1)
Smed IDSMED30024586
Uniprot Best hitPaired box protein Pax-6 OS=Rattus norvegicus OX=10116 GN=Pax6 PE=2 SV=1 (E=4.62434e-81)
Length (bp)1992
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Pax6A (SMED30024586) t-SNE clustered cells

Violin plots show distribution of expression levels for Pax6A (SMED30024586) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Pax6A (SMED30024586) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Pax6A (SMED30024586) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top

Expression Details

Pax6A ( pax6A ) is expressed during Stage 5, Stage 6, Stage 7 and Stage 8 in the cephalic ganglia, neural progenitor cell and nervous system

Click to see image symbols and abbreviations
Abbreviation or symbolDefinition
Ooral hemisphere
Aaboral hemisphere
Ddorsal
Vventral
Llateral
black arrowheadembryonic pharynx
red arrowheaddefinitive pharynx
black arrowsprimitive gut
yellow arrowsprimitive ectoderm cells
cyan arrowsbrain
cyan arrowheadsnerve cords
blue arrowheadseye progenitors (trail cells)
purple arrowheadseyes
scale bar100 µm

 

Neural progenitors arise in the piwi-1+ blastomere population during S5.

SPIM reconstructed S5 embryo costained with piwi-1 and VAL-like (both in red) and pax6a (green). Neural progenitors, coexpressing piwi-1 and pax6a, are dispersed in the embryonic wall. As neural progenitors differentiate, they are predicted to downregulate piwi-1 and retain expression of pax6a. VAL-like is expressed the temporary embryonic pharynx (at bottom) and is not detected in piwi-1+ blastomeres

Anatomical Expression

PAGE et. al., 2020




SMED30024586

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 41

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X2 cellSMED30024586SMESG000039056.1 SmedASXL_011125SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
headSMED30024586SMESG000039056.1 dd_Smed_v6_17726_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30024586SMESG000039056.1 JX010503.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 8 colorimetric in situ hybridization evidence
nervous systemSMED30024586SMESG000039056.1 JX010503.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 5 colorimetric in situ hybridization evidence
nervous systemSMED30024586SMESG000039056.1 JX010503.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 6 colorimetric in situ hybridization evidence
nervous systemSMED30024586SMESG000039056.1 JX010503.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 7 colorimetric in situ hybridization evidence
cephalic gangliaSMED30024586SMESG000039056.1 JX010503.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 8 colorimetric in situ hybridization evidence
cephalic gangliaSMED30024586SMESG000039056.1 JX010503.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 7 colorimetric in situ hybridization evidence
ventral nerve cordSMED30024586SMESG000039056.1 JX010503.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 8 colorimetric in situ hybridization evidence
ventral nerve cordSMED30024586SMESG000039056.1 JX010503.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 7 colorimetric in situ hybridization evidence
neural progenitor cellSMED30024586SMESG000039056.1 JX010503.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 8 colorimetric in situ hybridization evidence
neural progenitor cellSMED30024586SMESG000039056.1 JX010503.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 6 colorimetric in situ hybridization evidence
neural progenitor cellSMED30024586SMESG000039056.1 JX010503.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 5 colorimetric in situ hybridization evidence
neural progenitor cellSMED30024586SMESG000039056.1 JX010503.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 5 fluorescence in situ hybridization evidence
neural progenitor cellSMED30024586SMESG000039056.1 JX010503.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 7 colorimetric in situ hybridization evidence
nervous systemSMED30024586SMESG000039056.1 SMED30024586smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 8 colorimetric in situ hybridization evidence
nervous systemSMED30024586SMESG000039056.1 SMED30024586smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 5 colorimetric in situ hybridization evidence
nervous systemSMED30024586SMESG000039056.1 SMED30024586smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 6 colorimetric in situ hybridization evidence
nervous systemSMED30024586SMESG000039056.1 SMED30024586smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 7 colorimetric in situ hybridization evidence
cephalic gangliaSMED30024586SMESG000039056.1 SMED30024586smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 7 colorimetric in situ hybridization evidence
cephalic gangliaSMED30024586SMESG000039056.1 SMED30024586smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 8 colorimetric in situ hybridization evidence
ventral nerve cordSMED30024586SMESG000039056.1 SMED30024586smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 8 colorimetric in situ hybridization evidence
ventral nerve cordSMED30024586SMESG000039056.1 SMED30024586smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 7 colorimetric in situ hybridization evidence
neural progenitor cellSMED30024586SMESG000039056.1 SMED30024586smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 5 colorimetric in situ hybridization evidence
neural progenitor cellSMED30024586SMESG000039056.1 SMED30024586smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 5 fluorescence in situ hybridization evidence
neural progenitor cellSMED30024586SMESG000039056.1 SMED30024586smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 8 colorimetric in situ hybridization evidence
neural progenitor cellSMED30024586SMESG000039056.1 SMED30024586smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 7 colorimetric in situ hybridization evidence
neural progenitor cellSMED30024586SMESG000039056.1 SMED30024586smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 6 colorimetric in situ hybridization evidence
nervous systemSMED30024586SMESG000039056.1 AFJ24746.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 6 colorimetric in situ hybridization evidence
nervous systemSMED30024586SMESG000039056.1 AFJ24746.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 5 colorimetric in situ hybridization evidence
nervous systemSMED30024586SMESG000039056.1 AFJ24746.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 8 colorimetric in situ hybridization evidence
nervous systemSMED30024586SMESG000039056.1 AFJ24746.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 7 colorimetric in situ hybridization evidence
cephalic gangliaSMED30024586SMESG000039056.1 AFJ24746.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 7 colorimetric in situ hybridization evidence
cephalic gangliaSMED30024586SMESG000039056.1 AFJ24746.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 8 colorimetric in situ hybridization evidence
ventral nerve cordSMED30024586SMESG000039056.1 AFJ24746.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 8 colorimetric in situ hybridization evidence
ventral nerve cordSMED30024586SMESG000039056.1 AFJ24746.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 7 colorimetric in situ hybridization evidence
neural progenitor cellSMED30024586SMESG000039056.1 AFJ24746.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 5 colorimetric in situ hybridization evidence
neural progenitor cellSMED30024586SMESG000039056.1 AFJ24746.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 7 colorimetric in situ hybridization evidence
neural progenitor cellSMED30024586SMESG000039056.1 AFJ24746.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 5 fluorescence in situ hybridization evidence
neural progenitor cellSMED30024586SMESG000039056.1 AFJ24746.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 8 colorimetric in situ hybridization evidence
neural progenitor cellSMED30024586SMESG000039056.1 AFJ24746.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 6 colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Pax6A vs. Ensembl Human
Match: PAX6 (paired box 6 [Source:HGNC Symbol;Acc:HGNC:8620])

HSP 1 Score: 268.47 bits (685), Expect = 1.417e-83
Identity = 126/152 (82.89%), Postives = 139/152 (91.45%), Query Frame = 2
Query:  293 RGHSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAATGMYDKLSLLSGQ 748
            +GHSG+NQLGG+FVNGRPLPDSTRQ+IVELAHSGARPCDISRILQVSNGCVSKIL RYYETGSIRP+AIGGSKPRVAT  VVSKIA YKRECPSIF+WEIRDRLL EGVC  DNIPSVSSINRVLR+L++E Q+  + A GMYDKL +L+GQ
Sbjct:    4 KGHSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVSKIAQYKRECPSIFAWEIRDRLLSEGVCTNDNIPSVSSINRVLRNLASEKQQ--MGADGMYDKLRMLNGQ 153          

HSP 2 Score: 143.665 bits (361), Expect = 3.239e-37
Identity = 64/83 (77.11%), Postives = 74/83 (89.16%), Query Frame = 2
Query: 1052 GVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQ 1300
            G  S+   MR++LKRKLQRNRTSF+ +Q+++LEKEFERTHYPDVFARE+LA KI LPEARIQVWFSNRRAKWRREEKLR QR+
Sbjct:  195 GEDSDEAQMRLQLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEKLRNQRR 277          
BLAST of Pax6A vs. Ensembl Human
Match: PAX6 (paired box 6 [Source:HGNC Symbol;Acc:HGNC:8620])

HSP 1 Score: 266.159 bits (679), Expect = 8.423e-82
Identity = 125/150 (83.33%), Postives = 137/150 (91.33%), Query Frame = 2
Query:  299 HSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAATGMYDKLSLLSGQ 748
            HSG+NQLGG+FVNGRPLPDSTRQ+IVELAHSGARPCDISRILQVSNGCVSKIL RYYETGSIRP+AIGGSKPRVAT  VVSKIA YKRECPSIF+WEIRDRLL EGVC  DNIPSVSSINRVLR+L++E Q+  + A GMYDKL +L+GQ
Sbjct:    5 HSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVSKIAQYKRECPSIFAWEIRDRLLSEGVCTNDNIPSVSSINRVLRNLASEKQQ--MGADGMYDKLRMLNGQ 152          

HSP 2 Score: 145.591 bits (366), Expect = 3.181e-37
Identity = 64/83 (77.11%), Postives = 74/83 (89.16%), Query Frame = 2
Query: 1052 GVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQ 1300
            G  S+   MR++LKRKLQRNRTSF+ +Q+++LEKEFERTHYPDVFARE+LA KI LPEARIQVWFSNRRAKWRREEKLR QR+
Sbjct:  194 GEDSDEAQMRLQLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEKLRNQRR 276          
BLAST of Pax6A vs. Ensembl Human
Match: PAX6 (paired box 6 [Source:HGNC Symbol;Acc:HGNC:8620])

HSP 1 Score: 266.159 bits (679), Expect = 8.646e-82
Identity = 125/150 (83.33%), Postives = 137/150 (91.33%), Query Frame = 2
Query:  299 HSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAATGMYDKLSLLSGQ 748
            HSG+NQLGG+FVNGRPLPDSTRQ+IVELAHSGARPCDISRILQVSNGCVSKIL RYYETGSIRP+AIGGSKPRVAT  VVSKIA YKRECPSIF+WEIRDRLL EGVC  DNIPSVSSINRVLR+L++E Q+  + A GMYDKL +L+GQ
Sbjct:    5 HSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVSKIAQYKRECPSIFAWEIRDRLLSEGVCTNDNIPSVSSINRVLRNLASEKQQ--MGADGMYDKLRMLNGQ 152          

HSP 2 Score: 145.206 bits (365), Expect = 3.566e-37
Identity = 64/83 (77.11%), Postives = 74/83 (89.16%), Query Frame = 2
Query: 1052 GVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQ 1300
            G  S+   MR++LKRKLQRNRTSF+ +Q+++LEKEFERTHYPDVFARE+LA KI LPEARIQVWFSNRRAKWRREEKLR QR+
Sbjct:  194 GEDSDEAQMRLQLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEKLRNQRR 276          
BLAST of Pax6A vs. Ensembl Human
Match: PAX6 (paired box 6 [Source:HGNC Symbol;Acc:HGNC:8620])

HSP 1 Score: 266.159 bits (679), Expect = 8.646e-82
Identity = 125/150 (83.33%), Postives = 137/150 (91.33%), Query Frame = 2
Query:  299 HSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAATGMYDKLSLLSGQ 748
            HSG+NQLGG+FVNGRPLPDSTRQ+IVELAHSGARPCDISRILQVSNGCVSKIL RYYETGSIRP+AIGGSKPRVAT  VVSKIA YKRECPSIF+WEIRDRLL EGVC  DNIPSVSSINRVLR+L++E Q+  + A GMYDKL +L+GQ
Sbjct:    5 HSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVSKIAQYKRECPSIFAWEIRDRLLSEGVCTNDNIPSVSSINRVLRNLASEKQQ--MGADGMYDKLRMLNGQ 152          

HSP 2 Score: 145.206 bits (365), Expect = 3.566e-37
Identity = 64/83 (77.11%), Postives = 74/83 (89.16%), Query Frame = 2
Query: 1052 GVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQ 1300
            G  S+   MR++LKRKLQRNRTSF+ +Q+++LEKEFERTHYPDVFARE+LA KI LPEARIQVWFSNRRAKWRREEKLR QR+
Sbjct:  194 GEDSDEAQMRLQLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEKLRNQRR 276          
BLAST of Pax6A vs. Ensembl Human
Match: PAX6 (paired box 6 [Source:HGNC Symbol;Acc:HGNC:8620])

HSP 1 Score: 266.159 bits (679), Expect = 8.788e-82
Identity = 125/150 (83.33%), Postives = 137/150 (91.33%), Query Frame = 2
Query:  299 HSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAATGMYDKLSLLSGQ 748
            HSG+NQLGG+FVNGRPLPDSTRQ+IVELAHSGARPCDISRILQVSNGCVSKIL RYYETGSIRP+AIGGSKPRVAT  VVSKIA YKRECPSIF+WEIRDRLL EGVC  DNIPSVSSINRVLR+L++E Q+  + A GMYDKL +L+GQ
Sbjct:    5 HSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVSKIAQYKRECPSIFAWEIRDRLLSEGVCTNDNIPSVSSINRVLRNLASEKQQ--MGADGMYDKLRMLNGQ 152          

HSP 2 Score: 145.591 bits (366), Expect = 3.073e-37
Identity = 64/83 (77.11%), Postives = 74/83 (89.16%), Query Frame = 2
Query: 1052 GVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQ 1300
            G  S+   MR++LKRKLQRNRTSF+ +Q+++LEKEFERTHYPDVFARE+LA KI LPEARIQVWFSNRRAKWRREEKLR QR+
Sbjct:  194 GEDSDEAQMRLQLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEKLRNQRR 276          
BLAST of Pax6A vs. Ensembl Celegans
Match: vab-3 (MAB-18 [Source:UniProtKB/TrEMBL;Acc:G5EE71])

HSP 1 Score: 327.791 bits (839), Expect = 2.064e-105
Identity = 177/356 (49.72%), Postives = 231/356 (64.89%), Query Frame = 2
Query:  296 GHSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAATGMYDKLSLLSGQPXXXXXXXXXXXXXXXXXXXXXXXXFPNCGAYGGLTGIGIINGMSTAHAVASINQSNSGVTNYHVQSTTDSSDKHKSEKYSESIAHSESNASSEPGNEYMSGVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQNLMLG---SNGTSSTADTNVT 1354
            GH+G+NQLGG+FVNGRPLPD+TRQRIV+LAH G RPCDISR+LQVSNGCVSKILCRYYE+G+IRP+AIGGSKPRVATS VV KI  YKR+ PSIF+WEIRD+LL + +CN + IPSVSSINRVLR+L+ + ++ +   T +YD++ ++                            FP   ++ G   I  +NG     AV        G+  +      +   + + EK        +    +EP ++  + ++     ++ KL+R    NRTSF+  Q++SLEKEFERTHYPDVFARE+LA KI LPEARIQVWFSNRRAKWRREEK+R +R +  +    SNGT +    +VT
Sbjct:    5 GHTGVNQLGGVFVNGRPLPDATRQRIVDLAHKGCRPCDISRLLQVSNGCVSKILCRYYESGTIRPRAIGGSKPRVATSDVVEKIEDYKRDQPSIFAWEIRDKLLADNICNNETIPSVSSINRVLRNLAAKKEQ-VTMQTELYDRIRIVDN--------------------------FPYNSSWYGQWPIP-MNG-----AV--------GLNPFVPAPLIEPKTEGEFEK------DEDQKPPTEPEDDAAARMR-----LKRKLQR----NRTSFTQVQIESLEKEFERTHYPDVFARERLAQKIQLPEARIQVWFSNRRAKWRREEKMRNKRSSGTMDSSLSNGTPTPTPGSVT 304          
BLAST of Pax6A vs. Ensembl Celegans
Match: pax-2 (PAX (Paired box) transcription factor [Source:UniProtKB/TrEMBL;Acc:U4PCL3])

HSP 1 Score: 184.882 bits (468), Expect = 3.042e-53
Identity = 81/127 (63.78%), Postives = 106/127 (83.46%), Query Frame = 2
Query:  299 HSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLS 679
            H+G+NQLGG+FVNGRPLPD+ R +IVE++  G RPCDISR L+VS+GCVSKIL RYY TGS+RP  IGGSKP+VAT  VV  IA YKR  P++F+WEIR +L+++ +C ++N+PSVSSINR++R+ S
Sbjct:   30 HTGVNQLGGVFVNGRPLPDTIRAQIVEMSQHGTRPCDISRQLKVSHGCVSKILGRYYSTGSVRPGVIGGSKPKVATPRVVECIAGYKRANPTMFAWEIRQKLIEDQICGEENVPSVSSINRIVRNKS 156          
BLAST of Pax6A vs. Ensembl Celegans
Match: pax-2 (PAX (Paired box) transcription factor [Source:UniProtKB/TrEMBL;Acc:U4PCL3])

HSP 1 Score: 184.496 bits (467), Expect = 2.228e-52
Identity = 81/127 (63.78%), Postives = 106/127 (83.46%), Query Frame = 2
Query:  299 HSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLS 679
            H+G+NQLGG+FVNGRPLPD+ R +IVE++  G RPCDISR L+VS+GCVSKIL RYY TGS+RP  IGGSKP+VAT  VV  IA YKR  P++F+WEIR +L+++ +C ++N+PSVSSINR++R+ S
Sbjct:   92 HTGVNQLGGVFVNGRPLPDTIRAQIVEMSQHGTRPCDISRQLKVSHGCVSKILGRYYSTGSVRPGVIGGSKPKVATPRVVECIAGYKRANPTMFAWEIRQKLIEDQICGEENVPSVSSINRIVRNKS 218          
BLAST of Pax6A vs. Ensembl Celegans
Match: egl-38 (PAX protein [Source:UniProtKB/TrEMBL;Acc:G5ED14])

HSP 1 Score: 181.8 bits (460), Expect = 5.249e-52
Identity = 84/138 (60.87%), Postives = 109/138 (78.99%), Query Frame = 2
Query:  299 HSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAAT 712
            H+G+NQLGG+FVNGRPL D+ R +IVE++  G RPCDISR L+VS+GCVSKIL RYY TGS+RP  IGGSKP+VAT  VV  IA YKR  P++F+WEIR +L+++ +C ++N+PSVSSINR++R+ S   Q  L A T
Sbjct:   30 HTGVNQLGGVFVNGRPLADTVRAQIVEMSQHGTRPCDISRQLKVSHGCVSKILGRYYSTGSVRPGVIGGSKPKVATPRVVECIAGYKRANPTMFAWEIRQKLIEDQICGEENVPSVSSINRIVRNKSFMAQ--LAAPT 165          
BLAST of Pax6A vs. Ensembl Celegans
Match: pax-1 (PAX (Paired box) transcription factor [Source:UniProtKB/TrEMBL;Acc:Q21272])

HSP 1 Score: 160.229 bits (404), Expect = 1.382e-44
Identity = 74/121 (61.16%), Postives = 93/121 (76.86%), Query Frame = 2
Query:  308 INQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLR 670
            +NQLGG+FVNGRPLP   R +IVEL+  G RPCDISR L++S+GCVSKIL R+ E G+I P  IGGS+PRV T  VV  I + KR  P IF+WEIRDRL+   +C++ N+PSVSSI+R+LR
Sbjct:   65 VNQLGGVFVNGRPLPFEMRCKIVELSRQGTRPCDISRQLKISHGCVSKILTRFSENGTIMPGTIGGSRPRVTTPKVVEYIRSLKRSDPGIFAWEIRDRLISADICDRANLPSVSSISRILR 185          
BLAST of Pax6A vs. Ensembl Fly
Match: toy (gene:FBgn0019650 transcript:FBtr0089185)

HSP 1 Score: 387.497 bits (994), Expect = 3.235e-127
Identity = 204/352 (57.95%), Postives = 249/352 (70.74%), Query Frame = 2
Query:  296 GHSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAAT-GMYDKLSLLSGQPXXXXXXXXXXXXXXXXXXXXXXXXFPNCGAYGGLTGIGIINGMSTAHAVASINQSNSGVTNYHVQSTTDSSDKHKSE-KYSESIAHSESNASSEPGNEYMSGVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQNL-MLGSNGTSSTAD 1342
            GHSGINQLGG++VNGRPLPDSTRQ+IVELAHSGARPCDISRILQVSNGCVSKIL RYYETGSI+P+AIGGSKPRVAT+ VV KIA YKRECPSIF+WEIRDRLL E VCN DNIPSVSSINRVLR+L+++ ++        +Y+KL + +GQ                       + +P+      LT       +  A +V +   + SG          D  D  K E ++S  ++H+ S+ S+  GN   +    E+  MR++LKRKLQRNRTSFS +Q+DSLEKEFERTHYPDVFARE+LADKI LPEARIQVWFSNRRAKWRREEK+R QR++   +  +G +STA+
Sbjct:   29 GHSGINQLGGVYVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIKPRAIGGSKPRVATTPVVQKIADYKRECPSIFAWEIRDRLLSEQVCNSDNIPSVSSINRVLRNLASQKEQQAQQQNESVYEKLRMFNGQ-------------------TGGWAWYPSNTTTAHLT-------LPPAASVVTSPANLSG--------QADRDDVQKRELQFSVEVSHTNSHDSTSDGNSEHNSSGDEDSQMRLRLKRKLQRNRTSFSNEQIDSLEKEFERTHYPDVFARERLADKIGLPEARIQVWFSNRRAKWRREEKMRTQRRSADTVDGSGRTSTAN 346          
BLAST of Pax6A vs. Ensembl Fly
Match: toy (gene:FBgn0019650 transcript:FBtr0339509)

HSP 1 Score: 373.629 bits (958), Expect = 5.176e-122
Identity = 205/369 (55.56%), Postives = 252/369 (68.29%), Query Frame = 2
Query:  296 GHSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAAT-GMYDKLSLLSGQPXXXXXXXXXXXXXXXXXXXXXXXXFPNCGAYGGLTGIGIINGMSTAHAVASINQSNSGVTNYHVQSTTDSSDKHKSE-KYSESIAHSESNASSEPGNEYMSGVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQ--NLMLGSNGTS-------STADTNVTTNGNT 1369
            GHSGINQLGG++VNGRPLPDSTRQ+IVELAHSGARPCDISRILQVSNGCVSKIL RYYETGSI+P+AIGGSKPRVAT+ VV KIA YKRECPSIF+WEIRDRLL E VCN DNIPSVSSINRVLR+L+++ ++        +Y+KL + +GQ                       + +P+      LT       +  A +V +   + SG          D  D  K E ++S  ++H+ S+ S+  GN   +    E+  MR++LKRKLQRNRTSFS +Q+DSLEKEFERTHYPDVFARE+LADKI LPE    VWFSNRRAKWRREEK+R QR+  + + GS  TS       +TA ++V T+ N+
Sbjct:   29 GHSGINQLGGVYVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIKPRAIGGSKPRVATTPVVQKIADYKRECPSIFAWEIRDRLLSEQVCNSDNIPSVSSINRVLRNLASQKEQQAQQQNESVYEKLRMFNGQ-------------------TGGWAWYPSNTTTAHLT-------LPPAASVVTSPANLSG--------QADRDDVQKRELQFSVEVSHTNSHDSTSDGNSEHNSSGDEDSQMRLRLKRKLQRNRTSFSNEQIDSLEKEFERTHYPDVFARERLADKIGLPE----VWFSNRRAKWRREEKMRTQRRSADTVDGSGRTSTANNPSGTTASSSVATSNNS 359          
BLAST of Pax6A vs. Ensembl Fly
Match: ey (gene:FBgn0005558 transcript:FBtr0089236)

HSP 1 Score: 245.743 bits (626), Expect = 1.664e-70
Identity = 112/133 (84.21%), Postives = 124/133 (93.23%), Query Frame = 2
Query:  293 RGHSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQ 691
            +GHSG+NQLGG+FV GRPLPDSTRQ+IVELAHSGARPCDISRILQVSNGCVSKIL RYYETGSIRP+AIGGSKPRVAT+ VVSKI+ YKRECPSIF+WEIRDRLLQE VC  DNIPSVSSINRVLR+L+ + +
Sbjct:   36 KGHSGVNQLGGVFVGGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATAEVVSKISQYKRECPSIFAWEIRDRLLQENVCTNDNIPSVSSINRVLRNLAAQKE 168          

HSP 2 Score: 153.295 bits (386), Expect = 1.723e-38
Identity = 72/112 (64.29%), Postives = 85/112 (75.89%), Query Frame = 2
Query:  965 DKHKSEKYSESIAHSESNASSEPGNEYMSGVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQ 1300
            D H+S++       + +  +S  GN       +E+D  R+ LKRKLQRNRTSF+ DQ+DSLEKEFERTHYPDVFARE+LA KI LPEARIQVWFSNRRAKWRREEKLR QR+
Sbjct:  373 DGHQSDETGSGEGENSNGGASNIGN-------TEDDQARLILKRKLQRNRTSFTNDQIDSLEKEFERTHYPDVFARERLAGKIGLPEARIQVWFSNRRAKWRREEKLRNQRR 477          
BLAST of Pax6A vs. Ensembl Fly
Match: ey (gene:FBgn0005558 transcript:FBtr0100395)

HSP 1 Score: 242.662 bits (618), Expect = 2.767e-69
Identity = 111/131 (84.73%), Postives = 122/131 (93.13%), Query Frame = 2
Query:  299 HSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQ 691
            HSG+NQLGG+FV GRPLPDSTRQ+IVELAHSGARPCDISRILQVSNGCVSKIL RYYETGSIRP+AIGGSKPRVAT+ VVSKI+ YKRECPSIF+WEIRDRLLQE VC  DNIPSVSSINRVLR+L+ + +
Sbjct:   57 HSGVNQLGGVFVGGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATAEVVSKISQYKRECPSIFAWEIRDRLLQENVCTNDNIPSVSSINRVLRNLAAQKE 187          

HSP 2 Score: 152.91 bits (385), Expect = 2.293e-38
Identity = 72/112 (64.29%), Postives = 85/112 (75.89%), Query Frame = 2
Query:  965 DKHKSEKYSESIAHSESNASSEPGNEYMSGVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQ 1300
            D H+S++       + +  +S  GN       +E+D  R+ LKRKLQRNRTSF+ DQ+DSLEKEFERTHYPDVFARE+LA KI LPEARIQVWFSNRRAKWRREEKLR QR+
Sbjct:  392 DGHQSDETGSGEGENSNGGASNIGN-------TEDDQARLILKRKLQRNRTSFTNDQIDSLEKEFERTHYPDVFARERLAGKIGLPEARIQVWFSNRRAKWRREEKLRNQRR 496          
BLAST of Pax6A vs. Ensembl Fly
Match: ey (gene:FBgn0005558 transcript:FBtr0100396)

HSP 1 Score: 243.047 bits (619), Expect = 3.362e-69
Identity = 111/131 (84.73%), Postives = 122/131 (93.13%), Query Frame = 2
Query:  299 HSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQ 691
            HSG+NQLGG+FV GRPLPDSTRQ+IVELAHSGARPCDISRILQVSNGCVSKIL RYYETGSIRP+AIGGSKPRVAT+ VVSKI+ YKRECPSIF+WEIRDRLLQE VC  DNIPSVSSINRVLR+L+ + +
Sbjct:   98 HSGVNQLGGVFVGGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATAEVVSKISQYKRECPSIFAWEIRDRLLQENVCTNDNIPSVSSINRVLRNLAAQKE 228          

HSP 2 Score: 153.295 bits (386), Expect = 2.310e-38
Identity = 72/112 (64.29%), Postives = 85/112 (75.89%), Query Frame = 2
Query:  965 DKHKSEKYSESIAHSESNASSEPGNEYMSGVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQ 1300
            D H+S++       + +  +S  GN       +E+D  R+ LKRKLQRNRTSF+ DQ+DSLEKEFERTHYPDVFARE+LA KI LPEARIQVWFSNRRAKWRREEKLR QR+
Sbjct:  433 DGHQSDETGSGEGENSNGGASNIGN-------TEDDQARLILKRKLQRNRTSFTNDQIDSLEKEFERTHYPDVFARERLAGKIGLPEARIQVWFSNRRAKWRREEKLRNQRR 537          
BLAST of Pax6A vs. Ensembl Zebrafish
Match: pax6b (paired box 6b [Source:ZFIN;Acc:ZDB-GENE-001031-1])

HSP 1 Score: 264.618 bits (675), Expect = 3.826e-81
Identity = 124/150 (82.67%), Postives = 136/150 (90.67%), Query Frame = 2
Query:  299 HSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAATGMYDKLSLLSGQ 748
            HSG+NQLGG+FVNGRPLPDSTRQ+IVELAHSGARPCDISRILQVSNGCVSKIL RYYETGSIRP+AIGGSKPRVAT  VV KIA YKRECPSIF+WEIRDRLL EGVC  DNIPSVSSINRVLR+L++E Q+  + A GMYDKL +L+GQ
Sbjct:   24 HSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVGKIAQYKRECPSIFAWEIRDRLLSEGVCTNDNIPSVSSINRVLRNLASEKQQ--MGADGMYDKLRMLNGQ 171          

HSP 2 Score: 144.821 bits (364), Expect = 4.588e-37
Identity = 64/83 (77.11%), Postives = 74/83 (89.16%), Query Frame = 2
Query: 1052 GVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQ 1300
            G  S+   MR++LKRKLQRNRTSF+ +Q+++LEKEFERTHYPDVFARE+LA KI LPEARIQVWFSNRRAKWRREEKLR QR+
Sbjct:  213 GEDSDETQMRLQLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEKLRNQRR 295          
BLAST of Pax6A vs. Ensembl Zebrafish
Match: pax6b (paired box 6b [Source:ZFIN;Acc:ZDB-GENE-001031-1])

HSP 1 Score: 264.618 bits (675), Expect = 3.826e-81
Identity = 124/150 (82.67%), Postives = 136/150 (90.67%), Query Frame = 2
Query:  299 HSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAATGMYDKLSLLSGQ 748
            HSG+NQLGG+FVNGRPLPDSTRQ+IVELAHSGARPCDISRILQVSNGCVSKIL RYYETGSIRP+AIGGSKPRVAT  VV KIA YKRECPSIF+WEIRDRLL EGVC  DNIPSVSSINRVLR+L++E Q+  + A GMYDKL +L+GQ
Sbjct:   24 HSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVGKIAQYKRECPSIFAWEIRDRLLSEGVCTNDNIPSVSSINRVLRNLASEKQQ--MGADGMYDKLRMLNGQ 171          

HSP 2 Score: 144.821 bits (364), Expect = 4.588e-37
Identity = 64/83 (77.11%), Postives = 74/83 (89.16%), Query Frame = 2
Query: 1052 GVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQ 1300
            G  S+   MR++LKRKLQRNRTSF+ +Q+++LEKEFERTHYPDVFARE+LA KI LPEARIQVWFSNRRAKWRREEKLR QR+
Sbjct:  213 GEDSDETQMRLQLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEKLRNQRR 295          
BLAST of Pax6A vs. Ensembl Zebrafish
Match: pax6a (paired box 6a [Source:NCBI gene;Acc:30567])

HSP 1 Score: 262.692 bits (670), Expect = 1.880e-80
Identity = 123/150 (82.00%), Postives = 136/150 (90.67%), Query Frame = 2
Query:  299 HSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAATGMYDKLSLLSGQ 748
            HSG+NQLGG+FVNGRPLPDSTRQ+IVELAHSGARPCDISRILQVSNGCVSKIL RYYETGSIRP+AIGGSKPRVAT  VV KIA YKRECPSIF+WEIRDRLL EGVC  DNIPSVSSINRVLR+L++E Q+  + A GMY+KL +L+GQ
Sbjct:   24 HSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVGKIAQYKRECPSIFAWEIRDRLLSEGVCTNDNIPSVSSINRVLRNLASEKQQ--MGADGMYEKLRMLNGQ 171          

HSP 2 Score: 145.206 bits (365), Expect = 4.206e-37
Identity = 64/83 (77.11%), Postives = 74/83 (89.16%), Query Frame = 2
Query: 1052 GVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQ 1300
            G  S+   MR++LKRKLQRNRTSF+ +Q+++LEKEFERTHYPDVFARE+LA KI LPEARIQVWFSNRRAKWRREEKLR QR+
Sbjct:  213 GEDSDETQMRLQLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEKLRNQRR 295          
BLAST of Pax6A vs. Ensembl Zebrafish
Match: pax6b (paired box 6b [Source:ZFIN;Acc:ZDB-GENE-001031-1])

HSP 1 Score: 255.758 bits (652), Expect = 1.521e-77
Identity = 124/163 (76.07%), Postives = 136/163 (83.44%), Query Frame = 2
Query:  299 HSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQ-------------VSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAATGMYDKLSLLSGQ 748
            HSG+NQLGG+FVNGRPLPDSTRQ+IVELAHSGARPCDISRILQ             VSNGCVSKIL RYYETGSIRP+AIGGSKPRVAT  VV KIA YKRECPSIF+WEIRDRLL EGVC  DNIPSVSSINRVLR+L++E Q+  + A GMYDKL +L+GQ
Sbjct:   24 HSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQTHDDAKVQLDNKNVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVGKIAQYKRECPSIFAWEIRDRLLSEGVCTNDNIPSVSSINRVLRNLASEKQQ--MGADGMYDKLRMLNGQ 184          

HSP 2 Score: 144.821 bits (364), Expect = 6.722e-37
Identity = 64/83 (77.11%), Postives = 74/83 (89.16%), Query Frame = 2
Query: 1052 GVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQ 1300
            G  S+   MR++LKRKLQRNRTSF+ +Q+++LEKEFERTHYPDVFARE+LA KI LPEARIQVWFSNRRAKWRREEKLR QR+
Sbjct:  226 GEDSDETQMRLQLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEKLRNQRR 308          
BLAST of Pax6A vs. Ensembl Zebrafish
Match: pax6b (paired box 6b [Source:ZFIN;Acc:ZDB-GENE-001031-1])

HSP 1 Score: 255.758 bits (652), Expect = 1.521e-77
Identity = 124/163 (76.07%), Postives = 136/163 (83.44%), Query Frame = 2
Query:  299 HSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQ-------------VSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAATGMYDKLSLLSGQ 748
            HSG+NQLGG+FVNGRPLPDSTRQ+IVELAHSGARPCDISRILQ             VSNGCVSKIL RYYETGSIRP+AIGGSKPRVAT  VV KIA YKRECPSIF+WEIRDRLL EGVC  DNIPSVSSINRVLR+L++E Q+  + A GMYDKL +L+GQ
Sbjct:   24 HSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQTHDDAKVQLDNKNVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVGKIAQYKRECPSIFAWEIRDRLLSEGVCTNDNIPSVSSINRVLRNLASEKQQ--MGADGMYDKLRMLNGQ 184          

HSP 2 Score: 144.821 bits (364), Expect = 6.722e-37
Identity = 64/83 (77.11%), Postives = 74/83 (89.16%), Query Frame = 2
Query: 1052 GVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQ 1300
            G  S+   MR++LKRKLQRNRTSF+ +Q+++LEKEFERTHYPDVFARE+LA KI LPEARIQVWFSNRRAKWRREEKLR QR+
Sbjct:  226 GEDSDETQMRLQLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEKLRNQRR 308          
BLAST of Pax6A vs. Ensembl Xenopus
Match: pax6 (paired box 6 [Source:NCBI gene;Acc:448447])

HSP 1 Score: 266.929 bits (681), Expect = 1.042e-82
Identity = 126/151 (83.44%), Postives = 138/151 (91.39%), Query Frame = 2
Query:  296 GHSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAATGMYDKLSLLSGQ 748
            GHSG+NQLGG+FVNGRPLPDSTRQ+IVELAHSGARPCDISRILQVSNGCVSKIL RYYETGSIRP+AIGGSKPRVAT  VVSKIA YKRECPSIF+WEIRDRLL EGVC  DNIPSVSSINRVLR+L++E Q+  + A GMYDKL +L+GQ
Sbjct:   11 GHSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVSKIAQYKRECPSIFAWEIRDRLLSEGVCTNDNIPSVSSINRVLRNLASEKQQ--MGADGMYDKLRMLNGQ 159          

HSP 2 Score: 103.99 bits (258), Expect = 2.362e-23
Identity = 46/63 (73.02%), Postives = 55/63 (87.30%), Query Frame = 2
Query: 1052 GVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQV 1240
            G  S+   MR++LKRKLQRNRTSF+ +Q+++LEKEFERTHYPDVFARE+LA KI LPEARIQV
Sbjct:  203 GEDSDEAQMRLQLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQV 265          
BLAST of Pax6A vs. Ensembl Xenopus
Match: pax6 (paired box 6 [Source:NCBI gene;Acc:448447])

HSP 1 Score: 268.085 bits (684), Expect = 2.550e-82
Identity = 126/151 (83.44%), Postives = 138/151 (91.39%), Query Frame = 2
Query:  296 GHSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAATGMYDKLSLLSGQ 748
            GHSG+NQLGG+FVNGRPLPDSTRQ+IVELAHSGARPCDISRILQVSNGCVSKIL RYYETGSIRP+AIGGSKPRVAT  VVSKIA YKRECPSIF+WEIRDRLL EGVC  DNIPSVSSINRVLR+L++E Q+  + A GMYDKL +L+GQ
Sbjct:   11 GHSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVSKIAQYKRECPSIFAWEIRDRLLSEGVCTNDNIPSVSSINRVLRNLASEKQQ--MGADGMYDKLRMLNGQ 159          

HSP 2 Score: 145.206 bits (365), Expect = 4.004e-37
Identity = 64/83 (77.11%), Postives = 74/83 (89.16%), Query Frame = 2
Query: 1052 GVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQ 1300
            G  S+   MR++LKRKLQRNRTSF+ +Q+++LEKEFERTHYPDVFARE+LA KI LPEARIQVWFSNRRAKWRREEKLR QR+
Sbjct:  203 GEDSDEAQMRLQLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEKLRNQRR 285          
BLAST of Pax6A vs. Ensembl Xenopus
Match: pax6 (paired box 6 [Source:NCBI gene;Acc:448447])

HSP 1 Score: 265.774 bits (678), Expect = 1.257e-81
Identity = 125/150 (83.33%), Postives = 137/150 (91.33%), Query Frame = 2
Query:  299 HSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAATGMYDKLSLLSGQ 748
            HSG+NQLGG+FVNGRPLPDSTRQ+IVELAHSGARPCDISRILQVSNGCVSKIL RYYETGSIRP+AIGGSKPRVAT  VVSKIA YKRECPSIF+WEIRDRLL EGVC  DNIPSVSSINRVLR+L++E Q+  + A GMYDKL +L+GQ
Sbjct:    1 HSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVSKIAQYKRECPSIFAWEIRDRLLSEGVCTNDNIPSVSSINRVLRNLASEKQQ--MGADGMYDKLRMLNGQ 148          

HSP 2 Score: 145.206 bits (365), Expect = 4.034e-37
Identity = 64/83 (77.11%), Postives = 74/83 (89.16%), Query Frame = 2
Query: 1052 GVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQ 1300
            G  S+   MR++LKRKLQRNRTSF+ +Q+++LEKEFERTHYPDVFARE+LA KI LPEARIQVWFSNRRAKWRREEKLR QR+
Sbjct:  192 GEDSDEAQMRLQLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEKLRNQRR 274          
BLAST of Pax6A vs. Ensembl Xenopus
Match: pax6 (paired box 6 [Source:NCBI gene;Acc:448447])

HSP 1 Score: 265.388 bits (677), Expect = 3.812e-81
Identity = 125/150 (83.33%), Postives = 137/150 (91.33%), Query Frame = 2
Query:  299 HSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAATGMYDKLSLLSGQ 748
            HSG+NQLGG+FVNGRPLPDSTRQ+IVELAHSGARPCDISRILQVSNGCVSKIL RYYETGSIRP+AIGGSKPRVAT  VVSKIA YKRECPSIF+WEIRDRLL EGVC  DNIPSVSSINRVLR+L++E Q+  + A GMYDKL +L+GQ
Sbjct:   24 HSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVSKIAQYKRECPSIFAWEIRDRLLSEGVCTNDNIPSVSSINRVLRNLASEKQQ--MGADGMYDKLRMLNGQ 171          

HSP 2 Score: 144.821 bits (364), Expect = 8.127e-37
Identity = 64/83 (77.11%), Postives = 74/83 (89.16%), Query Frame = 2
Query: 1052 GVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQ 1300
            G  S+   MR++LKRKLQRNRTSF+ +Q+++LEKEFERTHYPDVFARE+LA KI LPEARIQVWFSNRRAKWRREEKLR QR+
Sbjct:  215 GEDSDEAQMRLQLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEKLRNQRR 297          
BLAST of Pax6A vs. Ensembl Xenopus
Match: pax6 (paired box 6 [Source:NCBI gene;Acc:448447])

HSP 1 Score: 261.536 bits (667), Expect = 8.503e-80
Identity = 123/148 (83.11%), Postives = 135/148 (91.22%), Query Frame = 2
Query:  305 GINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAATGMYDKLSLLSGQ 748
            G+NQLGG+FVNGRPLPDSTRQ+IVELAHSGARPCDISRILQVSNGCVSKIL RYYETGSIRP+AIGGSKPRVAT  VVSKIA YKRECPSIF+WEIRDRLL EGVC  DNIPSVSSINRVLR+L++E Q+  + A GMYDKL +L+GQ
Sbjct:   15 GVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVSKIAQYKRECPSIFAWEIRDRLLSEGVCTNDNIPSVSSINRVLRNLASEKQQ--MGADGMYDKLRMLNGQ 160          

HSP 2 Score: 145.206 bits (365), Expect = 5.138e-37
Identity = 64/83 (77.11%), Postives = 74/83 (89.16%), Query Frame = 2
Query: 1052 GVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQ 1300
            G  S+   MR++LKRKLQRNRTSF+ +Q+++LEKEFERTHYPDVFARE+LA KI LPEARIQVWFSNRRAKWRREEKLR QR+
Sbjct:  204 GEDSDEAQMRLQLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEKLRNQRR 286          
BLAST of Pax6A vs. Ensembl Mouse
Match: Pax6 (paired box 6 [Source:MGI Symbol;Acc:MGI:97490])

HSP 1 Score: 266.159 bits (679), Expect = 7.746e-82
Identity = 125/150 (83.33%), Postives = 137/150 (91.33%), Query Frame = 2
Query:  299 HSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAATGMYDKLSLLSGQ 748
            HSG+NQLGG+FVNGRPLPDSTRQ+IVELAHSGARPCDISRILQVSNGCVSKIL RYYETGSIRP+AIGGSKPRVAT  VVSKIA YKRECPSIF+WEIRDRLL EGVC  DNIPSVSSINRVLR+L++E Q+  + A GMYDKL +L+GQ
Sbjct:    5 HSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVSKIAQYKRECPSIFAWEIRDRLLSEGVCTNDNIPSVSSINRVLRNLASEKQQ--MGADGMYDKLRMLNGQ 152          

HSP 2 Score: 145.206 bits (365), Expect = 3.106e-37
Identity = 64/83 (77.11%), Postives = 74/83 (89.16%), Query Frame = 2
Query: 1052 GVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQ 1300
            G  S+   MR++LKRKLQRNRTSF+ +Q+++LEKEFERTHYPDVFARE+LA KI LPEARIQVWFSNRRAKWRREEKLR QR+
Sbjct:  194 GEDSDEAQMRLQLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEKLRNQRR 276          
BLAST of Pax6A vs. Ensembl Mouse
Match: Pax6 (paired box 6 [Source:MGI Symbol;Acc:MGI:97490])

HSP 1 Score: 266.159 bits (679), Expect = 7.746e-82
Identity = 125/150 (83.33%), Postives = 137/150 (91.33%), Query Frame = 2
Query:  299 HSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAATGMYDKLSLLSGQ 748
            HSG+NQLGG+FVNGRPLPDSTRQ+IVELAHSGARPCDISRILQVSNGCVSKIL RYYETGSIRP+AIGGSKPRVAT  VVSKIA YKRECPSIF+WEIRDRLL EGVC  DNIPSVSSINRVLR+L++E Q+  + A GMYDKL +L+GQ
Sbjct:    5 HSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVSKIAQYKRECPSIFAWEIRDRLLSEGVCTNDNIPSVSSINRVLRNLASEKQQ--MGADGMYDKLRMLNGQ 152          

HSP 2 Score: 145.206 bits (365), Expect = 3.106e-37
Identity = 64/83 (77.11%), Postives = 74/83 (89.16%), Query Frame = 2
Query: 1052 GVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQ 1300
            G  S+   MR++LKRKLQRNRTSF+ +Q+++LEKEFERTHYPDVFARE+LA KI LPEARIQVWFSNRRAKWRREEKLR QR+
Sbjct:  194 GEDSDEAQMRLQLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEKLRNQRR 276          
BLAST of Pax6A vs. Ensembl Mouse
Match: Pax6 (paired box 6 [Source:MGI Symbol;Acc:MGI:97490])

HSP 1 Score: 266.159 bits (679), Expect = 7.746e-82
Identity = 125/150 (83.33%), Postives = 137/150 (91.33%), Query Frame = 2
Query:  299 HSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAATGMYDKLSLLSGQ 748
            HSG+NQLGG+FVNGRPLPDSTRQ+IVELAHSGARPCDISRILQVSNGCVSKIL RYYETGSIRP+AIGGSKPRVAT  VVSKIA YKRECPSIF+WEIRDRLL EGVC  DNIPSVSSINRVLR+L++E Q+  + A GMYDKL +L+GQ
Sbjct:    5 HSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVSKIAQYKRECPSIFAWEIRDRLLSEGVCTNDNIPSVSSINRVLRNLASEKQQ--MGADGMYDKLRMLNGQ 152          

HSP 2 Score: 145.206 bits (365), Expect = 3.106e-37
Identity = 64/83 (77.11%), Postives = 74/83 (89.16%), Query Frame = 2
Query: 1052 GVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQ 1300
            G  S+   MR++LKRKLQRNRTSF+ +Q+++LEKEFERTHYPDVFARE+LA KI LPEARIQVWFSNRRAKWRREEKLR QR+
Sbjct:  194 GEDSDEAQMRLQLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEKLRNQRR 276          
BLAST of Pax6A vs. Ensembl Mouse
Match: Pax6 (paired box 6 [Source:MGI Symbol;Acc:MGI:97490])

HSP 1 Score: 266.159 bits (679), Expect = 7.746e-82
Identity = 125/150 (83.33%), Postives = 137/150 (91.33%), Query Frame = 2
Query:  299 HSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAATGMYDKLSLLSGQ 748
            HSG+NQLGG+FVNGRPLPDSTRQ+IVELAHSGARPCDISRILQVSNGCVSKIL RYYETGSIRP+AIGGSKPRVAT  VVSKIA YKRECPSIF+WEIRDRLL EGVC  DNIPSVSSINRVLR+L++E Q+  + A GMYDKL +L+GQ
Sbjct:    5 HSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVSKIAQYKRECPSIFAWEIRDRLLSEGVCTNDNIPSVSSINRVLRNLASEKQQ--MGADGMYDKLRMLNGQ 152          

HSP 2 Score: 145.206 bits (365), Expect = 3.106e-37
Identity = 64/83 (77.11%), Postives = 74/83 (89.16%), Query Frame = 2
Query: 1052 GVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQ 1300
            G  S+   MR++LKRKLQRNRTSF+ +Q+++LEKEFERTHYPDVFARE+LA KI LPEARIQVWFSNRRAKWRREEKLR QR+
Sbjct:  194 GEDSDEAQMRLQLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEKLRNQRR 276          
BLAST of Pax6A vs. Ensembl Mouse
Match: Pax6 (paired box 6 [Source:MGI Symbol;Acc:MGI:97490])

HSP 1 Score: 256.914 bits (655), Expect = 4.021e-78
Identity = 125/164 (76.22%), Postives = 137/164 (83.54%), Query Frame = 2
Query:  299 HSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQ--------------VSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAATGMYDKLSLLSGQ 748
            HSG+NQLGG+FVNGRPLPDSTRQ+IVELAHSGARPCDISRILQ              VSNGCVSKIL RYYETGSIRP+AIGGSKPRVAT  VVSKIA YKRECPSIF+WEIRDRLL EGVC  DNIPSVSSINRVLR+L++E Q+  + A GMYDKL +L+GQ
Sbjct:    5 HSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQTHADAKVQVLDNENVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVSKIAQYKRECPSIFAWEIRDRLLSEGVCTNDNIPSVSSINRVLRNLASEKQQ--MGADGMYDKLRMLNGQ 166          

HSP 2 Score: 145.206 bits (365), Expect = 3.898e-37
Identity = 64/83 (77.11%), Postives = 74/83 (89.16%), Query Frame = 2
Query: 1052 GVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQ 1300
            G  S+   MR++LKRKLQRNRTSF+ +Q+++LEKEFERTHYPDVFARE+LA KI LPEARIQVWFSNRRAKWRREEKLR QR+
Sbjct:  208 GEDSDEAQMRLQLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEKLRNQRR 290          
BLAST of Pax6A vs. UniProt
Match: sp|P63016|PAX6_RAT (Paired box protein Pax-6 OS=Rattus norvegicus OX=10116 GN=Pax6 PE=2 SV=1)

HSP 1 Score: 266.159 bits (679), Expect = 4.624e-81
Identity = 125/150 (83.33%), Postives = 137/150 (91.33%), Query Frame = 2
Query:  299 HSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAATGMYDKLSLLSGQ 748
            HSG+NQLGG+FVNGRPLPDSTRQ+IVELAHSGARPCDISRILQVSNGCVSKIL RYYETGSIRP+AIGGSKPRVAT  VVSKIA YKRECPSIF+WEIRDRLL EGVC  DNIPSVSSINRVLR+L++E Q+  + A GMYDKL +L+GQ
Sbjct:    5 HSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVSKIAQYKRECPSIFAWEIRDRLLSEGVCTNDNIPSVSSINRVLRNLASEKQQ--MGADGMYDKLRMLNGQ 152          

HSP 2 Score: 145.206 bits (365), Expect = 2.237e-36
Identity = 64/83 (77.11%), Postives = 74/83 (89.16%), Query Frame = 2
Query: 1052 GVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQ 1300
            G  S+   MR++LKRKLQRNRTSF+ +Q+++LEKEFERTHYPDVFARE+LA KI LPEARIQVWFSNRRAKWRREEKLR QR+
Sbjct:  194 GEDSDEAQMRLQLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEKLRNQRR 276          
BLAST of Pax6A vs. UniProt
Match: sp|Q1LZF1|PAX6_BOVIN (Paired box protein Pax-6 OS=Bos taurus OX=9913 GN=PAX6 PE=2 SV=1)

HSP 1 Score: 266.159 bits (679), Expect = 4.979e-81
Identity = 125/150 (83.33%), Postives = 137/150 (91.33%), Query Frame = 2
Query:  299 HSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAATGMYDKLSLLSGQ 748
            HSG+NQLGG+FVNGRPLPDSTRQ+IVELAHSGARPCDISRILQVSNGCVSKIL RYYETGSIRP+AIGGSKPRVAT  VVSKIA YKRECPSIF+WEIRDRLL EGVC  DNIPSVSSINRVLR+L++E Q+  + A GMYDKL +L+GQ
Sbjct:    5 HSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVSKIAQYKRECPSIFAWEIRDRLLSEGVCTNDNIPSVSSINRVLRNLASEKQQ--MGADGMYDKLRMLNGQ 152          

HSP 2 Score: 145.206 bits (365), Expect = 2.131e-36
Identity = 64/83 (77.11%), Postives = 74/83 (89.16%), Query Frame = 2
Query: 1052 GVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQ 1300
            G  S+   MR++LKRKLQRNRTSF+ +Q+++LEKEFERTHYPDVFARE+LA KI LPEARIQVWFSNRRAKWRREEKLR QR+
Sbjct:  194 GEDSDEAQMRLQLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEKLRNQRR 276          
BLAST of Pax6A vs. UniProt
Match: sp|P63015|PAX6_MOUSE (Paired box protein Pax-6 OS=Mus musculus OX=10090 GN=Pax6 PE=1 SV=1)

HSP 1 Score: 266.159 bits (679), Expect = 5.418e-81
Identity = 125/150 (83.33%), Postives = 137/150 (91.33%), Query Frame = 2
Query:  299 HSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAATGMYDKLSLLSGQ 748
            HSG+NQLGG+FVNGRPLPDSTRQ+IVELAHSGARPCDISRILQVSNGCVSKIL RYYETGSIRP+AIGGSKPRVAT  VVSKIA YKRECPSIF+WEIRDRLL EGVC  DNIPSVSSINRVLR+L++E Q+  + A GMYDKL +L+GQ
Sbjct:    5 HSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVSKIAQYKRECPSIFAWEIRDRLLSEGVCTNDNIPSVSSINRVLRNLASEKQQ--MGADGMYDKLRMLNGQ 152          

HSP 2 Score: 145.206 bits (365), Expect = 2.173e-36
Identity = 64/83 (77.11%), Postives = 74/83 (89.16%), Query Frame = 2
Query: 1052 GVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQ 1300
            G  S+   MR++LKRKLQRNRTSF+ +Q+++LEKEFERTHYPDVFARE+LA KI LPEARIQVWFSNRRAKWRREEKLR QR+
Sbjct:  194 GEDSDEAQMRLQLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEKLRNQRR 276          
BLAST of Pax6A vs. UniProt
Match: sp|P26367|PAX6_HUMAN (Paired box protein Pax-6 OS=Homo sapiens OX=9606 GN=PAX6 PE=1 SV=2)

HSP 1 Score: 266.159 bits (679), Expect = 5.418e-81
Identity = 125/150 (83.33%), Postives = 137/150 (91.33%), Query Frame = 2
Query:  299 HSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAATGMYDKLSLLSGQ 748
            HSG+NQLGG+FVNGRPLPDSTRQ+IVELAHSGARPCDISRILQVSNGCVSKIL RYYETGSIRP+AIGGSKPRVAT  VVSKIA YKRECPSIF+WEIRDRLL EGVC  DNIPSVSSINRVLR+L++E Q+  + A GMYDKL +L+GQ
Sbjct:    5 HSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVSKIAQYKRECPSIFAWEIRDRLLSEGVCTNDNIPSVSSINRVLRNLASEKQQ--MGADGMYDKLRMLNGQ 152          

HSP 2 Score: 145.206 bits (365), Expect = 2.173e-36
Identity = 64/83 (77.11%), Postives = 74/83 (89.16%), Query Frame = 2
Query: 1052 GVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQ 1300
            G  S+   MR++LKRKLQRNRTSF+ +Q+++LEKEFERTHYPDVFARE+LA KI LPEARIQVWFSNRRAKWRREEKLR QR+
Sbjct:  194 GEDSDEAQMRLQLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEKLRNQRR 276          
BLAST of Pax6A vs. UniProt
Match: sp|P47238|PAX6_COTJA (Paired box protein Pax-6 OS=Coturnix japonica OX=93934 GN=PAX6 PE=2 SV=1)

HSP 1 Score: 265.774 bits (678), Expect = 5.932e-81
Identity = 125/150 (83.33%), Postives = 137/150 (91.33%), Query Frame = 2
Query:  299 HSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAATGMYDKLSLLSGQ 748
            HSG+NQLGG+FVNGRPLPDSTRQ+IVELAHSGARPCDISRILQVSNGCVSKIL RYYETGSIRP+AIGGSKPRVAT  VVSKIA YKRECPSIF+WEIRDRLL EGVC  DNIPSVSSINRVLR+L++E Q+  + A GMYDKL +L+GQ
Sbjct:    5 HSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVSKIAQYKRECPSIFAWEIRDRLLSEGVCTNDNIPSVSSINRVLRNLASEKQQ--MGADGMYDKLRMLNGQ 152          

HSP 2 Score: 145.206 bits (365), Expect = 2.106e-36
Identity = 64/83 (77.11%), Postives = 74/83 (89.16%), Query Frame = 2
Query: 1052 GVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQ 1300
            G  S+   MR++LKRKLQRNRTSF+ +Q+++LEKEFERTHYPDVFARE+LA KI LPEARIQVWFSNRRAKWRREEKLR QR+
Sbjct:  194 GEDSDEAQMRLQLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEKLRNQRR 276          
BLAST of Pax6A vs. TrEMBL
Match: gnl|BL_ORD_ID|20306371 (tr|I1ZI92|I1ZI92_SCHMD Pax6A OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 1053.89 bits (2724), Expect = 0.000e+0
Identity = 553/553 (100.00%), Postives = 553/553 (100.00%), Query Frame = 2
Query:  236 SKPMTXXXXXXXXXXXXXXRGHSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAATGMYDKLSLLSGQPXXXXXXXXXXXXXXXXXXXXXXXXFPNCGAYGGLTGIGIINGMSTAHAVASINQSNSGVTNYHVQSTTDSSDKHKSEKYSESIAHSESNASSEPGNEYMSGVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQNLMLGSNGTSSTADTNVTTNGNTQCLSTTGQNSMGFSGINDIRNQFGDVGMQTPSLSAVAAAGMYHSAVASAADQYAKSAGLPNLSQSSINSPYSYMANLQSRSSGSQIDLPNVTSNSNSFYNPGSVYPPSLFQGVMRGYDTIGYPKYPSAMFPGSLESNNNINPAGFLANNMSSNSSKPDYDFSAFNRPSNYWTPVA 1894
            SKPMTESNEEEIKNKKKVKRGHSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAATGMYDKLSLLSGQPWSTAAAHAAWYSSAAAAHGYASSTFPNCGAYGGLTGIGIINGMSTAHAVASINQSNSGVTNYHVQSTTDSSDKHKSEKYSESIAHSESNASSEPGNEYMSGVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQNLMLGSNGTSSTADTNVTTNGNTQCLSTTGQNSMGFSGINDIRNQFGDVGMQTPSLSAVAAAGMYHSAVASAADQYAKSAGLPNLSQSSINSPYSYMANLQSRSSGSQIDLPNVTSNSNSFYNPGSVYPPSLFQGVMRGYDTIGYPKYPSAMFPGSLESNNNINPAGFLANNMSSNSSKPDYDFSAFNRPSNYWTPVA
Sbjct:   12 SKPMTESNEEEIKNKKKVKRGHSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAATGMYDKLSLLSGQPWSTAAAHAAWYSSAAAAHGYASSTFPNCGAYGGLTGIGIINGMSTAHAVASINQSNSGVTNYHVQSTTDSSDKHKSEKYSESIAHSESNASSEPGNEYMSGVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQNLMLGSNGTSSTADTNVTTNGNTQCLSTTGQNSMGFSGINDIRNQFGDVGMQTPSLSAVAAAGMYHSAVASAADQYAKSAGLPNLSQSSINSPYSYMANLQSRSSGSQIDLPNVTSNSNSFYNPGSVYPPSLFQGVMRGYDTIGYPKYPSAMFPGSLESNNNINPAGFLANNMSSNSSKPDYDFSAFNRPSNYWTPVA 564          
BLAST of Pax6A vs. TrEMBL
Match: gnl|BL_ORD_ID|19625282 (tr|O97038|O97038_DUGJA DjPax-6 OS=Dugesia japonica OX=6161 GN=DjPax-6 PE=2 SV=1)

HSP 1 Score: 1025.77 bits (2651), Expect = 0.000e+0
Identity = 523/534 (97.94%), Postives = 529/534 (99.06%), Query Frame = 2
Query:  293 RGHSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAATGMYDKLSLLSGQPXXXXXXXXXXXXXXXXXXXXXXXXFPNCGAYGGLTGIGIINGMSTAHAVASINQSNSGVTNYHVQSTTDSSDKHKSEKYSESIAHSESNASSEPGNEYMSGVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQNLMLGSNGTSSTADTNVTTNGNTQCLSTTGQNSMGFSGINDIRNQFGDVGMQTPSLSAVAAAGMYHSAVASAADQYAKSAGLPNLSQSSINSPYSYMANLQSRSSGSQIDLPNVTSNSNSFYNPGSVYPPSLFQGVMRGYDTIGYPKYPSAMFPGSLESNNNINPAGFLANNMSSNSSKPDYDFSAFNRPSNYWTPVA 1894
            RGHSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAATGMYDKLSLLSGQPWSTAAAHAAWYSSAAAAHGYASSTFPNCGAYGGLTGIGIINGMSTAHAVASINQSNSGV NYHVQSTTDSSDK KSEKYSESIAHSESNASSEPGNEYMSGVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQNLMLGS+GTSSTA+TNVTTNGNTQCLSTTGQNSMGFSGI DIRNQFGDVGMQTPSLSAVAAAGMYHSAVASAADQYAKSAGLPNLSQSSINSPYSYMANLQSRSSGSQIDLPNVTSNSNSFYNPGSVYPPSLFQGVMRGYDTIGYPKYP+AMFPGSLESN+NIN AGFLANNMS+NS+KPDYDFSAFNR SNYWTPVA
Sbjct:   17 RGHSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAATGMYDKLSLLSGQPWSTAAAHAAWYSSAAAAHGYASSTFPNCGAYGGLTGIGIINGMSTAHAVASINQSNSGVNNYHVQSTTDSSDKLKSEKYSESIAHSESNASSEPGNEYMSGVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQNLMLGSSGTSSTAETNVTTNGNTQCLSTTGQNSMGFSGIADIRNQFGDVGMQTPSLSAVAAAGMYHSAVASAADQYAKSAGLPNLSQSSINSPYSYMANLQSRSSGSQIDLPNVTSNSNSFYNPGSVYPPSLFQGVMRGYDTIGYPKYPTAMFPGSLESNSNINAAGFLANNMSTNSAKPDYDFSAFNRTSNYWTPVA 550          
BLAST of Pax6A vs. TrEMBL
Match: gnl|BL_ORD_ID|22483269 (tr|Q95UT4|Q95UT4_GIRTI Pax6A (Fragment) OS=Girardia tigrina OX=6162 PE=2 SV=1)

HSP 1 Score: 869.381 bits (2245), Expect = 0.000e+0
Identity = 445/464 (95.91%), Postives = 455/464 (98.06%), Query Frame = 2
Query:  437 GCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAATGMYDKLSLLSGQPXXXXXXXXXXXXXXXXXXXXXXXXFPNCGAYGGLTGIGIINGMSTAHAVASINQSNSGVTNYHVQSTTDSSDKHKSEKYSESIAHSESNASSEPGNEYMSGVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQNLMLGSNGTSSTADTNVTTNGNTQCLSTTGQNSMGFSGINDIRNQFGDVGMQTPSLSAVAAAGMYHSAVASAADQYAKSAGLPNLSQSSINSPYSYMANLQSRSSGSQIDLPNVTSNSNSFYNPGSVYPPSLFQGVMRGYDTIGYPKYPSAMFPGSLESNNNINPAGFLANNMSSN 1828
            GCVSKILCRYYETGSIRPKAIGGSKP VATSSVVSK AAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAATGMYDKLSLLSGQPWSTAAAHAAWYS AAAAHGYASSTFPNCGAYGGLTGIGIINGMSTAHAVASINQSNSGV NYHVQST DSS KHKSEKYSESIAHSESNASSEPGNEY+SGVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQNLMLGS+GTSSTA+TNVTTNGNTQCLSTTGQ+SMGF+GINDIRNQFGDVGMQTPSLSAVAAAGMYHS VASAADQYAKSAGLPNLSQSSINSPYSYMANLQSRS+GSQIDLPNV+SNSNSFYNPGSVYPPSLFQGVMRGYDTIGYPKYP+AMF GSLE+NNNIN AGFLANNMS+N
Sbjct:    1 GCVSKILCRYYETGSIRPKAIGGSKPTVATSSVVSKTAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAATGMYDKLSLLSGQPWSTAAAHAAWYSCAAAAHGYASSTFPNCGAYGGLTGIGIINGMSTAHAVASINQSNSGVNNYHVQSTADSSGKHKSEKYSESIAHSESNASSEPGNEYLSGVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQNLMLGSSGTSSTAETNVTTNGNTQCLSTTGQSSMGFTGINDIRNQFGDVGMQTPSLSAVAAAGMYHSVVASAADQYAKSAGLPNLSQSSINSPYSYMANLQSRSNGSQIDLPNVSSNSNSFYNPGSVYPPSLFQGVMRGYDTIGYPKYPTAMFRGSLETNNNINTAGFLANNMSTN 464          
BLAST of Pax6A vs. TrEMBL
Match: gnl|BL_ORD_ID|20932711 (tr|H6V052|H6V052_SCHPL PAX6 (Fragment) OS=Schmidtea polychroa OX=50054 GN=pax6 PE=2 SV=1)

HSP 1 Score: 619.387 bits (1596), Expect = 0.000e+0
Identity = 326/326 (100.00%), Postives = 326/326 (100.00%), Query Frame = 2
Query:  503 GSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAATGMYDKLSLLSGQPXXXXXXXXXXXXXXXXXXXXXXXXFPNCGAYGGLTGIGIINGMSTAHAVASINQSNSGVTNYHVQSTTDSSDKHKSEKYSESIAHSESNASSEPGNEYMSGVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQNLMLGSNGTSSTADTNVTTNGNTQCLSTTGQNSMGFSGINDIRNQFGDVGMQTPSLSAVA 1480
            GSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAATGMYDKLSLLSGQPWSTAAAHAAWYSSAAAAHGYASSTFPNCGAYGGLTGIGIINGMSTAHAVASINQSNSGVTNYHVQSTTDSSDKHKSEKYSESIAHSESNASSEPGNEYMSGVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQNLMLGSNGTSSTADTNVTTNGNTQCLSTTGQNSMGFSGINDIRNQFGDVGMQTPSLSAVA
Sbjct:    1 GSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAATGMYDKLSLLSGQPWSTAAAHAAWYSSAAAAHGYASSTFPNCGAYGGLTGIGIINGMSTAHAVASINQSNSGVTNYHVQSTTDSSDKHKSEKYSESIAHSESNASSEPGNEYMSGVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQNLMLGSNGTSSTADTNVTTNGNTQCLSTTGQNSMGFSGINDIRNQFGDVGMQTPSLSAVA 326          
BLAST of Pax6A vs. TrEMBL
Match: gnl|BL_ORD_ID|23073508 (tr|T1E1D9|T1E1D9_9PLAT Pax6A (Fragment) OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 573.548 bits (1477), Expect = 0.000e+0
Identity = 291/344 (84.59%), Postives = 315/344 (91.57%), Query Frame = 2
Query:  293 RGHSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAATGMYDKLSLLSGQPXXXXXXXXXXXXXXXXXXXX-XXXXFPNCGAYGGLTGIGIINGMSTAHAVASINQSNSGVTNYHVQSTTDSSDKHKSEKYSESIAHSESNASSEPGNEYMSGVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQNLMLGSN 1321
            RGHSG+NQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVV+KIA YKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNEN R L AATGMYDKLSLLSGQPWS+AAA  A + S+AAA    ASSTFPNCG YG LTGIGIINGM++AHAVAS+NQSNS + NY +Q++ +S    +  K + S++ SESNASSE G++YMSG+K ENDDMR+KLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKI+LPEARIQVWFSNRRAKWRREEKLRRQRQNLM+G+N
Sbjct:   17 RGHSGVNQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVAKIAGYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENHRQLAAATGMYDKLSLLSGQPWSSAAAAHAAWYSSAAAAHGYASSTFPNCGTYGSLTGIGIINGMNSAHAVASMNQSNSSINNYQLQTSAES----EKPKSAGSVSQSESNASSENGHDYMSGLKGENDDMRVKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKITLPEARIQVWFSNRRAKWRREEKLRRQRQNLMIGNN 356          
BLAST of Pax6A vs. Ensembl Cavefish
Match: pax6a (paired box 6 [Source:NCBI gene;Acc:103044317])

HSP 1 Score: 262.692 bits (670), Expect = 1.200e-80
Identity = 122/151 (80.79%), Postives = 137/151 (90.73%), Query Frame = 2
Query:  296 GHSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAATGMYDKLSLLSGQ 748
            GHSG+NQLGG+FVNGRPLPDSTRQ+IVELAHSGARPCDISRILQVSNGCVSKIL RYYETGSIRP+AIGGSKPRVAT  VV KIA +KRECPSIF+WEIRDRLL EG+C  DNIPSVSSINRVLR+L++E Q+  + A GMY+KL +L+GQ
Sbjct:   13 GHSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVGKIAQFKRECPSIFAWEIRDRLLSEGICTNDNIPSVSSINRVLRNLASEKQQ--MGADGMYEKLRMLNGQ 161          

HSP 2 Score: 146.362 bits (368), Expect = 9.556e-38
Identity = 65/83 (78.31%), Postives = 74/83 (89.16%), Query Frame = 2
Query: 1052 GVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQ 1300
            G  SE   MR++LKRKLQRNRTSF+ +Q+++LEKEFERTHYPDVFARE+LA KI LPEARIQVWFSNRRAKWRREEKLR QR+
Sbjct:  203 GEDSEEAQMRLQLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEKLRNQRR 285          
BLAST of Pax6A vs. Ensembl Cavefish
Match: pax6a (paired box 6 [Source:NCBI gene;Acc:103044317])

HSP 1 Score: 263.077 bits (671), Expect = 1.501e-80
Identity = 122/151 (80.79%), Postives = 137/151 (90.73%), Query Frame = 2
Query:  296 GHSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAATGMYDKLSLLSGQ 748
            GHSG+NQLGG+FVNGRPLPDSTRQ+IVELAHSGARPCDISRILQVSNGCVSKIL RYYETGSIRP+AIGGSKPRVAT  VV KIA +KRECPSIF+WEIRDRLL EG+C  DNIPSVSSINRVLR+L++E Q+  + A GMY+KL +L+GQ
Sbjct:   31 GHSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVGKIAQFKRECPSIFAWEIRDRLLSEGICTNDNIPSVSSINRVLRNLASEKQQ--MGADGMYEKLRMLNGQ 179          

HSP 2 Score: 146.362 bits (368), Expect = 1.320e-37
Identity = 65/83 (78.31%), Postives = 74/83 (89.16%), Query Frame = 2
Query: 1052 GVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQ 1300
            G  SE   MR++LKRKLQRNRTSF+ +Q+++LEKEFERTHYPDVFARE+LA KI LPEARIQVWFSNRRAKWRREEKLR QR+
Sbjct:  221 GEDSEEAQMRLQLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEKLRNQRR 303          
BLAST of Pax6A vs. Ensembl Cavefish
Match: pax6b (paired box 6b [Source:ZFIN;Acc:ZDB-GENE-001031-1])

HSP 1 Score: 257.684 bits (657), Expect = 7.393e-79
Identity = 120/150 (80.00%), Postives = 135/150 (90.00%), Query Frame = 2
Query:  299 HSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAATGMYDKLSLLSGQ 748
            HSG+NQLGG+FVNGRPLPD+TRQ+IVELAHSGARPCDISRILQVSNGCVSKIL RYYETGSIRP+AIGGSKPRVAT  VV KIA YK ECPSIF+WEIRDRLL EG+C+ DNIPSVSSINRVLR+L++E Q+  V   G+YDKL +L+GQ
Sbjct:    5 HSGVNQLGGVFVNGRPLPDTTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVGKIAQYKHECPSIFAWEIRDRLLSEGICSNDNIPSVSSINRVLRNLASEKQQ--VGVDGVYDKLRMLNGQ 152          

HSP 2 Score: 141.739 bits (356), Expect = 3.063e-36
Identity = 66/102 (64.71%), Postives = 81/102 (79.41%), Query Frame = 2
Query: 1052 GVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQNLMLGSNGTSSTADTNVTT 1357
            G   +   +R++LKRKLQRNRTSF+ +Q+++LEKEFERTHYPDVFARE+LA KI LPEARIQVWFSNRRAKWRREEKLR QR+   + SN +     +N +T
Sbjct:  194 GEDLDETQIRLQLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEKLRNQRRQ--VSSNSSHVPVSSNFST 293          
BLAST of Pax6A vs. Ensembl Cavefish
Match: pax6a (paired box 6 [Source:NCBI gene;Acc:103044317])

HSP 1 Score: 253.447 bits (646), Expect = 9.503e-77
Identity = 122/165 (73.94%), Postives = 137/165 (83.03%), Query Frame = 2
Query:  296 GHSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQ--------------VSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAATGMYDKLSLLSGQ 748
            GHSG+NQLGG+FVNGRPLPDSTRQ+IVELAHSGARPCDISRILQ              VSNGCVSKIL RYYETGSIRP+AIGGSKPRVAT  VV KIA +KRECPSIF+WEIRDRLL EG+C  DNIPSVSSINRVLR+L++E Q+  + A GMY+KL +L+GQ
Sbjct:   31 GHSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQTQADAKVQVLDNENVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVGKIAQFKRECPSIFAWEIRDRLLSEGICTNDNIPSVSSINRVLRNLASEKQQ--MGADGMYEKLRMLNGQ 193          

HSP 2 Score: 146.362 bits (368), Expect = 1.887e-37
Identity = 65/83 (78.31%), Postives = 74/83 (89.16%), Query Frame = 2
Query: 1052 GVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQ 1300
            G  SE   MR++LKRKLQRNRTSF+ +Q+++LEKEFERTHYPDVFARE+LA KI LPEARIQVWFSNRRAKWRREEKLR QR+
Sbjct:  235 GEDSEEAQMRLQLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEKLRNQRR 317          
BLAST of Pax6A vs. Ensembl Cavefish
Match: pax6a (paired box 6 [Source:NCBI gene;Acc:103044317])

HSP 1 Score: 253.447 bits (646), Expect = 9.503e-77
Identity = 122/165 (73.94%), Postives = 137/165 (83.03%), Query Frame = 2
Query:  296 GHSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQ--------------VSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAATGMYDKLSLLSGQ 748
            GHSG+NQLGG+FVNGRPLPDSTRQ+IVELAHSGARPCDISRILQ              VSNGCVSKIL RYYETGSIRP+AIGGSKPRVAT  VV KIA +KRECPSIF+WEIRDRLL EG+C  DNIPSVSSINRVLR+L++E Q+  + A GMY+KL +L+GQ
Sbjct:   31 GHSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQTQADAKVQVLDNENVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVGKIAQFKRECPSIFAWEIRDRLLSEGICTNDNIPSVSSINRVLRNLASEKQQ--MGADGMYEKLRMLNGQ 193          

HSP 2 Score: 146.362 bits (368), Expect = 1.887e-37
Identity = 65/83 (78.31%), Postives = 74/83 (89.16%), Query Frame = 2
Query: 1052 GVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQ 1300
            G  SE   MR++LKRKLQRNRTSF+ +Q+++LEKEFERTHYPDVFARE+LA KI LPEARIQVWFSNRRAKWRREEKLR QR+
Sbjct:  235 GEDSEEAQMRLQLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEKLRNQRR 317          
BLAST of Pax6A vs. Ensembl Sea Lamprey
Match: pax9 (paired box 9 [Source:ZFIN;Acc:ZDB-GENE-980526-399])

HSP 1 Score: 178.333 bits (451), Expect = 3.329e-52
Identity = 87/140 (62.14%), Postives = 110/140 (78.57%), Query Frame = 2
Query:  308 INQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRS-LSNENQRHLVAATGMYD 724
            +NQLGG+FVNGRPLP++ R RIVE+A  G RPCDISR L+VS+GCVSKIL RY ETGSI P AIGGSKPRV T +VV+ I  YK+  P IF+WEIRD+LL +GVC++ N+PSVSSI+R+LR+ + N +Q     ++  YD
Sbjct:    7 VNQLGGVFVNGRPLPNAIRLRIVEMAQLGIRPCDISRQLRVSHGCVSKILARYNETGSILPGAIGGSKPRVTTPNVVNHIRTYKQRDPGIFAWEIRDKLLADGVCDKYNVPSVSSISRILRNKIGNLSQPPNAGSSSHYD 146          
BLAST of Pax6A vs. Ensembl Sea Lamprey
Match: pax1a (paired box 1a [Source:ZFIN;Acc:ZDB-GENE-070112-182])

HSP 1 Score: 174.866 bits (442), Expect = 1.064e-49
Identity = 85/121 (70.25%), Postives = 99/121 (81.82%), Query Frame = 2
Query:  308 INQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLR 670
            +NQLGG+FVNGRPLP+  R RIVELA  G RPCDISR L+VS+GCVSKIL RY ETGSI P AIGGSKPRV T +VV  I  YK+  P IF+WEIRDRLL +GVC++ N+PSVSSI+R+LR
Sbjct:   68 VNQLGGVFVNGRPLPNPIRLRIVELAQLGIRPCDISRQLRVSHGCVSKILARYNETGSILPGAIGGSKPRVTTPNVVKHIRDYKQRDPGIFAWEIRDRLLADGVCDKYNVPSVSSISRILR 188          
BLAST of Pax6A vs. Ensembl Sea Lamprey
Match: dmbx1b (diencephalon/mesencephalon homeobox 1b [Source:NCBI gene;Acc:550288])

HSP 1 Score: 87.8113 bits (216), Expect = 4.868e-19
Identity = 35/60 (58.33%), Postives = 51/60 (85.00%), Query Frame = 2
Query: 1103 QRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEK 1282
            +R+RT+F+  QL++LEK F++THYPDV  RE+LA   +LPEAR+QVWF NRRAK+R++++
Sbjct:   44 RRSRTAFTAQQLEALEKTFQKTHYPDVVMRERLAMCTNLPEARVQVWFKNRRAKFRKKQR 103          
BLAST of Pax6A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010761.1 (pep scaffold:Pmarinus_7.0:GL476415:928307:936594:-1 gene:ENSPMAG00000009746.1 transcript:ENSPMAT00000010761.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 79.337 bits (194), Expect = 1.571e-18
Identity = 36/59 (61.02%), Postives = 46/59 (77.97%), Query Frame = 2
Query: 1094 RKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWR 1270
            RK +R RT+F+  QLD LE  F +T YPD+F RE++A KI+LPE+R+QVWF NRRAK R
Sbjct:    4 RKQRRERTTFTRAQLDVLEALFSKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCR 62          
BLAST of Pax6A vs. Ensembl Sea Lamprey
Match: otx5 (orthodenticle homolog 5 [Source:ZFIN;Acc:ZDB-GENE-030508-1])

HSP 1 Score: 64.6994 bits (156), Expect = 9.432e-12
Identity = 30/57 (52.63%), Postives = 41/57 (71.93%), Query Frame = 2
Query: 1094 RKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAK 1264
            RK +R RT+F+  QLD LE  F +T YPD+F RE++A KI+LPE+R+Q+ F   R K
Sbjct:   36 RKQRRERTTFTRAQLD-LESLFSKTRYPDIFMREEVALKINLPESRVQINFPESRVK 91          
BLAST of Pax6A vs. Ensembl Yeast
Match: PHO2 (Homeobox transcription factor; regulatory targets include genes involved in phosphate metabolism; binds cooperatively with Pho4p to the PHO5 promoter; phosphorylation of Pho2p facilitates interaction with Pho4p; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000002264])

HSP 1 Score: 54.6842 bits (130), Expect = 3.015e-8
Identity = 22/56 (39.29%), Postives = 37/56 (66.07%), Query Frame = 2
Query: 1112 RTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREE 1279
            RT    + LD L+++FE    P +  R+K++D I +PE  +++WF NRRAK R+++
Sbjct:   81 RTRAKGEALDVLKRKFEINPTPSLVERKKISDLIGMPEKNVRIWFQNRRAKLRKKQ 136          
BLAST of Pax6A vs. Ensembl Nematostella
Match: PAXB (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RN74])

HSP 1 Score: 288.115 bits (736), Expect = 1.555e-89
Identity = 163/351 (46.44%), Postives = 212/351 (60.40%), Query Frame = 2
Query:  293 RGHSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAATGMYDKLSLLSGQPXXXXXXXXXXXXXXXXXXXXXXXXFPNCGAYGGLTGIGIINGMSTAHAVASINQSNSGVTNYHVQSTTDSSDKHKSEKYSESIAHSESNASSEPGNEYMSGVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQR-----QNLMLGSNGTS 1330
            +GH G+NQLGG+FVNGRPLPD  RQRIVELA SG RPCDISR L+VS+GCVSKILCR+YETGSI+P  IGGSKP+VAT +VV+KIA YK   P++F+WEIRDRLL EGVC  DN+PSVSSINR++R+  N             DK+S   G P   +                     P   A      +  IN   ++++++ +     G+   H Q    +S   +  KYS   A S  + S + G+        + +  R K+ R   R RT+F+ +Q++ LEK FE+THYPDVF RE+LA +++L EARIQVW+SNRRAKWR+E K   Q      Q   + SNG S
Sbjct:    6 QGHGGVNQLGGVFVNGRPLPDVVRQRIVELAQSGVRPCDISRQLRVSHGCVSKILCRFYETGSIKPGVIGGSKPKVATGNVVTKIAEYKLANPTMFAWEIRDRLLSEGVCTSDNVPSVSSINRIVRNRINSQ-----------DKMSNPKGNPGDNS---------------------PMDMALKSDRDMQAINVPRSSYSISGL----LGIPMPHQQVAQHTSPSKR--KYSVDSADSTGSHSGDEGD--------DPNSQRSKMSR---RQRTNFTDEQIEKLEKVFEKTHYPDVFTREELAQQVNLSEARIQVWYSNRRAKWRKEGKDGPQDPQGPIQTTYISSNGYS 307          
BLAST of Pax6A vs. Ensembl Nematostella
Match: PAXC (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCC8])

HSP 1 Score: 199.519 bits (506), Expect = 7.716e-57
Identity = 93/153 (60.78%), Postives = 119/153 (77.78%), Query Frame = 2
Query:  293 RGHSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNE----------NQRHLVAATGMY 721
            +GH G+NQLGG FVNGRPLPD  R RI++LA  G RPC+ISR L VS+GCVSKIL RYYETGSIRP +IGGSKP+VAT  VV+KI  YK++ P+IF+WEIRDRL++EG+C++DN PSVSSINR+LR+ + E           ++HL +  G++
Sbjct:   21 QGHGGLNQLGGAFVNGRPLPDYIRHRIIQLATYGVRPCEISRRLLVSHGCVSKILGRYYETGSIRPGSIGGSKPKVATPPVVNKILQYKQQNPTIFAWEIRDRLVEEGICDRDNTPSVSSINRILRNKAAERAAQFAMLERERQHLASLYGLH 173          

HSP 2 Score: 113.62 bits (283), Expect = 9.569e-27
Identity = 60/134 (44.78%), Postives = 85/134 (63.43%), Query Frame = 2
Query:  908 NQSNSGVTNYHVQSTTDSSDKHKSEKYSESIAHSE-SNASSEPGNEYMSGVKSENDDMRIK-------LKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKL 1285
             ++ S  ++   +ST + +D H+  +Y   I H E  +   E  +   +   +  DD R K        KRKL+RNRT+F+ DQL+ LEKEFE++HYPDV  RE+LA+KI + EAR+QVWFSNRRAKWRR +K+
Sbjct:  259 EETESITSHTEERSTIEDTDSHR--QYEPRITHEEVRDRMDEAADSDTNANDASTDDERGKDEDPATNQKRKLRRNRTTFTPDQLEMLEKEFEKSHYPDVATREELANKIDMSEARVQVWFSNRRAKWRRHQKI 390          
BLAST of Pax6A vs. Ensembl Nematostella
Match: PAXA (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S916])

HSP 1 Score: 194.512 bits (493), Expect = 5.516e-54
Identity = 92/137 (67.15%), Postives = 109/137 (79.56%), Query Frame = 2
Query:  293 RGHSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLV 703
            RG  G+NQLGG+FVNGRPLPD  R RIVELAH G RP +ISR L VS+GCVSKIL RYYETGS+RP AIGGSKP+VAT  VVSKI  YK + P IF+WEIR+ LL +GVC++ N+PSVSSINR+LR+ + E +   V
Sbjct:    4 RGPGGVNQLGGVFVNGRPLPDYMRHRIVELAHCGVRPSEISRQLLVSHGCVSKILGRYYETGSVRPGAIGGSKPKVATPKVVSKILEYKDKNPCIFAWEIRNNLLADGVCDKTNVPSVSSINRILRNSAAEKEARAV 140          
BLAST of Pax6A vs. Ensembl Nematostella
Match: EDO32510 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUW0])

HSP 1 Score: 149.443 bits (376), Expect = 1.593e-42
Identity = 65/126 (51.59%), Postives = 96/126 (76.19%), Query Frame = 2
Query:  308 INQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNE 685
            +NQLGG +VNG+PLP   R +I+ELA SG RPC+ISR L++++GC+SK+L ++ +TGS+ P  +   +PRV TS +  KI  Y+ E P IFSWEIRD+LLQEG+C++  +PS+SSI+R+++   +E
Sbjct:    1 VNQLGGGYVNGKPLPREIRIQIIELARSGVRPCEISRRLKITHGCISKLLAKFQKTGSLEPGTVYKGRPRVVTSQIEKKIDQYRAEQPGIFSWEIRDQLLQEGICDRSEVPSLSSISRIVKRKVSE 126          
BLAST of Pax6A vs. Ensembl Nematostella
Match: EDO36623 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SI38])

HSP 1 Score: 148.673 bits (374), Expect = 3.045e-42
Identity = 70/127 (55.12%), Postives = 97/127 (76.38%), Query Frame = 2
Query:  296 GHSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGG-SKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRS 673
            G   +NQLGG+F+NGRPLP   R++I+ELA  G RPCDISR L+VS+GCVSKIL R+ +TGSI P AI G S PR  T  +  KI  Y+RE P +FSWE+RDRL+++ VC++  +PS+++I++VL++
Sbjct:    2 GQGRVNQLGGVFINGRPLPLVLRKQIIELAQLGVRPCDISRRLRVSHGCVSKILYRFQQTGSIEPGAIAGSSTPRNVTPEIEEKIDEYRRENPGMFSWEVRDRLVKDNVCSRCTVPSLAAISQVLKN 128          
BLAST of Pax6A vs. Ensembl Medaka
Match: ENSORLT00000033584.1 (paired box protein Pax-6 [Source:NCBI gene;Acc:101173141])

HSP 1 Score: 367.081 bits (941), Expect = 1.182e-120
Identity = 191/335 (57.01%), Postives = 229/335 (68.36%), Query Frame = 2
Query:  299 HSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAATGMYDKLSLLSGQPXXXXXXXXXXXXXXXXXXXXXXXXFPNCGAYGGLTGIGIINGMSTAHAVASINQSNSGVTNYHVQSTTDSSDKHKSEKYSESIAHSESNASSEPGNEYMSGVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQN 1303
            HSG+NQLGG+FVNGRPLPDSTRQ+IVELAHSGARPCDISRILQVSNGCVSKIL RYYETGSIRP+AIGGSKPRVAT  VV+KIA YKRECPSIF+WEIRDRLL EGVC+ DNIPSVSSINRVLR+L+++ Q+                                               G+ G         GM     + +++ S  G ++++  +T  S++  ++E     I+    N+S+E          SE   MR++LKRKLQRNRTSF+ DQ+++LEKEFERTHYPDVFARE+LA+KI LPEARIQVWFSNRRAKWRREEKLR QR+ 
Sbjct:   24 HSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVAKIAQYKRECPSIFAWEIRDRLLAEGVCSNDNIPSVSSINRVLRNLASDKQQ----------------------------------------------MGSLG-------TEGMFDKLKMLNVHTSWGGRSSWYAGTTLSSTECPQAEGRENGIS---VNSSTE---------DSEETQMRLQLKRKLQRNRTSFTQDQIEALEKEFERTHYPDVFARERLANKIDLPEARIQVWFSNRRAKWRREEKLRNQRRQ 293          
BLAST of Pax6A vs. Ensembl Medaka
Match: pax6b (paired box 6 [Source:NCBI gene;Acc:100049356])

HSP 1 Score: 264.618 bits (675), Expect = 3.189e-81
Identity = 123/150 (82.00%), Postives = 137/150 (91.33%), Query Frame = 2
Query:  299 HSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAATGMYDKLSLLSGQ 748
            HSG+NQLGG+FVNGRPLPDSTRQ+IVELAHSGARPCDISRILQVSNGCVSKIL RYYETGSIRP+AIGGSKPRVAT  VV+KIA YKRECPSIF+WEIRDRLL EG+C  DNIPSVSSINRVLR+L++E Q+  + A GMYDKL +L+GQ
Sbjct:   24 HSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVAKIAQYKRECPSIFAWEIRDRLLSEGICTNDNIPSVSSINRVLRNLASEKQQ--MGADGMYDKLRMLNGQ 171          

HSP 2 Score: 146.362 bits (368), Expect = 1.322e-37
Identity = 65/83 (78.31%), Postives = 74/83 (89.16%), Query Frame = 2
Query: 1052 GVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQ 1300
            G  SE   MR++LKRKLQRNRTSF+ +Q+++LEKEFERTHYPDVFARE+LA KI LPEARIQVWFSNRRAKWRREEKLR QR+
Sbjct:  213 GEDSEETQMRLQLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEKLRNQRR 295          
BLAST of Pax6A vs. Ensembl Medaka
Match: pax6b (paired box 6 [Source:NCBI gene;Acc:100049356])

HSP 1 Score: 258.07 bits (658), Expect = 1.638e-78
Identity = 124/163 (76.07%), Postives = 138/163 (84.66%), Query Frame = 2
Query:  296 GHSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQ------------VSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAATGMYDKLSLLSGQ 748
            GHSG+NQLGG+FVNGRPLPDSTRQ+IVELAHSGARPCDISRILQ            VSNGCVSKIL RYYETGSIRP+AIGGSKPRVAT  VV+KIA YKRECPSIF+WEIRDRLL EG+C  DNIPSVSSINRVLR+L++E Q+  + A GMYDKL +L+GQ
Sbjct:   31 GHSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQTHDEVQVLDSEKVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVAKIAQYKRECPSIFAWEIRDRLLSEGICTNDNIPSVSSINRVLRNLASEKQQ--MGADGMYDKLRMLNGQ 191          

HSP 2 Score: 145.976 bits (367), Expect = 2.447e-37
Identity = 65/83 (78.31%), Postives = 74/83 (89.16%), Query Frame = 2
Query: 1052 GVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQ 1300
            G  SE   MR++LKRKLQRNRTSF+ +Q+++LEKEFERTHYPDVFARE+LA KI LPEARIQVWFSNRRAKWRREEKLR QR+
Sbjct:  233 GEDSEETQMRLQLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEKLRNQRR 315          
BLAST of Pax6A vs. Ensembl Medaka
Match: ENSORLT00000001038.2 (paired box protein Pax-6 [Source:NCBI gene;Acc:101173141])

HSP 1 Score: 255.758 bits (652), Expect = 4.197e-78
Identity = 119/148 (80.41%), Postives = 134/148 (90.54%), Query Frame = 2
Query:  299 HSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRH-LVAATGMYDKLSLL 739
            HSG+NQLGG+FVNGRPLPDSTRQ+IVELAHSGARPCDISRILQVSNGCVSKIL RYYETGSIRP+AIGGSKPRVAT  VV+KIA YKRECPSIF+WEIRDRLL EGVC+ DNIPSVSSINRVLR+L+++ Q+   +   GM+DKL +L
Sbjct:    9 HSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVAKIAQYKRECPSIFAWEIRDRLLAEGVCSNDNIPSVSSINRVLRNLASDKQQMGSLGTEGMFDKLKML 156          

HSP 2 Score: 147.517 bits (371), Expect = 3.284e-38
Identity = 65/81 (80.25%), Postives = 74/81 (91.36%), Query Frame = 2
Query: 1061 SENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQN 1303
            SE   MR++LKRKLQRNRTSF+ DQ+++LEKEFERTHYPDVFARE+LA+KI LPEARIQVWFSNRRAKWRREEKLR QR+ 
Sbjct:  192 SEETQMRLQLKRKLQRNRTSFTQDQIEALEKEFERTHYPDVFARERLANKIDLPEARIQVWFSNRRAKWRREEKLRNQRRQ 272          
BLAST of Pax6A vs. Ensembl Medaka
Match: pax6b (paired box 6 [Source:NCBI gene;Acc:100049356])

HSP 1 Score: 256.144 bits (653), Expect = 8.628e-78
Identity = 123/162 (75.93%), Postives = 137/162 (84.57%), Query Frame = 2
Query:  299 HSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQ------------VSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAATGMYDKLSLLSGQ 748
            HSG+NQLGG+FVNGRPLPDSTRQ+IVELAHSGARPCDISRILQ            VSNGCVSKIL RYYETGSIRP+AIGGSKPRVAT  VV+KIA YKRECPSIF+WEIRDRLL EG+C  DNIPSVSSINRVLR+L++E Q+  + A GMYDKL +L+GQ
Sbjct:   24 HSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQTHDEVQVLDSEKVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVAKIAQYKRECPSIFAWEIRDRLLSEGICTNDNIPSVSSINRVLRNLASEKQQ--MGADGMYDKLRMLNGQ 183          

HSP 2 Score: 145.976 bits (367), Expect = 1.930e-37
Identity = 65/83 (78.31%), Postives = 74/83 (89.16%), Query Frame = 2
Query: 1052 GVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQ 1300
            G  SE   MR++LKRKLQRNRTSF+ +Q+++LEKEFERTHYPDVFARE+LA KI LPEARIQVWFSNRRAKWRREEKLR QR+
Sbjct:  225 GEDSEETQMRLQLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEKLRNQRR 307          
BLAST of Pax6A vs. Planmine SMEST
Match: SMESG000039056.1 (SMESG000039056.1)

HSP 1 Score: 1046.19 bits (2704), Expect = 0.000e+0
Identity = 533/534 (99.81%), Postives = 533/534 (99.81%), Query Frame = 2
Query:  293 RGHSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAATGMYDKLSLLSGQPXXXXXXXXXXXXXXXXXXXXXXXXFPNCGAYGGLTGIGIINGMSTAHAVASINQSNSGVTNYHVQSTTDSSDKHKSEKYSESIAHSESNASSEPGNEYMSGVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQNLMLGSNGTSSTADTNVTTNGNTQCLSTTGQNSMGFSGINDIRNQFGDVGMQTPSLSAVAAAGMYHSAVASAADQYAKSAGLPNLSQSSINSPYSYMANLQSRSSGSQIDLPNVTSNSNSFYNPGSVYPPSLFQGVMRGYDTIGYPKYPSAMFPGSLESNNNINPAGFLANNMSSNSSKPDYDFSAFNRPSNYWTPVA 1894
            RGHSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAATGMYDKLSLLSGQPWSTAAAHAAWYSSAAAAHGYASSTFPNCGAYGGLTGIGIINGMSTAHAVASINQSNSGVTNYHVQSTTDSSDKHKSEKYSESIAHSESNASSEPGNEYMSGVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQNLMLGSNG SSTADTNVTTNGNTQCLSTTGQNSMGFSGINDIRNQFGDVGMQTPSLSAVAAAGMYHSAVASAADQYAKSAGLPNLSQSSINSPYSYMANLQSRSSGSQIDLPNVTSNSNSFYNPGSVYPPSLFQGVMRGYDTIGYPKYPSAMFPGSLESNNNINPAGFLANNMSSNSSKPDYDFSAFNRPSNYWTPVA
Sbjct:   17 RGHSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAATGMYDKLSLLSGQPWSTAAAHAAWYSSAAAAHGYASSTFPNCGAYGGLTGIGIINGMSTAHAVASINQSNSGVTNYHVQSTTDSSDKHKSEKYSESIAHSESNASSEPGNEYMSGVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQNLMLGSNGASSTADTNVTTNGNTQCLSTTGQNSMGFSGINDIRNQFGDVGMQTPSLSAVAAAGMYHSAVASAADQYAKSAGLPNLSQSSINSPYSYMANLQSRSSGSQIDLPNVTSNSNSFYNPGSVYPPSLFQGVMRGYDTIGYPKYPSAMFPGSLESNNNINPAGFLANNMSSNSSKPDYDFSAFNRPSNYWTPVA 550          
BLAST of Pax6A vs. Planmine SMEST
Match: SMESG000077501.1 (SMESG000077501.1)

HSP 1 Score: 323.553 bits (828), Expect = 3.082e-102
Identity = 197/442 (44.57%), Postives = 258/442 (58.37%), Query Frame = 2
Query:  293 RGHSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLR---------------SLSNENQRHLVAATG-------MYDKLSLLSGQPXXXXXXXXXXXXXXXXXXXXXXXXFPNCGAYGGLTGIGIINGMSTAHAVASINQSNSGVTNYHVQ--STTDSSDKHKSEKYSESIAHS--ESNASSEPG------------NEYMSGVKSEND----DMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEK----------LRRQRQNLMLGSNGTSSTADTNVTTNGNTQCLSTTGQNSMGFSGINDIRNQFGDVGMQTP 1462
            +GHSGINQLGGMFVNGRPLPD TRQRI+EL+ SGARPCDISRILQVSNGCVSKILCRYYETGSI+PKAIGGSKPRVAT++VV K+  YK+E PS+F+WEIRDRLLQ+GVCNQDN+PS+SSINR+LR               S+SN +Q  L +           YD  +  +    +    +++           A   FPN  +  G++ +      ST     + N  ++  ++Y     S  DS  +  +  + ES+  S  +S   SE G            +++ S  +SEN+    +   K+ +K QR+RTSF+ DQ++ LEKEFERTHYPDVF+REKL+  + + E RIQVWFSNRRAKWRREEK          +R    N+   S  + ++ D+ + TN N       G  +     I    N FG    Q P
Sbjct:   19 KGHSGINQLGGMFVNGRPLPDMTRQRIIELSQSGARPCDISRILQVSNGCVSKILCRYYETGSIKPKAIGGSKPRVATNTVVRKVTIYKQESPSMFAWEIRDRLLQDGVCNQDNLPSISSINRILRSLANESPTTNPTFKSSISNSHQLALASQNNGTSSCLPQYDSFNTSTNN--NFNLLNSSSTFINTWPPTSAPPVFPNWYSQSGISSLC----HSTLFGYNTPNYYSAHFSDYSSSQISFEDSKARLVNNSHHESVRESAMKSLLQSETGVGNGLKINNDKISDFNSDRESENEKRYSNSESKINKKSQRSRTSFTNDQINLLEKEFERTHYPDVFSREKLSQNLKVAETRIQVWFSNRRAKWRREEKSEENNLSNGLIRSDLSNMEQVSGVSIASNDSILNTNSNFFSDCFRGNFTSMPEDIRSSWNSFGSSLFQPP 454          
BLAST of Pax6A vs. Planmine SMEST
Match: SMESG000004009.1 (SMESG000004009.1)

HSP 1 Score: 199.134 bits (505), Expect = 5.010e-55
Identity = 88/126 (69.84%), Postives = 107/126 (84.92%), Query Frame = 2
Query:  296 GHSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRS 673
            GH G+NQLGG+FVNGRPLP+S RQ+IVELAH G RPCDISR L+VS+GCVSKIL R+YETGSI+P  IGGSKP+VAT  VV  I  YK E P++F+WEIRD LL + VC+Q+N+PSVSSINR++R+
Sbjct:   50 GHGGVNQLGGLFVNGRPLPNSVRQQIVELAHRGVRPCDISRQLRVSHGCVSKILGRFYETGSIKPGVIGGSKPKVATPEVVEAICKYKAENPTMFAWEIRDMLLNDRVCSQENVPSVSSINRIVRN 175          
BLAST of Pax6A vs. Planmine SMEST
Match: SMESG000080212.1 (SMESG000080212.1)

HSP 1 Score: 152.525 bits (384), Expect = 1.097e-39
Identity = 68/121 (56.20%), Postives = 90/121 (74.38%), Query Frame = 2
Query:  308 INQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLR 670
            +NQ G +F NGRPLP+  R +I+++A    RPC+ISR LQVS+GCVSKIL RY  TGSI P  IGGSKP+V T  +VS + +Y+ + P IF+WEIR RL+ EG C + + PS+SSINR++R
Sbjct:  126 VNQYGRVFTNGRPLPEDLRLKILKMAMENVRPCEISRQLQVSHGCVSKILNRYSRTGSINPGQIGGSKPKVTTPEIVSLVKSYREKNPQIFAWEIRQRLVDEGACTERSAPSISSINRIIR 246          
BLAST of Pax6A vs. Planmine SMEST
Match: SMESG000080212.1 (SMESG000080212.1)

HSP 1 Score: 152.525 bits (384), Expect = 1.190e-39
Identity = 68/121 (56.20%), Postives = 90/121 (74.38%), Query Frame = 2
Query:  308 INQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLR 670
            +NQ G +F NGRPLP+  R +I+++A    RPC+ISR LQVS+GCVSKIL RY  TGSI P  IGGSKP+V T  +VS + +Y+ + P IF+WEIR RL+ EG C + + PS+SSINR++R
Sbjct:  131 VNQYGRVFTNGRPLPEDLRLKILKMAMENVRPCEISRQLQVSHGCVSKILNRYSRTGSINPGQIGGSKPKVTTPEIVSLVKSYREKNPQIFAWEIRQRLVDEGACTERSAPSISSINRIIR 251          
The following BLAST results are available for this feature:
BLAST of Pax6A vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PAX61.417e-8382.89paired box 6 [Source:HGNC Symbol;Acc:HGNC:8620][more]
PAX68.423e-8283.33paired box 6 [Source:HGNC Symbol;Acc:HGNC:8620][more]
PAX68.646e-8283.33paired box 6 [Source:HGNC Symbol;Acc:HGNC:8620][more]
PAX68.646e-8283.33paired box 6 [Source:HGNC Symbol;Acc:HGNC:8620][more]
PAX68.788e-8283.33paired box 6 [Source:HGNC Symbol;Acc:HGNC:8620][more]
back to top
BLAST of Pax6A vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vab-32.064e-10549.72MAB-18 [Source:UniProtKB/TrEMBL;Acc:G5EE71][more]
pax-23.042e-5363.78PAX (Paired box) transcription factor [Source:Uni... [more]
pax-22.228e-5263.78PAX (Paired box) transcription factor [Source:Uni... [more]
egl-385.249e-5260.87PAX protein [Source:UniProtKB/TrEMBL;Acc:G5ED14][more]
pax-11.382e-4461.16PAX (Paired box) transcription factor [Source:Uni... [more]
back to top
BLAST of Pax6A vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
toy3.235e-12757.95gene:FBgn0019650 transcript:FBtr0089185[more]
toy5.176e-12255.56gene:FBgn0019650 transcript:FBtr0339509[more]
ey1.664e-7084.21gene:FBgn0005558 transcript:FBtr0089236[more]
ey2.767e-6984.73gene:FBgn0005558 transcript:FBtr0100395[more]
ey3.362e-6984.73gene:FBgn0005558 transcript:FBtr0100396[more]
back to top
BLAST of Pax6A vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pax6b3.826e-8182.67paired box 6b [Source:ZFIN;Acc:ZDB-GENE-001031-1][more]
pax6b3.826e-8182.67paired box 6b [Source:ZFIN;Acc:ZDB-GENE-001031-1][more]
pax6a1.880e-8082.00paired box 6a [Source:NCBI gene;Acc:30567][more]
pax6b1.521e-7776.07paired box 6b [Source:ZFIN;Acc:ZDB-GENE-001031-1][more]
pax6b1.521e-7776.07paired box 6b [Source:ZFIN;Acc:ZDB-GENE-001031-1][more]
back to top
BLAST of Pax6A vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pax61.042e-8283.44paired box 6 [Source:NCBI gene;Acc:448447][more]
pax62.550e-8283.44paired box 6 [Source:NCBI gene;Acc:448447][more]
pax61.257e-8183.33paired box 6 [Source:NCBI gene;Acc:448447][more]
pax63.812e-8183.33paired box 6 [Source:NCBI gene;Acc:448447][more]
pax68.503e-8083.11paired box 6 [Source:NCBI gene;Acc:448447][more]
back to top
BLAST of Pax6A vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pax67.746e-8283.33paired box 6 [Source:MGI Symbol;Acc:MGI:97490][more]
Pax67.746e-8283.33paired box 6 [Source:MGI Symbol;Acc:MGI:97490][more]
Pax67.746e-8283.33paired box 6 [Source:MGI Symbol;Acc:MGI:97490][more]
Pax67.746e-8283.33paired box 6 [Source:MGI Symbol;Acc:MGI:97490][more]
Pax64.021e-7876.22paired box 6 [Source:MGI Symbol;Acc:MGI:97490][more]
back to top
BLAST of Pax6A vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P63016|PAX6_RAT4.624e-8183.33Paired box protein Pax-6 OS=Rattus norvegicus OX=1... [more]
sp|Q1LZF1|PAX6_BOVIN4.979e-8183.33Paired box protein Pax-6 OS=Bos taurus OX=9913 GN=... [more]
sp|P63015|PAX6_MOUSE5.418e-8183.33Paired box protein Pax-6 OS=Mus musculus OX=10090 ... [more]
sp|P26367|PAX6_HUMAN5.418e-8183.33Paired box protein Pax-6 OS=Homo sapiens OX=9606 G... [more]
sp|P47238|PAX6_COTJA5.932e-8183.33Paired box protein Pax-6 OS=Coturnix japonica OX=9... [more]
back to top
BLAST of Pax6A vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|203063710.000e+0100.00tr|I1ZI92|I1ZI92_SCHMD Pax6A OS=Schmidtea mediterr... [more]
gnl|BL_ORD_ID|196252820.000e+097.94tr|O97038|O97038_DUGJA DjPax-6 OS=Dugesia japonica... [more]
gnl|BL_ORD_ID|224832690.000e+095.91tr|Q95UT4|Q95UT4_GIRTI Pax6A (Fragment) OS=Girardi... [more]
gnl|BL_ORD_ID|209327110.000e+0100.00tr|H6V052|H6V052_SCHPL PAX6 (Fragment) OS=Schmidte... [more]
gnl|BL_ORD_ID|230735080.000e+084.59tr|T1E1D9|T1E1D9_9PLAT Pax6A (Fragment) OS=Dendroc... [more]
back to top
BLAST of Pax6A vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pax6a1.200e-8080.79paired box 6 [Source:NCBI gene;Acc:103044317][more]
pax6a1.501e-8080.79paired box 6 [Source:NCBI gene;Acc:103044317][more]
pax6b7.393e-7980.00paired box 6b [Source:ZFIN;Acc:ZDB-GENE-001031-1][more]
pax6a9.503e-7773.94paired box 6 [Source:NCBI gene;Acc:103044317][more]
pax6a9.503e-7773.94paired box 6 [Source:NCBI gene;Acc:103044317][more]
back to top
BLAST of Pax6A vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pax93.329e-5262.14paired box 9 [Source:ZFIN;Acc:ZDB-GENE-980526-399][more]
pax1a1.064e-4970.25paired box 1a [Source:ZFIN;Acc:ZDB-GENE-070112-182... [more]
dmbx1b4.868e-1958.33diencephalon/mesencephalon homeobox 1b [Source:NCB... [more]
ENSPMAT00000010761.11.571e-1861.02pep scaffold:Pmarinus_7.0:GL476415:928307:936594:-... [more]
otx59.432e-1252.63orthodenticle homolog 5 [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of Pax6A vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
PHO23.015e-839.29Homeobox transcription factor; regulatory targets ... [more]
back to top
BLAST of Pax6A vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
PAXB1.555e-8946.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
PAXC7.716e-5760.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
PAXA5.516e-5467.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO325101.593e-4251.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO366233.045e-4255.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Pax6A vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000033584.11.182e-12057.01paired box protein Pax-6 [Source:NCBI gene;Acc:101... [more]
pax6b3.189e-8182.00paired box 6 [Source:NCBI gene;Acc:100049356][more]
pax6b1.638e-7876.07paired box 6 [Source:NCBI gene;Acc:100049356][more]
ENSORLT00000001038.24.197e-7880.41paired box protein Pax-6 [Source:NCBI gene;Acc:101... [more]
pax6b8.628e-7875.93paired box 6 [Source:NCBI gene;Acc:100049356][more]
back to top
BLAST of Pax6A vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000039056.10.000e+099.81SMESG000039056.1[more]
SMESG000077501.13.082e-10244.57SMESG000077501.1[more]
SMESG000004009.15.010e-5569.84SMESG000004009.1[more]
SMESG000080212.11.097e-3956.20SMESG000080212.1[more]
SMESG000080212.11.190e-3956.20SMESG000080212.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30024586
GenBankAFJ24746.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024586 ID=SMED30024586|Name=Pax6A|organism=Schmidtea mediterranea sexual|type=transcript|length=1992bp
GTTGGTTTTTCTAACAGATTTATTAATGCTAGATTGGCCGCTCAAGATTA
ATCATAATATTCTGCTACTTTACTGATATAATTTTTATACACGGTTACTA
CTACTCCTCTACTATTTTCGCATTGTTGGCTTCTCAAATTCAATCCCTGG
GCATAAATCAAACCGCTTCATTGACAAAATCCTTTTTGACACTACAAGAA
ATTGATTCAGTTACTGAAGTAGAAAATATACACAGTCGAAACCTATGACC
GAATCGAATGAAGAGGAAATAAAAAATAAAAAGAAAGTTAAACGAGGACA
TTCAGGAATCAATCAATTAGGTGGAATGTTTGTCAACGGTCGACCTTTGC
CCGATTCGACCCGACAGAGAATCGTTGAGTTGGCTCACTCCGGAGCGAGA
CCATGTGATATTTCCCGAATCCTCCAAGTTTCCAATGGATGCGTCAGTAA
AATCCTATGCAGATACTACGAAACCGGTTCAATTCGACCGAAAGCCATCG
GAGGCAGCAAACCAAGAGTAGCTACCAGTTCAGTTGTGTCGAAAATTGCC
GCCTACAAACGTGAATGCCCGTCGATATTTTCTTGGGAAATTCGCGATAG
ATTATTACAGGAAGGGGTTTGCAATCAGGATAACATTCCCAGTGTCTCTT
CGATAAATCGTGTTCTACGCAGTTTGTCTAATGAAAACCAACGACATTTA
GTTGCAGCAACTGGAATGTATGACAAACTGTCATTGTTAAGCGGCCAGCC
TTGGTCTACTGCAGCTGCTCATGCGGCTTGGTATTCCAGTGCTGCAGCAG
CACATGGGTATGCTTCATCGACATTTCCCAATTGTGGTGCCTATGGAGGC
TTAACCGGAATCGGAATTATCAATGGAATGAGTACAGCCCACGCGGTAGC
GTCAATTAATCAGTCGAATTCCGGGGTCACAAATTACCATGTTCAATCAA
CAACCGATAGTTCCGACAAACACAAATCAGAAAAATATTCAGAATCCATT
GCACATTCTGAATCGAATGCTTCCAGTGAGCCTGGCAACGAATATATGTC
CGGAGTAAAAAGTGAGAATGATGATATGAGAATTAAACTGAAAAGGAAAC
TTCAAAGAAATCGAACATCGTTTTCAACAGATCAGCTTGATTCTTTGGAA
AAAGAATTTGAACGAACTCATTATCCTGATGTATTCGCCAGAGAGAAATT
GGCAGACAAAATCAGTCTTCCAGAGGCGAGAATACAAGTTTGGTTTTCAA
ATCGAAGAGCAAAATGGAGACGAGAAGAAAAACTTCGTCGACAACGGCAA
AATCTTATGCTTGGTTCAAACGGAACAAGTTCTACTGCTGATACTAATGT
AACAACAAATGGAAATACTCAATGTTTGTCGACAACCGGACAAAATTCAA
TGGGATTTTCTGGAATAAATGATATCAGAAACCAATTTGGTGATGTTGGA
ATGCAAACACCTTCATTGTCGGCTGTAGCAGCTGCAGGAATGTACCATTC
GGCAGTTGCCTCTGCTGCAGATCAGTATGCAAAATCAGCCGGTTTACCAA
ATCTTTCGCAATCGTCAATCAATTCTCCATATTCCTACATGGCAAATTTG
CAGTCGAGATCCAGTGGTTCCCAAATTGACTTGCCAAACGTTACAAGCAA
TTCAAATTCTTTTTACAACCCCGGATCAGTTTATCCCCCAAGTTTATTTC
AAGGTGTAATGAGAGGATATGACACCATTGGATATCCCAAGTATCCTTCA
GCAATGTTTCCAGGATCACTCGAAAGTAATAATAATATCAACCCTGCCGG
TTTTCTTGCAAATAATATGTCTTCGAATTCATCTAAACCCGATTACGATT
TCTCAGCATTTAATCGGCCCAGCAATTATTGGACTCCGGTCGCATAAAAT
TGCACAAATGAATGAAAACAATTTCAAAAATTCCGAAACAACAATGATTA
GAACAAAAAAAACATTTTTCTAAAATAGTTGTTAATTTAAAC
back to top

protein sequence of SMED30024586-orf-1

>SMED30024586-orf-1 ID=SMED30024586-orf-1|Name=SMED30024586-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=551bp
MTESNEEEIKNKKKVKRGHSGINQLGGMFVNGRPLPDSTRQRIVELAHSG
ARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSK
IAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQR
HLVAATGMYDKLSLLSGQPWSTAAAHAAWYSSAAAAHGYASSTFPNCGAY
GGLTGIGIINGMSTAHAVASINQSNSGVTNYHVQSTTDSSDKHKSEKYSE
SIAHSESNASSEPGNEYMSGVKSENDDMRIKLKRKLQRNRTSFSTDQLDS
LEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQ
RQNLMLGSNGTSSTADTNVTTNGNTQCLSTTGQNSMGFSGINDIRNQFGD
VGMQTPSLSAVAAAGMYHSAVASAADQYAKSAGLPNLSQSSINSPYSYMA
NLQSRSSGSQIDLPNVTSNSNSFYNPGSVYPPSLFQGVMRGYDTIGYPKY
PSAMFPGSLESNNNINPAGFLANNMSSNSSKPDYDFSAFNRPSNYWTPVA
*
back to top
Aliases
The feature 'Pax6A' has the following synonyms
Synonym
pax6A
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000097ventral nerve cord
PLANA:0000418head
PLANA:0002111X2 cell
PLANA:0000044cephalic ganglia
PLANA:0000025nervous system
PLANA:0000012neural progenitor cell
Vocabulary: INTERPRO
TermDefinition
IPR036388WH-like_DNA-bd_sf
IPR043182PAIRED_DNA_bd_dom
IPR001523Paired_dom
IPR001356Homeobox_dom
IPR011991WHTH_DNA-bd_dom
IPR009057Homeobox-like_sf
IPR017970Homeobox_CS
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO:0006351transcription, DNA-templated
GO:0007275multicellular organism development
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0043565sequence-specific DNA binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
Vocabulary: Schmidtea mediterranea Developmental Stages
TermDefinition
PLANA:0000006Stage 6
PLANA:0000007Stage 7
PLANA:0000005Stage 5
PLANA:0000008Stage 8
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001523Paired domainPRINTSPR00027PAIREDBOXcoord: 60..77
score: 84.64
coord: 22..37
score: 83.36
coord: 78..95
score: 77.4
coord: 40..58
score: 82.85
IPR001523Paired domainSMARTSM00351pax3coord: 18..142
e-value: 9.4E-90
score: 314.2
IPR001523Paired domainPFAMPF00292PAXcoord: 18..142
e-value: 2.8E-69
score: 230.8
IPR001523Paired domainPROSITEPS51057PAIRED_2coord: 18..144
score: 62.635
IPR001523Paired domainCDDcd00131PAXcoord: 18..144
e-value: 4.04206E-81
score: 247.718
IPR001356Homeobox domainSMARTSM00389HOX_1coord: 286..348
e-value: 5.2E-25
score: 99.1
IPR001356Homeobox domainPFAMPF00046Homeodomaincoord: 288..343
e-value: 1.7E-21
score: 75.8
IPR001356Homeobox domainPROSITEPS50071HOMEOBOX_2coord: 284..344
score: 19.937
IPR001356Homeobox domainCDDcd00086homeodomaincoord: 288..345
e-value: 2.57999E-23
score: 91.1508
NoneNo IPR availableGENE3DG3DSA:1.10.10.60coord: 271..347
e-value: 1.5E-26
score: 93.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 231..276
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 237..251
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 252..268
NoneNo IPR availablePANTHERPTHR45636:SF5PAIRED BOX PROTEIN PAX-6coord: 18..457
NoneNo IPR availablePANTHERPTHR45636FAMILY NOT NAMEDcoord: 18..457
IPR036388Winged helix-like DNA-binding domain superfamilyGENE3DG3DSA:1.10.10.10coord: 10..86
e-value: 3.4E-42
score: 144.0
IPR036388Winged helix-like DNA-binding domain superfamilyGENE3DG3DSA:1.10.10.10coord: 87..150
e-value: 7.0E-32
score: 110.9
IPR043182Paired DNA-binding domainPROSITEPS00034PAIRED_1coord: 52..68
IPR017970Homeobox, conserved sitePROSITEPS00027HOMEOBOX_1coord: 319..342
IPR009057Homeobox-like domain superfamilySUPERFAMILYSSF46689Homeodomain-likecoord: 270..345
IPR009057Homeobox-like domain superfamilySUPERFAMILYSSF46689Homeodomain-likecoord: 20..143