Pax6A

Overview
NamePax6A (AFJ24746.1)
Smed IDSMED30024586
Uniprot Best hitPaired box protein Pax-6 OS=Rattus norvegicus GN=Pax6 PE=2 SV=1 (E=8.4526e-80)
Length (bp)1992
Neoblast Clusters

Zeng et. al., 2018


▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Pax6A (SMED30024586) t-SNE clustered cells

Violin plots show distribution of expression levels for Pax6A (SMED30024586) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Pax6A (SMED30024586) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Pax6A (SMED30024586) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017


Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

Download CSV of Expression Data

 

back to top

Expression Details

Pax6A ( pax6A ) is expressed during Stage 5, Stage 6, Stage 7 and Stage 8 in the cephalic ganglia, neural progenitor and nervous system

Click to see image symbols and abbreviations
Abbreviation or symbolDefinition
Ooral hemisphere
Aaboral hemisphere
Ddorsal
Vventral
Llateral
black arrowheadembryonic pharynx
red arrowheaddefinitive pharynx
black arrowsprimitive gut
yellow arrowsprimitive ectoderm cells
cyan arrowsbrain
cyan arrowheadsnerve cords
blue arrowheadseye progenitors (trail cells)
purple arrowheadseyes
scale bar100 µm

 

Neural progenitors arise in the piwi-1+ blastomere population during S5.

SPIM reconstructed S5 embryo costained with piwi-1 and VAL-like (both in red) and pax6a (green). Neural progenitors, coexpressing piwi-1 and pax6a, are dispersed in the embryonic wall. As neural progenitors differentiate, they are predicted to downregulate piwi-1 and retain expression of pax6a. VAL-like is expressed the temporary embryonic pharynx (at bottom) and is not detected in piwi-1+ blastomeres

Homology
BLAST of Pax6A vs. Ensembl Human
Match: PAX6 (paired box 6 [Source:HGNC Symbol;Acc:HGNC:8620])

HSP 1 Score: 266.159 bits (679), Expect = 1.924e-80
Identity = 125/150 (83.33%), Postives = 137/150 (91.33%), Query Frame = 2
Query:  299 HSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAATGMYDKLSLLSGQ 748
            HSG+NQLGG+FVNGRPLPDSTRQ+IVELAHSGARPCDISRILQVSNGCVSKIL RYYETGSIRP+AIGGSKPRVAT  VVSKIA YKRECPSIF+WEIRDRLL EGVC  DNIPSVSSINRVLR+L++E Q+  + A GMYDKL +L+GQ
Sbjct:    5 HSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVSKIAQYKRECPSIFAWEIRDRLLSEGVCTNDNIPSVSSINRVLRNLASEKQQ--MGADGMYDKLRMLNGQ 152          

HSP 2 Score: 145.206 bits (365), Expect = 5.747e-37
Identity = 64/83 (77.11%), Postives = 74/83 (89.16%), Query Frame = 2
Query: 1052 GVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQ 1300
            G  S+   MR++LKRKLQRNRTSF+ +Q+++LEKEFERTHYPDVFARE+LA KI LPEARIQVWFSNRRAKWRREEKLR QR+
Sbjct:  194 GEDSDEAQMRLQLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEKLRNQRR 276          
BLAST of Pax6A vs. Ensembl Human
Match: PAX6 (paired box 6 [Source:HGNC Symbol;Acc:HGNC:8620])

HSP 1 Score: 266.159 bits (679), Expect = 1.924e-80
Identity = 125/150 (83.33%), Postives = 137/150 (91.33%), Query Frame = 2
Query:  299 HSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAATGMYDKLSLLSGQ 748
            HSG+NQLGG+FVNGRPLPDSTRQ+IVELAHSGARPCDISRILQVSNGCVSKIL RYYETGSIRP+AIGGSKPRVAT  VVSKIA YKRECPSIF+WEIRDRLL EGVC  DNIPSVSSINRVLR+L++E Q+  + A GMYDKL +L+GQ
Sbjct:    5 HSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVSKIAQYKRECPSIFAWEIRDRLLSEGVCTNDNIPSVSSINRVLRNLASEKQQ--MGADGMYDKLRMLNGQ 152          

HSP 2 Score: 145.206 bits (365), Expect = 5.747e-37
Identity = 64/83 (77.11%), Postives = 74/83 (89.16%), Query Frame = 2
Query: 1052 GVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQ 1300
            G  S+   MR++LKRKLQRNRTSF+ +Q+++LEKEFERTHYPDVFARE+LA KI LPEARIQVWFSNRRAKWRREEKLR QR+
Sbjct:  194 GEDSDEAQMRLQLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEKLRNQRR 276          
BLAST of Pax6A vs. Ensembl Human
Match: PAX6 (paired box 6 [Source:HGNC Symbol;Acc:HGNC:8620])

HSP 1 Score: 266.159 bits (679), Expect = 1.924e-80
Identity = 125/150 (83.33%), Postives = 137/150 (91.33%), Query Frame = 2
Query:  299 HSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAATGMYDKLSLLSGQ 748
            HSG+NQLGG+FVNGRPLPDSTRQ+IVELAHSGARPCDISRILQVSNGCVSKIL RYYETGSIRP+AIGGSKPRVAT  VVSKIA YKRECPSIF+WEIRDRLL EGVC  DNIPSVSSINRVLR+L++E Q+  + A GMYDKL +L+GQ
Sbjct:    5 HSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVSKIAQYKRECPSIFAWEIRDRLLSEGVCTNDNIPSVSSINRVLRNLASEKQQ--MGADGMYDKLRMLNGQ 152          

HSP 2 Score: 145.206 bits (365), Expect = 5.747e-37
Identity = 64/83 (77.11%), Postives = 74/83 (89.16%), Query Frame = 2
Query: 1052 GVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQ 1300
            G  S+   MR++LKRKLQRNRTSF+ +Q+++LEKEFERTHYPDVFARE+LA KI LPEARIQVWFSNRRAKWRREEKLR QR+
Sbjct:  194 GEDSDEAQMRLQLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEKLRNQRR 276          
BLAST of Pax6A vs. Ensembl Human
Match: PAX6 (paired box 6 [Source:HGNC Symbol;Acc:HGNC:8620])

HSP 1 Score: 266.159 bits (679), Expect = 1.924e-80
Identity = 125/150 (83.33%), Postives = 137/150 (91.33%), Query Frame = 2
Query:  299 HSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAATGMYDKLSLLSGQ 748
            HSG+NQLGG+FVNGRPLPDSTRQ+IVELAHSGARPCDISRILQVSNGCVSKIL RYYETGSIRP+AIGGSKPRVAT  VVSKIA YKRECPSIF+WEIRDRLL EGVC  DNIPSVSSINRVLR+L++E Q+  + A GMYDKL +L+GQ
Sbjct:    5 HSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVSKIAQYKRECPSIFAWEIRDRLLSEGVCTNDNIPSVSSINRVLRNLASEKQQ--MGADGMYDKLRMLNGQ 152          

HSP 2 Score: 145.206 bits (365), Expect = 5.747e-37
Identity = 64/83 (77.11%), Postives = 74/83 (89.16%), Query Frame = 2
Query: 1052 GVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQ 1300
            G  S+   MR++LKRKLQRNRTSF+ +Q+++LEKEFERTHYPDVFARE+LA KI LPEARIQVWFSNRRAKWRREEKLR QR+
Sbjct:  194 GEDSDEAQMRLQLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEKLRNQRR 276          
BLAST of Pax6A vs. Ensembl Human
Match: PAX6 (paired box 6 [Source:HGNC Symbol;Acc:HGNC:8620])

HSP 1 Score: 266.159 bits (679), Expect = 1.924e-80
Identity = 125/150 (83.33%), Postives = 137/150 (91.33%), Query Frame = 2
Query:  299 HSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAATGMYDKLSLLSGQ 748
            HSG+NQLGG+FVNGRPLPDSTRQ+IVELAHSGARPCDISRILQVSNGCVSKIL RYYETGSIRP+AIGGSKPRVAT  VVSKIA YKRECPSIF+WEIRDRLL EGVC  DNIPSVSSINRVLR+L++E Q+  + A GMYDKL +L+GQ
Sbjct:    5 HSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVSKIAQYKRECPSIFAWEIRDRLLSEGVCTNDNIPSVSSINRVLRNLASEKQQ--MGADGMYDKLRMLNGQ 152          

HSP 2 Score: 145.206 bits (365), Expect = 5.747e-37
Identity = 64/83 (77.11%), Postives = 74/83 (89.16%), Query Frame = 2
Query: 1052 GVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQ 1300
            G  S+   MR++LKRKLQRNRTSF+ +Q+++LEKEFERTHYPDVFARE+LA KI LPEARIQVWFSNRRAKWRREEKLR QR+
Sbjct:  194 GEDSDEAQMRLQLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEKLRNQRR 276          
BLAST of Pax6A vs. Ensembl Celegans
Match: vab-3 (Uncharacterized protein; Variable abnormal-3 [Source:UniProtKB/TrEMBL;Acc:G5EDS1])

HSP 1 Score: 327.791 bits (839), Expect = 5.514e-104
Identity = 177/356 (49.72%), Postives = 231/356 (64.89%), Query Frame = 2
Query:  296 GHSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAATGMYDKLSLLSGQPXXXXXXXXXXXXXXXXXXXXXXXXFPNCGAYGGLTGIGIINGMSTAHAVASINQSNSGVTNYHVQSTTDSSDKHKSEKYSESIAHSESNASSEPGNEYMSGVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQNLMLG---SNGTSSTADTNVT 1354
            GH+G+NQLGG+FVNGRPLPD+TRQRIV+LAH G RPCDISR+LQVSNGCVSKILCRYYE+G+IRP+AIGGSKPRVATS VV KI  YKR+ PSIF+WEIRD+LL + +CN + IPSVSSINRVLR+L+ + ++ +   T +YD++ ++                            FP   ++ G   I  +NG     AV        G+  +      +   + + EK        +    +EP ++  + ++     ++ KL+R    NRTSF+  Q++SLEKEFERTHYPDVFARE+LA KI LPEARIQVWFSNRRAKWRREEK+R +R +  +    SNGT +    +VT
Sbjct:    5 GHTGVNQLGGVFVNGRPLPDATRQRIVDLAHKGCRPCDISRLLQVSNGCVSKILCRYYESGTIRPRAIGGSKPRVATSDVVEKIEDYKRDQPSIFAWEIRDKLLADNICNNETIPSVSSINRVLRNLAAKKEQ-VTMQTELYDRIRIVDN--------------------------FPYNSSWYGQWPIP-MNG-----AV--------GLNPFVPAPLIEPKTEGEFEK------DEDQKPPTEPEDDAAARMR-----LKRKLQR----NRTSFTQVQIESLEKEFERTHYPDVFARERLAQKIQLPEARIQVWFSNRRAKWRREEKMRNKRSSGTMDSSLSNGTPTPTPGSVT 304          
BLAST of Pax6A vs. Ensembl Celegans
Match: pax-2 (PAX (Paired box) transcription factor [Source:RefSeq peptide;Acc:NP_500513])

HSP 1 Score: 184.882 bits (468), Expect = 1.627e-52
Identity = 81/127 (63.78%), Postives = 106/127 (83.46%), Query Frame = 2
Query:  299 HSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLS 679
            H+G+NQLGG+FVNGRPLPD+ R +IVE++  G RPCDISR L+VS+GCVSKIL RYY TGS+RP  IGGSKP+VAT  VV  IA YKR  P++F+WEIR +L+++ +C ++N+PSVSSINR++R+ S
Sbjct:   30 HTGVNQLGGVFVNGRPLPDTIRAQIVEMSQHGTRPCDISRQLKVSHGCVSKILGRYYSTGSVRPGVIGGSKPKVATPRVVECIAGYKRANPTMFAWEIRQKLIEDQICGEENVPSVSSINRIVRNKS 156          
BLAST of Pax6A vs. Ensembl Celegans
Match: pax-2 (PAX (Paired box) transcription factor [Source:RefSeq peptide;Acc:NP_500513])

HSP 1 Score: 184.496 bits (467), Expect = 1.053e-51
Identity = 81/127 (63.78%), Postives = 106/127 (83.46%), Query Frame = 2
Query:  299 HSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLS 679
            H+G+NQLGG+FVNGRPLPD+ R +IVE++  G RPCDISR L+VS+GCVSKIL RYY TGS+RP  IGGSKP+VAT  VV  IA YKR  P++F+WEIR +L+++ +C ++N+PSVSSINR++R+ S
Sbjct:   92 HTGVNQLGGVFVNGRPLPDTIRAQIVEMSQHGTRPCDISRQLKVSHGCVSKILGRYYSTGSVRPGVIGGSKPKVATPRVVECIAGYKRANPTMFAWEIRQKLIEDQICGEENVPSVSSINRIVRNKS 218          
BLAST of Pax6A vs. Ensembl Celegans
Match: egl-38 (PAX protein; Uncharacterized protein [Source:UniProtKB/TrEMBL;Acc:G5ED14])

HSP 1 Score: 181.8 bits (460), Expect = 2.520e-51
Identity = 84/138 (60.87%), Postives = 109/138 (78.99%), Query Frame = 2
Query:  299 HSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAAT 712
            H+G+NQLGG+FVNGRPL D+ R +IVE++  G RPCDISR L+VS+GCVSKIL RYY TGS+RP  IGGSKP+VAT  VV  IA YKR  P++F+WEIR +L+++ +C ++N+PSVSSINR++R+ S   Q  L A T
Sbjct:   30 HTGVNQLGGVFVNGRPLADTVRAQIVEMSQHGTRPCDISRQLKVSHGCVSKILGRYYSTGSVRPGVIGGSKPKVATPRVVECIAGYKRANPTMFAWEIRQKLIEDQICGEENVPSVSSINRIVRNKSFMAQ--LAAPT 165          
BLAST of Pax6A vs. Ensembl Celegans
Match: pax-1 (PAX (Paired box) transcription factor [Source:RefSeq peptide;Acc:NP_505120])

HSP 1 Score: 160.229 bits (404), Expect = 3.427e-44
Identity = 74/121 (61.16%), Postives = 93/121 (76.86%), Query Frame = 2
Query:  308 INQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLR 670
            +NQLGG+FVNGRPLP   R +IVEL+  G RPCDISR L++S+GCVSKIL R+ E G+I P  IGGS+PRV T  VV  I + KR  P IF+WEIRDRL+   +C++ N+PSVSSI+R+LR
Sbjct:   65 VNQLGGVFVNGRPLPFEMRCKIVELSRQGTRPCDISRQLKISHGCVSKILTRFSENGTIMPGTIGGSRPRVTTPKVVEYIRSLKRSDPGIFAWEIRDRLISADICDRANLPSVSSISRILR 185          
BLAST of Pax6A vs. Ensembl Fly
Match: toy (twin of eyeless [Source:FlyBase gene name;Acc:FBgn0019650])

HSP 1 Score: 387.497 bits (994), Expect = 1.229e-125
Identity = 204/352 (57.95%), Postives = 249/352 (70.74%), Query Frame = 2
Query:  296 GHSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAAT-GMYDKLSLLSGQPXXXXXXXXXXXXXXXXXXXXXXXXFPNCGAYGGLTGIGIINGMSTAHAVASINQSNSGVTNYHVQSTTDSSDKHKSE-KYSESIAHSESNASSEPGNEYMSGVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQNL-MLGSNGTSSTAD 1342
            GHSGINQLGG++VNGRPLPDSTRQ+IVELAHSGARPCDISRILQVSNGCVSKIL RYYETGSI+P+AIGGSKPRVAT+ VV KIA YKRECPSIF+WEIRDRLL E VCN DNIPSVSSINRVLR+L+++ ++        +Y+KL + +GQ                       + +P+      LT       +  A +V +   + SG          D  D  K E ++S  ++H+ S+ S+  GN   +    E+  MR++LKRKLQRNRTSFS +Q+DSLEKEFERTHYPDVFARE+LADKI LPEARIQVWFSNRRAKWRREEK+R QR++   +  +G +STA+
Sbjct:   29 GHSGINQLGGVYVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIKPRAIGGSKPRVATTPVVQKIADYKRECPSIFAWEIRDRLLSEQVCNSDNIPSVSSINRVLRNLASQKEQQAQQQNESVYEKLRMFNGQ-------------------TGGWAWYPSNTTTAHLT-------LPPAASVVTSPANLSG--------QADRDDVQKRELQFSVEVSHTNSHDSTSDGNSEHNSSGDEDSQMRLRLKRKLQRNRTSFSNEQIDSLEKEFERTHYPDVFARERLADKIGLPEARIQVWFSNRRAKWRREEKMRTQRRSADTVDGSGRTSTAN 346          
BLAST of Pax6A vs. Ensembl Fly
Match: toy (twin of eyeless [Source:FlyBase gene name;Acc:FBgn0019650])

HSP 1 Score: 373.629 bits (958), Expect = 1.853e-120
Identity = 205/369 (55.56%), Postives = 252/369 (68.29%), Query Frame = 2
Query:  296 GHSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAAT-GMYDKLSLLSGQPXXXXXXXXXXXXXXXXXXXXXXXXFPNCGAYGGLTGIGIINGMSTAHAVASINQSNSGVTNYHVQSTTDSSDKHKSE-KYSESIAHSESNASSEPGNEYMSGVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQ--NLMLGSNGTS-------STADTNVTTNGNT 1369
            GHSGINQLGG++VNGRPLPDSTRQ+IVELAHSGARPCDISRILQVSNGCVSKIL RYYETGSI+P+AIGGSKPRVAT+ VV KIA YKRECPSIF+WEIRDRLL E VCN DNIPSVSSINRVLR+L+++ ++        +Y+KL + +GQ                       + +P+      LT       +  A +V +   + SG          D  D  K E ++S  ++H+ S+ S+  GN   +    E+  MR++LKRKLQRNRTSFS +Q+DSLEKEFERTHYPDVFARE+LADKI LPE    VWFSNRRAKWRREEK+R QR+  + + GS  TS       +TA ++V T+ N+
Sbjct:   29 GHSGINQLGGVYVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIKPRAIGGSKPRVATTPVVQKIADYKRECPSIFAWEIRDRLLSEQVCNSDNIPSVSSINRVLRNLASQKEQQAQQQNESVYEKLRMFNGQ-------------------TGGWAWYPSNTTTAHLT-------LPPAASVVTSPANLSG--------QADRDDVQKRELQFSVEVSHTNSHDSTSDGNSEHNSSGDEDSQMRLRLKRKLQRNRTSFSNEQIDSLEKEFERTHYPDVFARERLADKIGLPE----VWFSNRRAKWRREEKMRTQRRSADTVDGSGRTSTANNPSGTTASSSVATSNNS 359          
BLAST of Pax6A vs. Ensembl Fly
Match: ey (eyeless [Source:FlyBase gene name;Acc:FBgn0005558])

HSP 1 Score: 245.743 bits (626), Expect = 1.085e-69
Identity = 112/133 (84.21%), Postives = 124/133 (93.23%), Query Frame = 2
Query:  293 RGHSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQ 691
            +GHSG+NQLGG+FV GRPLPDSTRQ+IVELAHSGARPCDISRILQVSNGCVSKIL RYYETGSIRP+AIGGSKPRVAT+ VVSKI+ YKRECPSIF+WEIRDRLLQE VC  DNIPSVSSINRVLR+L+ + +
Sbjct:   36 KGHSGVNQLGGVFVGGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATAEVVSKISQYKRECPSIFAWEIRDRLLQENVCTNDNIPSVSSINRVLRNLAAQKE 168          

HSP 2 Score: 153.295 bits (386), Expect = 1.771e-38
Identity = 72/112 (64.29%), Postives = 85/112 (75.89%), Query Frame = 2
Query:  965 DKHKSEKYSESIAHSESNASSEPGNEYMSGVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQ 1300
            D H+S++       + +  +S  GN       +E+D  R+ LKRKLQRNRTSF+ DQ+DSLEKEFERTHYPDVFARE+LA KI LPEARIQVWFSNRRAKWRREEKLR QR+
Sbjct:  373 DGHQSDETGSGEGENSNGGASNIGN-------TEDDQARLILKRKLQRNRTSFTNDQIDSLEKEFERTHYPDVFARERLAGKIGLPEARIQVWFSNRRAKWRREEKLRNQRR 477          
BLAST of Pax6A vs. Ensembl Fly
Match: ey (eyeless [Source:FlyBase gene name;Acc:FBgn0005558])

HSP 1 Score: 242.662 bits (618), Expect = 1.558e-68
Identity = 111/131 (84.73%), Postives = 122/131 (93.13%), Query Frame = 2
Query:  299 HSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQ 691
            HSG+NQLGG+FV GRPLPDSTRQ+IVELAHSGARPCDISRILQVSNGCVSKIL RYYETGSIRP+AIGGSKPRVAT+ VVSKI+ YKRECPSIF+WEIRDRLLQE VC  DNIPSVSSINRVLR+L+ + +
Sbjct:   57 HSGVNQLGGVFVGGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATAEVVSKISQYKRECPSIFAWEIRDRLLQENVCTNDNIPSVSSINRVLRNLAAQKE 187          

HSP 2 Score: 152.91 bits (385), Expect = 2.347e-38
Identity = 72/112 (64.29%), Postives = 85/112 (75.89%), Query Frame = 2
Query:  965 DKHKSEKYSESIAHSESNASSEPGNEYMSGVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQ 1300
            D H+S++       + +  +S  GN       +E+D  R+ LKRKLQRNRTSF+ DQ+DSLEKEFERTHYPDVFARE+LA KI LPEARIQVWFSNRRAKWRREEKLR QR+
Sbjct:  392 DGHQSDETGSGEGENSNGGASNIGN-------TEDDQARLILKRKLQRNRTSFTNDQIDSLEKEFERTHYPDVFARERLAGKIGLPEARIQVWFSNRRAKWRREEKLRNQRR 496          
BLAST of Pax6A vs. Ensembl Fly
Match: ey (eyeless [Source:FlyBase gene name;Acc:FBgn0005558])

HSP 1 Score: 243.047 bits (619), Expect = 1.591e-68
Identity = 111/131 (84.73%), Postives = 122/131 (93.13%), Query Frame = 2
Query:  299 HSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQ 691
            HSG+NQLGG+FV GRPLPDSTRQ+IVELAHSGARPCDISRILQVSNGCVSKIL RYYETGSIRP+AIGGSKPRVAT+ VVSKI+ YKRECPSIF+WEIRDRLLQE VC  DNIPSVSSINRVLR+L+ + +
Sbjct:   98 HSGVNQLGGVFVGGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATAEVVSKISQYKRECPSIFAWEIRDRLLQENVCTNDNIPSVSSINRVLRNLAAQKE 228          

HSP 2 Score: 153.295 bits (386), Expect = 2.332e-38
Identity = 72/112 (64.29%), Postives = 85/112 (75.89%), Query Frame = 2
Query:  965 DKHKSEKYSESIAHSESNASSEPGNEYMSGVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQ 1300
            D H+S++       + +  +S  GN       +E+D  R+ LKRKLQRNRTSF+ DQ+DSLEKEFERTHYPDVFARE+LA KI LPEARIQVWFSNRRAKWRREEKLR QR+
Sbjct:  433 DGHQSDETGSGEGENSNGGASNIGN-------TEDDQARLILKRKLQRNRTSFTNDQIDSLEKEFERTHYPDVFARERLAGKIGLPEARIQVWFSNRRAKWRREEKLRNQRR 537          
BLAST of Pax6A vs. Ensembl Zebrafish
Match: pax6b (paired box 6b [Source:ZFIN;Acc:ZDB-GENE-001031-1])

HSP 1 Score: 264.233 bits (674), Expect = 1.948e-80
Identity = 124/150 (82.67%), Postives = 136/150 (90.67%), Query Frame = 2
Query:  299 HSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAATGMYDKLSLLSGQ 748
            HSG+NQLGG+FVNGRPLPDSTRQ+IVELAHSGARPCDISRILQVSNGCVSKIL RYYETGSIRP+AIGGSKPRVAT  VV KIA YKRECPSIF+WEIRDRLL EGVC  DNIPSVSSINRVLR+L++E Q+  + A GMYDKL +L+GQ
Sbjct:   24 HSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVGKIAQYKRECPSIFAWEIRDRLLSEGVCTNDNIPSVSSINRVLRNLASEKQQ--MGADGMYDKLRMLNGQ 171          

HSP 2 Score: 103.99 bits (258), Expect = 1.480e-23
Identity = 46/63 (73.02%), Postives = 55/63 (87.30%), Query Frame = 2
Query: 1052 GVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQV 1240
            G  S+   MR++LKRKLQRNRTSF+ +Q+++LEKEFERTHYPDVFARE+LA KI LPEARIQV
Sbjct:  213 GEDSDETQMRLQLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQV 275          
BLAST of Pax6A vs. Ensembl Zebrafish
Match: pax6b (paired box 6b [Source:ZFIN;Acc:ZDB-GENE-001031-1])

HSP 1 Score: 264.618 bits (675), Expect = 5.837e-80
Identity = 124/150 (82.67%), Postives = 136/150 (90.67%), Query Frame = 2
Query:  299 HSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAATGMYDKLSLLSGQ 748
            HSG+NQLGG+FVNGRPLPDSTRQ+IVELAHSGARPCDISRILQVSNGCVSKIL RYYETGSIRP+AIGGSKPRVAT  VV KIA YKRECPSIF+WEIRDRLL EGVC  DNIPSVSSINRVLR+L++E Q+  + A GMYDKL +L+GQ
Sbjct:   24 HSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVGKIAQYKRECPSIFAWEIRDRLLSEGVCTNDNIPSVSSINRVLRNLASEKQQ--MGADGMYDKLRMLNGQ 171          

HSP 2 Score: 144.821 bits (364), Expect = 5.067e-37
Identity = 64/83 (77.11%), Postives = 74/83 (89.16%), Query Frame = 2
Query: 1052 GVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQ 1300
            G  S+   MR++LKRKLQRNRTSF+ +Q+++LEKEFERTHYPDVFARE+LA KI LPEARIQVWFSNRRAKWRREEKLR QR+
Sbjct:  213 GEDSDETQMRLQLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEKLRNQRR 295          
BLAST of Pax6A vs. Ensembl Zebrafish
Match: pax6a (paired box 6a [Source:ZFIN;Acc:ZDB-GENE-990415-200])

HSP 1 Score: 262.692 bits (670), Expect = 2.817e-79
Identity = 123/150 (82.00%), Postives = 136/150 (90.67%), Query Frame = 2
Query:  299 HSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAATGMYDKLSLLSGQ 748
            HSG+NQLGG+FVNGRPLPDSTRQ+IVELAHSGARPCDISRILQVSNGCVSKIL RYYETGSIRP+AIGGSKPRVAT  VV KIA YKRECPSIF+WEIRDRLL EGVC  DNIPSVSSINRVLR+L++E Q+  + A GMY+KL +L+GQ
Sbjct:   24 HSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVGKIAQYKRECPSIFAWEIRDRLLSEGVCTNDNIPSVSSINRVLRNLASEKQQ--MGADGMYEKLRMLNGQ 171          

HSP 2 Score: 145.206 bits (365), Expect = 4.647e-37
Identity = 64/83 (77.11%), Postives = 74/83 (89.16%), Query Frame = 2
Query: 1052 GVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQ 1300
            G  S+   MR++LKRKLQRNRTSF+ +Q+++LEKEFERTHYPDVFARE+LA KI LPEARIQVWFSNRRAKWRREEKLR QR+
Sbjct:  213 GEDSDETQMRLQLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEKLRNQRR 295          
BLAST of Pax6A vs. Ensembl Zebrafish
Match: pax6b (paired box 6b [Source:ZFIN;Acc:ZDB-GENE-001031-1])

HSP 1 Score: 255.758 bits (652), Expect = 2.081e-76
Identity = 124/163 (76.07%), Postives = 136/163 (83.44%), Query Frame = 2
Query:  299 HSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQ-------------VSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAATGMYDKLSLLSGQ 748
            HSG+NQLGG+FVNGRPLPDSTRQ+IVELAHSGARPCDISRILQ             VSNGCVSKIL RYYETGSIRP+AIGGSKPRVAT  VV KIA YKRECPSIF+WEIRDRLL EGVC  DNIPSVSSINRVLR+L++E Q+  + A GMYDKL +L+GQ
Sbjct:   24 HSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQTHDDAKVQLDNKNVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVGKIAQYKRECPSIFAWEIRDRLLSEGVCTNDNIPSVSSINRVLRNLASEKQQ--MGADGMYDKLRMLNGQ 184          

HSP 2 Score: 144.821 bits (364), Expect = 7.043e-37
Identity = 64/83 (77.11%), Postives = 74/83 (89.16%), Query Frame = 2
Query: 1052 GVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQ 1300
            G  S+   MR++LKRKLQRNRTSF+ +Q+++LEKEFERTHYPDVFARE+LA KI LPEARIQVWFSNRRAKWRREEKLR QR+
Sbjct:  226 GEDSDETQMRLQLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEKLRNQRR 308          
BLAST of Pax6A vs. Ensembl Zebrafish
Match: pax6a (paired box 6a [Source:ZFIN;Acc:ZDB-GENE-990415-200])

HSP 1 Score: 254.988 bits (650), Expect = 3.094e-76
Identity = 124/165 (75.15%), Postives = 137/165 (83.03%), Query Frame = 2
Query:  296 GHSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQ--------------VSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAATGMYDKLSLLSGQ 748
            GHSG+NQLGG+FVNGRPLPDSTRQ+IVELAHSGARPCDISRILQ              VSNGCVSKIL RYYETGSIRP+AIGGSKPRVAT  VV KIA YKRECPSIF+WEIRDRLL EGVC  DNIPSVSSINRVLR+L++E Q+  + A GMY+KL +L+GQ
Sbjct:   13 GHSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQTHADAKVQVLDNENVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVGKIAQYKRECPSIFAWEIRDRLLSEGVCTNDNIPSVSSINRVLRNLASEKQQ--MGADGMYEKLRMLNGQ 175          

HSP 2 Score: 144.821 bits (364), Expect = 5.287e-37
Identity = 64/83 (77.11%), Postives = 74/83 (89.16%), Query Frame = 2
Query: 1052 GVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQ 1300
            G  S+   MR++LKRKLQRNRTSF+ +Q+++LEKEFERTHYPDVFARE+LA KI LPEARIQVWFSNRRAKWRREEKLR QR+
Sbjct:  217 GEDSDETQMRLQLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEKLRNQRR 299          
BLAST of Pax6A vs. Ensembl Xenopus
Match: pax6 (paired box 6 [Source:Xenbase;Acc:XB-GENE-484088])

HSP 1 Score: 267.314 bits (682), Expect = 5.064e-82
Identity = 126/151 (83.44%), Postives = 138/151 (91.39%), Query Frame = 2
Query:  296 GHSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAATGMYDKLSLLSGQ 748
            GHSG+NQLGG+FVNGRPLPDSTRQ+IVELAHSGARPCDISRILQVSNGCVSKIL RYYETGSIRP+AIGGSKPRVAT  VVSKIA YKRECPSIF+WEIRDRLL EGVC  DNIPSVSSINRVLR+L++E Q+  + A GMYDKL +L+GQ
Sbjct:    4 GHSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVSKIAQYKRECPSIFAWEIRDRLLSEGVCTNDNIPSVSSINRVLRNLASEKQQ--MGADGMYDKLRMLNGQ 152          

HSP 2 Score: 144.05 bits (362), Expect = 2.349e-37
Identity = 64/83 (77.11%), Postives = 74/83 (89.16%), Query Frame = 2
Query: 1052 GVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQ 1300
            G  S+   MR++LKRKLQRNRTSF+ +Q+++LEKEFERTHYPDVFARE+LA KI LPEARIQVWFSNRRAKWRREEKLR QR+
Sbjct:  196 GEDSDEAQMRLQLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEKLRNQRR 278          
BLAST of Pax6A vs. Ensembl Xenopus
Match: pax6 (paired box 6 [Source:Xenbase;Acc:XB-GENE-484088])

HSP 1 Score: 266.544 bits (680), Expect = 4.975e-81
Identity = 126/151 (83.44%), Postives = 138/151 (91.39%), Query Frame = 2
Query:  296 GHSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAATGMYDKLSLLSGQ 748
            GHSG+NQLGG+FVNGRPLPDSTRQ+IVELAHSGARPCDISRILQVSNGCVSKIL RYYETGSIRP+AIGGSKPRVAT  VVSKIA YKRECPSIF+WEIRDRLL EGVC  DNIPSVSSINRVLR+L++E Q+  + A GMYDKL +L+GQ
Sbjct:    4 GHSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVSKIAQYKRECPSIFAWEIRDRLLSEGVCTNDNIPSVSSINRVLRNLASEKQQ--MGADGMYDKLRMLNGQ 152          

HSP 2 Score: 144.05 bits (362), Expect = 4.743e-37
Identity = 64/83 (77.11%), Postives = 74/83 (89.16%), Query Frame = 2
Query: 1052 GVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQ 1300
            G  S+   MR++LKRKLQRNRTSF+ +Q+++LEKEFERTHYPDVFARE+LA KI LPEARIQVWFSNRRAKWRREEKLR QR+
Sbjct:  196 GEDSDEAQMRLQLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEKLRNQRR 278          
BLAST of Pax6A vs. Ensembl Xenopus
Match: pax5 (paired box 5 [Source:Xenbase;Acc:XB-GENE-479876])

HSP 1 Score: 213.001 bits (541), Expect = 1.343e-61
Identity = 127/305 (41.64%), Postives = 170/305 (55.74%), Query Frame = 2
Query:  296 GHSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNE--NQR-----HLVAATGMYDKLSLLSGQPXXXXXXXXXXXXXXXXXXXXXXXXFPNCGAYGGLTGIGIINGMSTAHAVASINQSNSGVTNYHVQSTTDSSDKHKSEKYSESIAHSESNASSEPGNEYMSGVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFA 1189
            GH G+NQLGG+FVNGRPLPD  RQRIVELAH G RPCDISR L+VS+GCVSKIL RYYETGSI+P  IGGSKP+VAT  VV KIA YKR+ P++F+WEIRDRLL E VC+ D +PSVSSINR++R+   +  NQ+     H + +TG   ++S +S                             + G+   ++GI                    G+T+    S  +++ + + E   ES      N  S PG ++          +R +++  L      F+  QLD L++ FER HY D+F 
Sbjct:   16 GHGGVNQLGGVFVNGRPLPDVVRQRIVELAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIKPGVIGGSKPKVATPKVVEKIAEYKRQNPTMFAWEIRDRLLAERVCDNDTVPSVSSINRIIRTKVQQPTNQQVPPSNHSIVSTGSVTQVSSVSTD---------------------------SAGSSYSISGI-------------------LGITS----SNAETNKRKRDEGIQESPV---PNGHSLPGRDF----------LRKQMRGDL------FTQQQLDVLDRVFERQHYTDIFT 251          
BLAST of Pax6A vs. Ensembl Xenopus
Match: pax2 (paired box 2 [Source:Xenbase;Acc:XB-GENE-486801])

HSP 1 Score: 199.904 bits (507), Expect = 5.956e-60
Identity = 91/121 (75.21%), Postives = 104/121 (85.95%), Query Frame = 2
Query:  296 GHSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSIN 658
            GH G+NQLGG+FVNGRPLPD  RQRIVELAH G RPCDISR L+VS+GCVSKIL RYYETGSI+P  IGGSKP+VAT  VV KIA YKR+ P++F+WEIRDRLL EG+C+ D +PSVSSIN
Sbjct:   16 GHGGVNQLGGVFVNGRPLPDVVRQRIVELAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIKPGVIGGSKPKVATPKVVDKIAEYKRQNPTMFAWEIRDRLLAEGICDNDTVPSVSSIN 136          
BLAST of Pax6A vs. Ensembl Xenopus
Match: pax2 (paired box 2 [Source:Xenbase;Acc:XB-GENE-486801])

HSP 1 Score: 209.534 bits (532), Expect = 2.877e-59
Identity = 93/126 (73.81%), Postives = 109/126 (86.51%), Query Frame = 2
Query:  296 GHSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRS 673
            GH G+NQLGG+FVNGRPLPD  RQRIVELAH G RPCDISR L+VS+GCVSKIL RYYETGSI+P  IGGSKP+VAT  VV KIA YKR+ P++F+WEIRDRLL EG+C+ D +PSVSSINR++R+
Sbjct:   16 GHGGVNQLGGVFVNGRPLPDVVRQRIVELAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIKPGVIGGSKPKVATPKVVDKIAEYKRQNPTMFAWEIRDRLLAEGICDNDTVPSVSSINRIIRT 141          
BLAST of Pax6A vs. Ensembl Mouse
Match: Pax6 (paired box 6 [Source:MGI Symbol;Acc:MGI:97490])

HSP 1 Score: 266.159 bits (679), Expect = 1.269e-80
Identity = 125/150 (83.33%), Postives = 137/150 (91.33%), Query Frame = 2
Query:  299 HSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAATGMYDKLSLLSGQ 748
            HSG+NQLGG+FVNGRPLPDSTRQ+IVELAHSGARPCDISRILQVSNGCVSKIL RYYETGSIRP+AIGGSKPRVAT  VVSKIA YKRECPSIF+WEIRDRLL EGVC  DNIPSVSSINRVLR+L++E Q+  + A GMYDKL +L+GQ
Sbjct:    5 HSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVSKIAQYKRECPSIFAWEIRDRLLSEGVCTNDNIPSVSSINRVLRNLASEKQQ--MGADGMYDKLRMLNGQ 152          

HSP 2 Score: 145.206 bits (365), Expect = 3.792e-37
Identity = 64/83 (77.11%), Postives = 74/83 (89.16%), Query Frame = 2
Query: 1052 GVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQ 1300
            G  S+   MR++LKRKLQRNRTSF+ +Q+++LEKEFERTHYPDVFARE+LA KI LPEARIQVWFSNRRAKWRREEKLR QR+
Sbjct:  194 GEDSDEAQMRLQLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEKLRNQRR 276          
BLAST of Pax6A vs. Ensembl Mouse
Match: Pax6 (paired box 6 [Source:MGI Symbol;Acc:MGI:97490])

HSP 1 Score: 266.159 bits (679), Expect = 1.269e-80
Identity = 125/150 (83.33%), Postives = 137/150 (91.33%), Query Frame = 2
Query:  299 HSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAATGMYDKLSLLSGQ 748
            HSG+NQLGG+FVNGRPLPDSTRQ+IVELAHSGARPCDISRILQVSNGCVSKIL RYYETGSIRP+AIGGSKPRVAT  VVSKIA YKRECPSIF+WEIRDRLL EGVC  DNIPSVSSINRVLR+L++E Q+  + A GMYDKL +L+GQ
Sbjct:    5 HSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVSKIAQYKRECPSIFAWEIRDRLLSEGVCTNDNIPSVSSINRVLRNLASEKQQ--MGADGMYDKLRMLNGQ 152          

HSP 2 Score: 145.206 bits (365), Expect = 3.792e-37
Identity = 64/83 (77.11%), Postives = 74/83 (89.16%), Query Frame = 2
Query: 1052 GVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQ 1300
            G  S+   MR++LKRKLQRNRTSF+ +Q+++LEKEFERTHYPDVFARE+LA KI LPEARIQVWFSNRRAKWRREEKLR QR+
Sbjct:  194 GEDSDEAQMRLQLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEKLRNQRR 276          
BLAST of Pax6A vs. Ensembl Mouse
Match: Pax6 (paired box 6 [Source:MGI Symbol;Acc:MGI:97490])

HSP 1 Score: 266.159 bits (679), Expect = 1.269e-80
Identity = 125/150 (83.33%), Postives = 137/150 (91.33%), Query Frame = 2
Query:  299 HSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAATGMYDKLSLLSGQ 748
            HSG+NQLGG+FVNGRPLPDSTRQ+IVELAHSGARPCDISRILQVSNGCVSKIL RYYETGSIRP+AIGGSKPRVAT  VVSKIA YKRECPSIF+WEIRDRLL EGVC  DNIPSVSSINRVLR+L++E Q+  + A GMYDKL +L+GQ
Sbjct:    5 HSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVSKIAQYKRECPSIFAWEIRDRLLSEGVCTNDNIPSVSSINRVLRNLASEKQQ--MGADGMYDKLRMLNGQ 152          

HSP 2 Score: 145.206 bits (365), Expect = 3.792e-37
Identity = 64/83 (77.11%), Postives = 74/83 (89.16%), Query Frame = 2
Query: 1052 GVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQ 1300
            G  S+   MR++LKRKLQRNRTSF+ +Q+++LEKEFERTHYPDVFARE+LA KI LPEARIQVWFSNRRAKWRREEKLR QR+
Sbjct:  194 GEDSDEAQMRLQLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEKLRNQRR 276          
BLAST of Pax6A vs. Ensembl Mouse
Match: Pax6 (paired box 6 [Source:MGI Symbol;Acc:MGI:97490])

HSP 1 Score: 266.159 bits (679), Expect = 1.269e-80
Identity = 125/150 (83.33%), Postives = 137/150 (91.33%), Query Frame = 2
Query:  299 HSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAATGMYDKLSLLSGQ 748
            HSG+NQLGG+FVNGRPLPDSTRQ+IVELAHSGARPCDISRILQVSNGCVSKIL RYYETGSIRP+AIGGSKPRVAT  VVSKIA YKRECPSIF+WEIRDRLL EGVC  DNIPSVSSINRVLR+L++E Q+  + A GMYDKL +L+GQ
Sbjct:    5 HSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVSKIAQYKRECPSIFAWEIRDRLLSEGVCTNDNIPSVSSINRVLRNLASEKQQ--MGADGMYDKLRMLNGQ 152          

HSP 2 Score: 145.206 bits (365), Expect = 3.792e-37
Identity = 64/83 (77.11%), Postives = 74/83 (89.16%), Query Frame = 2
Query: 1052 GVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQ 1300
            G  S+   MR++LKRKLQRNRTSF+ +Q+++LEKEFERTHYPDVFARE+LA KI LPEARIQVWFSNRRAKWRREEKLR QR+
Sbjct:  194 GEDSDEAQMRLQLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEKLRNQRR 276          
BLAST of Pax6A vs. Ensembl Mouse
Match: Pax6 (paired box 6 [Source:MGI Symbol;Acc:MGI:97490])

HSP 1 Score: 256.914 bits (655), Expect = 5.900e-77
Identity = 125/164 (76.22%), Postives = 137/164 (83.54%), Query Frame = 2
Query:  299 HSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQ--------------VSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAATGMYDKLSLLSGQ 748
            HSG+NQLGG+FVNGRPLPDSTRQ+IVELAHSGARPCDISRILQ              VSNGCVSKIL RYYETGSIRP+AIGGSKPRVAT  VVSKIA YKRECPSIF+WEIRDRLL EGVC  DNIPSVSSINRVLR+L++E Q+  + A GMYDKL +L+GQ
Sbjct:    5 HSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQTHADAKVQVLDNENVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVSKIAQYKRECPSIFAWEIRDRLLSEGVCTNDNIPSVSSINRVLRNLASEKQQ--MGADGMYDKLRMLNGQ 166          

HSP 2 Score: 145.206 bits (365), Expect = 4.503e-37
Identity = 64/83 (77.11%), Postives = 74/83 (89.16%), Query Frame = 2
Query: 1052 GVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQ 1300
            G  S+   MR++LKRKLQRNRTSF+ +Q+++LEKEFERTHYPDVFARE+LA KI LPEARIQVWFSNRRAKWRREEKLR QR+
Sbjct:  208 GEDSDEAQMRLQLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEKLRNQRR 290          
BLAST of Pax6A vs. UniProt
Match: sp|P63016|PAX6_RAT (Paired box protein Pax-6 OS=Rattus norvegicus GN=Pax6 PE=2 SV=1)

HSP 1 Score: 266.159 bits (679), Expect = 8.453e-80
Identity = 125/150 (83.33%), Postives = 137/150 (91.33%), Query Frame = 2
Query:  299 HSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAATGMYDKLSLLSGQ 748
            HSG+NQLGG+FVNGRPLPDSTRQ+IVELAHSGARPCDISRILQVSNGCVSKIL RYYETGSIRP+AIGGSKPRVAT  VVSKIA YKRECPSIF+WEIRDRLL EGVC  DNIPSVSSINRVLR+L++E Q+  + A GMYDKL +L+GQ
Sbjct:    5 HSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVSKIAQYKRECPSIFAWEIRDRLLSEGVCTNDNIPSVSSINRVLRNLASEKQQ--MGADGMYDKLRMLNGQ 152          

HSP 2 Score: 145.206 bits (365), Expect = 3.040e-36
Identity = 64/83 (77.11%), Postives = 74/83 (89.16%), Query Frame = 2
Query: 1052 GVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQ 1300
            G  S+   MR++LKRKLQRNRTSF+ +Q+++LEKEFERTHYPDVFARE+LA KI LPEARIQVWFSNRRAKWRREEKLR QR+
Sbjct:  194 GEDSDEAQMRLQLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEKLRNQRR 276          
BLAST of Pax6A vs. UniProt
Match: sp|Q1LZF1|PAX6_BOVIN (Paired box protein Pax-6 OS=Bos taurus GN=PAX6 PE=2 SV=1)

HSP 1 Score: 266.159 bits (679), Expect = 9.094e-80
Identity = 125/150 (83.33%), Postives = 137/150 (91.33%), Query Frame = 2
Query:  299 HSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAATGMYDKLSLLSGQ 748
            HSG+NQLGG+FVNGRPLPDSTRQ+IVELAHSGARPCDISRILQVSNGCVSKIL RYYETGSIRP+AIGGSKPRVAT  VVSKIA YKRECPSIF+WEIRDRLL EGVC  DNIPSVSSINRVLR+L++E Q+  + A GMYDKL +L+GQ
Sbjct:    5 HSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVSKIAQYKRECPSIFAWEIRDRLLSEGVCTNDNIPSVSSINRVLRNLASEKQQ--MGADGMYDKLRMLNGQ 152          

HSP 2 Score: 145.206 bits (365), Expect = 2.897e-36
Identity = 64/83 (77.11%), Postives = 74/83 (89.16%), Query Frame = 2
Query: 1052 GVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQ 1300
            G  S+   MR++LKRKLQRNRTSF+ +Q+++LEKEFERTHYPDVFARE+LA KI LPEARIQVWFSNRRAKWRREEKLR QR+
Sbjct:  194 GEDSDEAQMRLQLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEKLRNQRR 276          
BLAST of Pax6A vs. UniProt
Match: sp|P63015|PAX6_MOUSE (Paired box protein Pax-6 OS=Mus musculus GN=Pax6 PE=1 SV=1)

HSP 1 Score: 266.159 bits (679), Expect = 9.886e-80
Identity = 125/150 (83.33%), Postives = 137/150 (91.33%), Query Frame = 2
Query:  299 HSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAATGMYDKLSLLSGQ 748
            HSG+NQLGG+FVNGRPLPDSTRQ+IVELAHSGARPCDISRILQVSNGCVSKIL RYYETGSIRP+AIGGSKPRVAT  VVSKIA YKRECPSIF+WEIRDRLL EGVC  DNIPSVSSINRVLR+L++E Q+  + A GMYDKL +L+GQ
Sbjct:    5 HSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVSKIAQYKRECPSIFAWEIRDRLLSEGVCTNDNIPSVSSINRVLRNLASEKQQ--MGADGMYDKLRMLNGQ 152          

HSP 2 Score: 145.206 bits (365), Expect = 2.953e-36
Identity = 64/83 (77.11%), Postives = 74/83 (89.16%), Query Frame = 2
Query: 1052 GVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQ 1300
            G  S+   MR++LKRKLQRNRTSF+ +Q+++LEKEFERTHYPDVFARE+LA KI LPEARIQVWFSNRRAKWRREEKLR QR+
Sbjct:  194 GEDSDEAQMRLQLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEKLRNQRR 276          
BLAST of Pax6A vs. UniProt
Match: sp|P26367|PAX6_HUMAN (Paired box protein Pax-6 OS=Homo sapiens GN=PAX6 PE=1 SV=2)

HSP 1 Score: 266.159 bits (679), Expect = 9.886e-80
Identity = 125/150 (83.33%), Postives = 137/150 (91.33%), Query Frame = 2
Query:  299 HSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAATGMYDKLSLLSGQ 748
            HSG+NQLGG+FVNGRPLPDSTRQ+IVELAHSGARPCDISRILQVSNGCVSKIL RYYETGSIRP+AIGGSKPRVAT  VVSKIA YKRECPSIF+WEIRDRLL EGVC  DNIPSVSSINRVLR+L++E Q+  + A GMYDKL +L+GQ
Sbjct:    5 HSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVSKIAQYKRECPSIFAWEIRDRLLSEGVCTNDNIPSVSSINRVLRNLASEKQQ--MGADGMYDKLRMLNGQ 152          

HSP 2 Score: 145.206 bits (365), Expect = 2.953e-36
Identity = 64/83 (77.11%), Postives = 74/83 (89.16%), Query Frame = 2
Query: 1052 GVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQ 1300
            G  S+   MR++LKRKLQRNRTSF+ +Q+++LEKEFERTHYPDVFARE+LA KI LPEARIQVWFSNRRAKWRREEKLR QR+
Sbjct:  194 GEDSDEAQMRLQLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEKLRNQRR 276          
BLAST of Pax6A vs. UniProt
Match: sp|P47238|PAX6_COTJA (Paired box protein Pax-6 OS=Coturnix coturnix japonica GN=PAX6 PE=2 SV=1)

HSP 1 Score: 265.774 bits (678), Expect = 1.087e-79
Identity = 125/150 (83.33%), Postives = 137/150 (91.33%), Query Frame = 2
Query:  299 HSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAATGMYDKLSLLSGQ 748
            HSG+NQLGG+FVNGRPLPDSTRQ+IVELAHSGARPCDISRILQVSNGCVSKIL RYYETGSIRP+AIGGSKPRVAT  VVSKIA YKRECPSIF+WEIRDRLL EGVC  DNIPSVSSINRVLR+L++E Q+  + A GMYDKL +L+GQ
Sbjct:    5 HSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVSKIAQYKRECPSIFAWEIRDRLLSEGVCTNDNIPSVSSINRVLRNLASEKQQ--MGADGMYDKLRMLNGQ 152          

HSP 2 Score: 145.206 bits (365), Expect = 2.929e-36
Identity = 64/83 (77.11%), Postives = 74/83 (89.16%), Query Frame = 2
Query: 1052 GVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQ 1300
            G  S+   MR++LKRKLQRNRTSF+ +Q+++LEKEFERTHYPDVFARE+LA KI LPEARIQVWFSNRRAKWRREEKLR QR+
Sbjct:  194 GEDSDEAQMRLQLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEKLRNQRR 276          
BLAST of Pax6A vs. TrEMBL
Match: tr|I1ZI92|I1ZI92_SCHMD (Pax6A OS=Schmidtea mediterranea PE=2 SV=1)

HSP 1 Score: 1053.89 bits (2724), Expect = 0.000e+0
Identity = 553/553 (100.00%), Postives = 553/553 (100.00%), Query Frame = 2
Query:  236 SKPMTXXXXXXXXXXXXXXRGHSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAATGMYDKLSLLSGQPXXXXXXXXXXXXXXXXXXXXXXXXFPNCGAYGGLTGIGIINGMSTAHAVASINQSNSGVTNYHVQSTTDSSDKHKSEKYSESIAHSESNASSEPGNEYMSGVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQNLMLGSNGTSSTADTNVTTNGNTQCLSTTGQNSMGFSGINDIRNQFGDVGMQTPSLSAVAAAGMYHSAVASAADQYAKSAGLPNLSQSSINSPYSYMANLQSRSSGSQIDLPNVTSNSNSFYNPGSVYPPSLFQGVMRGYDTIGYPKYPSAMFPGSLESNNNINPAGFLANNMSSNSSKPDYDFSAFNRPSNYWTPVA 1894
            SKPMTESNEEEIKNKKKVKRGHSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAATGMYDKLSLLSGQPWSTAAAHAAWYSSAAAAHGYASSTFPNCGAYGGLTGIGIINGMSTAHAVASINQSNSGVTNYHVQSTTDSSDKHKSEKYSESIAHSESNASSEPGNEYMSGVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQNLMLGSNGTSSTADTNVTTNGNTQCLSTTGQNSMGFSGINDIRNQFGDVGMQTPSLSAVAAAGMYHSAVASAADQYAKSAGLPNLSQSSINSPYSYMANLQSRSSGSQIDLPNVTSNSNSFYNPGSVYPPSLFQGVMRGYDTIGYPKYPSAMFPGSLESNNNINPAGFLANNMSSNSSKPDYDFSAFNRPSNYWTPVA
Sbjct:   12 SKPMTESNEEEIKNKKKVKRGHSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAATGMYDKLSLLSGQPWSTAAAHAAWYSSAAAAHGYASSTFPNCGAYGGLTGIGIINGMSTAHAVASINQSNSGVTNYHVQSTTDSSDKHKSEKYSESIAHSESNASSEPGNEYMSGVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQNLMLGSNGTSSTADTNVTTNGNTQCLSTTGQNSMGFSGINDIRNQFGDVGMQTPSLSAVAAAGMYHSAVASAADQYAKSAGLPNLSQSSINSPYSYMANLQSRSSGSQIDLPNVTSNSNSFYNPGSVYPPSLFQGVMRGYDTIGYPKYPSAMFPGSLESNNNINPAGFLANNMSSNSSKPDYDFSAFNRPSNYWTPVA 564          
BLAST of Pax6A vs. TrEMBL
Match: tr|O97038|O97038_DUGJA (DjPax-6 OS=Dugesia japonica GN=DjPax-6 PE=2 SV=1)

HSP 1 Score: 1025.77 bits (2651), Expect = 0.000e+0
Identity = 523/534 (97.94%), Postives = 529/534 (99.06%), Query Frame = 2
Query:  293 RGHSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAATGMYDKLSLLSGQPXXXXXXXXXXXXXXXXXXXXXXXXFPNCGAYGGLTGIGIINGMSTAHAVASINQSNSGVTNYHVQSTTDSSDKHKSEKYSESIAHSESNASSEPGNEYMSGVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQNLMLGSNGTSSTADTNVTTNGNTQCLSTTGQNSMGFSGINDIRNQFGDVGMQTPSLSAVAAAGMYHSAVASAADQYAKSAGLPNLSQSSINSPYSYMANLQSRSSGSQIDLPNVTSNSNSFYNPGSVYPPSLFQGVMRGYDTIGYPKYPSAMFPGSLESNNNINPAGFLANNMSSNSSKPDYDFSAFNRPSNYWTPVA 1894
            RGHSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAATGMYDKLSLLSGQPWSTAAAHAAWYSSAAAAHGYASSTFPNCGAYGGLTGIGIINGMSTAHAVASINQSNSGV NYHVQSTTDSSDK KSEKYSESIAHSESNASSEPGNEYMSGVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQNLMLGS+GTSSTA+TNVTTNGNTQCLSTTGQNSMGFSGI DIRNQFGDVGMQTPSLSAVAAAGMYHSAVASAADQYAKSAGLPNLSQSSINSPYSYMANLQSRSSGSQIDLPNVTSNSNSFYNPGSVYPPSLFQGVMRGYDTIGYPKYP+AMFPGSLESN+NIN AGFLANNMS+NS+KPDYDFSAFNR SNYWTPVA
Sbjct:   17 RGHSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAATGMYDKLSLLSGQPWSTAAAHAAWYSSAAAAHGYASSTFPNCGAYGGLTGIGIINGMSTAHAVASINQSNSGVNNYHVQSTTDSSDKLKSEKYSESIAHSESNASSEPGNEYMSGVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQNLMLGSSGTSSTAETNVTTNGNTQCLSTTGQNSMGFSGIADIRNQFGDVGMQTPSLSAVAAAGMYHSAVASAADQYAKSAGLPNLSQSSINSPYSYMANLQSRSSGSQIDLPNVTSNSNSFYNPGSVYPPSLFQGVMRGYDTIGYPKYPTAMFPGSLESNSNINAAGFLANNMSTNSAKPDYDFSAFNRTSNYWTPVA 550          
BLAST of Pax6A vs. TrEMBL
Match: tr|Q95UT4|Q95UT4_GIRTI (Pax6A (Fragment) OS=Girardia tigrina PE=2 SV=1)

HSP 1 Score: 869.381 bits (2245), Expect = 0.000e+0
Identity = 445/464 (95.91%), Postives = 455/464 (98.06%), Query Frame = 2
Query:  437 GCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAATGMYDKLSLLSGQPXXXXXXXXXXXXXXXXXXXXXXXXFPNCGAYGGLTGIGIINGMSTAHAVASINQSNSGVTNYHVQSTTDSSDKHKSEKYSESIAHSESNASSEPGNEYMSGVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQNLMLGSNGTSSTADTNVTTNGNTQCLSTTGQNSMGFSGINDIRNQFGDVGMQTPSLSAVAAAGMYHSAVASAADQYAKSAGLPNLSQSSINSPYSYMANLQSRSSGSQIDLPNVTSNSNSFYNPGSVYPPSLFQGVMRGYDTIGYPKYPSAMFPGSLESNNNINPAGFLANNMSSN 1828
            GCVSKILCRYYETGSIRPKAIGGSKP VATSSVVSK AAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAATGMYDKLSLLSGQPWSTAAAHAAWYS AAAAHGYASSTFPNCGAYGGLTGIGIINGMSTAHAVASINQSNSGV NYHVQST DSS KHKSEKYSESIAHSESNASSEPGNEY+SGVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQNLMLGS+GTSSTA+TNVTTNGNTQCLSTTGQ+SMGF+GINDIRNQFGDVGMQTPSLSAVAAAGMYHS VASAADQYAKSAGLPNLSQSSINSPYSYMANLQSRS+GSQIDLPNV+SNSNSFYNPGSVYPPSLFQGVMRGYDTIGYPKYP+AMF GSLE+NNNIN AGFLANNMS+N
Sbjct:    1 GCVSKILCRYYETGSIRPKAIGGSKPTVATSSVVSKTAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAATGMYDKLSLLSGQPWSTAAAHAAWYSCAAAAHGYASSTFPNCGAYGGLTGIGIINGMSTAHAVASINQSNSGVNNYHVQSTADSSGKHKSEKYSESIAHSESNASSEPGNEYLSGVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQNLMLGSSGTSSTAETNVTTNGNTQCLSTTGQSSMGFTGINDIRNQFGDVGMQTPSLSAVAAAGMYHSVVASAADQYAKSAGLPNLSQSSINSPYSYMANLQSRSNGSQIDLPNVSSNSNSFYNPGSVYPPSLFQGVMRGYDTIGYPKYPTAMFRGSLETNNNINTAGFLANNMSTN 464          
BLAST of Pax6A vs. TrEMBL
Match: tr|H6V052|H6V052_SCHPL (PAX6 (Fragment) OS=Schmidtea polychroa GN=pax6 PE=2 SV=1)

HSP 1 Score: 619.387 bits (1596), Expect = 0.000e+0
Identity = 326/326 (100.00%), Postives = 326/326 (100.00%), Query Frame = 2
Query:  503 GSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAATGMYDKLSLLSGQPXXXXXXXXXXXXXXXXXXXXXXXXFPNCGAYGGLTGIGIINGMSTAHAVASINQSNSGVTNYHVQSTTDSSDKHKSEKYSESIAHSESNASSEPGNEYMSGVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQNLMLGSNGTSSTADTNVTTNGNTQCLSTTGQNSMGFSGINDIRNQFGDVGMQTPSLSAVA 1480
            GSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAATGMYDKLSLLSGQPWSTAAAHAAWYSSAAAAHGYASSTFPNCGAYGGLTGIGIINGMSTAHAVASINQSNSGVTNYHVQSTTDSSDKHKSEKYSESIAHSESNASSEPGNEYMSGVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQNLMLGSNGTSSTADTNVTTNGNTQCLSTTGQNSMGFSGINDIRNQFGDVGMQTPSLSAVA
Sbjct:    1 GSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAATGMYDKLSLLSGQPWSTAAAHAAWYSSAAAAHGYASSTFPNCGAYGGLTGIGIINGMSTAHAVASINQSNSGVTNYHVQSTTDSSDKHKSEKYSESIAHSESNASSEPGNEYMSGVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQNLMLGSNGTSSTADTNVTTNGNTQCLSTTGQNSMGFSGINDIRNQFGDVGMQTPSLSAVA 326          
BLAST of Pax6A vs. TrEMBL
Match: tr|T1E1D9|T1E1D9_9PLAT (Pax6A (Fragment) OS=Dendrocoelum lacteum PE=2 SV=1)

HSP 1 Score: 573.548 bits (1477), Expect = 0.000e+0
Identity = 291/344 (84.59%), Postives = 315/344 (91.57%), Query Frame = 2
Query:  293 RGHSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQRHLVAATGMYDKLSLLSGQPXXXXXXXXXXXXXXXXXXXX-XXXXFPNCGAYGGLTGIGIINGMSTAHAVASINQSNSGVTNYHVQSTTDSSDKHKSEKYSESIAHSESNASSEPGNEYMSGVKSENDDMRIKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQRQNLMLGSN 1321
            RGHSG+NQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVV+KIA YKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNEN R L AATGMYDKLSLLSGQPWS+AAA  A + S+AAA    ASSTFPNCG YG LTGIGIINGM++AHAVAS+NQSNS + NY +Q++ +S    +  K + S++ SESNASSE G++YMSG+K ENDDMR+KLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKI+LPEARIQVWFSNRRAKWRREEKLRRQRQNLM+G+N
Sbjct:   17 RGHSGVNQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVAKIAGYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENHRQLAAATGMYDKLSLLSGQPWSSAAAAHAAWYSSAAAAHGYASSTFPNCGTYGSLTGIGIINGMNSAHAVASMNQSNSSINNYQLQTSAES----EKPKSAGSVSQSESNASSENGHDYMSGLKGENDDMRVKLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKITLPEARIQVWFSNRRAKWRREEKLRRQRQNLMIGNN 356          
The following BLAST results are available for this feature:
BLAST of Pax6A vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Human)
Total hits: 5
Match NameE-valueIdentityDescription
PAX61.924e-8083.33paired box 6 [Source:HGNC Symbol;Acc:HGNC:8620][more]
PAX61.924e-8083.33paired box 6 [Source:HGNC Symbol;Acc:HGNC:8620][more]
PAX61.924e-8083.33paired box 6 [Source:HGNC Symbol;Acc:HGNC:8620][more]
PAX61.924e-8083.33paired box 6 [Source:HGNC Symbol;Acc:HGNC:8620][more]
PAX61.924e-8083.33paired box 6 [Source:HGNC Symbol;Acc:HGNC:8620][more]
back to top
BLAST of Pax6A vs. Ensembl Celegans
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Celegan)
Total hits: 5
Match NameE-valueIdentityDescription
vab-35.514e-10449.72Uncharacterized protein; Variable abnormal-3 [Sou... [more]
pax-21.627e-5263.78PAX (Paired box) transcription factor [Source:Ref... [more]
pax-21.053e-5163.78PAX (Paired box) transcription factor [Source:Ref... [more]
egl-382.520e-5160.87PAX protein; Uncharacterized protein [Source:UniP... [more]
pax-13.427e-4461.16PAX (Paired box) transcription factor [Source:Ref... [more]
back to top
BLAST of Pax6A vs. Ensembl Fly
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Drosophila)
Total hits: 5
Match NameE-valueIdentityDescription
toy1.229e-12557.95twin of eyeless [Source:FlyBase gene name;Acc:FBgn... [more]
toy1.853e-12055.56twin of eyeless [Source:FlyBase gene name;Acc:FBgn... [more]
ey1.085e-6984.21eyeless [Source:FlyBase gene name;Acc:FBgn0005558][more]
ey1.558e-6884.73eyeless [Source:FlyBase gene name;Acc:FBgn0005558][more]
ey1.591e-6884.73eyeless [Source:FlyBase gene name;Acc:FBgn0005558][more]
back to top
BLAST of Pax6A vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Zebrafish)
Total hits: 5
Match NameE-valueIdentityDescription
pax6b1.948e-8082.67paired box 6b [Source:ZFIN;Acc:ZDB-GENE-001031-1][more]
pax6b5.837e-8082.67paired box 6b [Source:ZFIN;Acc:ZDB-GENE-001031-1][more]
pax6a2.817e-7982.00paired box 6a [Source:ZFIN;Acc:ZDB-GENE-990415-200... [more]
pax6b2.081e-7676.07paired box 6b [Source:ZFIN;Acc:ZDB-GENE-001031-1][more]
pax6a3.094e-7675.15paired box 6a [Source:ZFIN;Acc:ZDB-GENE-990415-200... [more]
back to top
BLAST of Pax6A vs. Ensembl Xenopus
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Xenopus)
Total hits: 5
Match NameE-valueIdentityDescription
pax65.064e-8283.44paired box 6 [Source:Xenbase;Acc:XB-GENE-484088][more]
pax64.975e-8183.44paired box 6 [Source:Xenbase;Acc:XB-GENE-484088][more]
pax51.343e-6141.64paired box 5 [Source:Xenbase;Acc:XB-GENE-479876][more]
pax25.956e-6075.21paired box 2 [Source:Xenbase;Acc:XB-GENE-486801][more]
pax22.877e-5973.81paired box 2 [Source:Xenbase;Acc:XB-GENE-486801][more]
back to top
BLAST of Pax6A vs. Ensembl Mouse
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Mouse)
Total hits: 5
Match NameE-valueIdentityDescription
Pax61.269e-8083.33paired box 6 [Source:MGI Symbol;Acc:MGI:97490][more]
Pax61.269e-8083.33paired box 6 [Source:MGI Symbol;Acc:MGI:97490][more]
Pax61.269e-8083.33paired box 6 [Source:MGI Symbol;Acc:MGI:97490][more]
Pax61.269e-8083.33paired box 6 [Source:MGI Symbol;Acc:MGI:97490][more]
Pax65.900e-7776.22paired box 6 [Source:MGI Symbol;Acc:MGI:97490][more]
back to top
BLAST of Pax6A vs. UniProt
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P63016|PAX6_RAT8.453e-8083.33Paired box protein Pax-6 OS=Rattus norvegicus GN=P... [more]
sp|Q1LZF1|PAX6_BOVIN9.094e-8083.33Paired box protein Pax-6 OS=Bos taurus GN=PAX6 PE=... [more]
sp|P63015|PAX6_MOUSE9.886e-8083.33Paired box protein Pax-6 OS=Mus musculus GN=Pax6 P... [more]
sp|P26367|PAX6_HUMAN9.886e-8083.33Paired box protein Pax-6 OS=Homo sapiens GN=PAX6 P... [more]
sp|P47238|PAX6_COTJA1.087e-7983.33Paired box protein Pax-6 OS=Coturnix coturnix japo... [more]
back to top
BLAST of Pax6A vs. TrEMBL
Analysis Date: 2017-05-17 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
tr|I1ZI92|I1ZI92_SCHMD0.000e+0100.00Pax6A OS=Schmidtea mediterranea PE=2 SV=1[more]
tr|O97038|O97038_DUGJA0.000e+097.94DjPax-6 OS=Dugesia japonica GN=DjPax-6 PE=2 SV=1[more]
tr|Q95UT4|Q95UT4_GIRTI0.000e+095.91Pax6A (Fragment) OS=Girardia tigrina PE=2 SV=1[more]
tr|H6V052|H6V052_SCHPL0.000e+0100.00PAX6 (Fragment) OS=Schmidtea polychroa GN=pax6 PE=... [more]
tr|T1E1D9|T1E1D9_9PLAT0.000e+084.59Pax6A (Fragment) OS=Dendrocoelum lacteum PE=2 SV=1[more]
back to top
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2016-09-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001523Paired domainPRINTSPR00027PAIREDBOXcoord: 49..67
score: 82.85
coord: 87..104
score: 77.4
coord: 69..86
score: 84.64
coord: 31..46
score: 83.36
IPR001523Paired domainSMARTSM00351pax3coord: 27..151
e-value: 9.4E-90
score: 314.2
IPR001523Paired domainPFAMPF00292PAXcoord: 27..151
e-value: 2.5E-68
score: 227.6
IPR001523Paired domainPROSITEPS00034PAIRED_1coord: 61..77
IPR001523Paired domainPROSITEPS51057PAIRED_2coord: 27..153
score: 62.635
IPR001356Homeobox domainSMARTSM00389HOX_1coord: 295..357
e-value: 5.2E-25
score: 99.1
IPR001356Homeobox domainPFAMPF00046Homeoboxcoord: 297..352
e-value: 1.7E-21
score: 75.6
IPR001356Homeobox domainPROSITEPS50071HOMEOBOX_2coord: 293..353
score: 19.937
IPR011991Winged helix-turn-helix DNA-binding domainGENE3DG3DSA:1.10.10.10coord: 96..158
e-value: 2.2E-34
score: 116.5
IPR011991Winged helix-turn-helix DNA-binding domainGENE3DG3DSA:1.10.10.10coord: 30..95
e-value: 4.6E-40
score: 134.8
IPR009057Homeodomain-likeGENE3DG3DSA:1.10.10.60coord: 268..355
e-value: 2.8E-26
score: 90.9
IPR009057Homeodomain-likeSUPERFAMILYSSF46689Homeodomain-likecoord: 279..354
IPR009057Homeodomain-likeSUPERFAMILYSSF46689Homeodomain-likecoord: 29..152
IPR017970Homeobox, conserved sitePROSITEPS00027HOMEOBOX_1coord: 328..351
NoneNo IPR availableTMHMMTMhelixcoord: 10..32
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..22
score: 0.504
NoneNo IPR availableTMHMMTMhelixcoord: 13..35
NoneNo IPR availableTMHMMTMhelixcoord: 7..29
NoneNo IPR availableTMHMMTMhelixcoord: 4..26
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..21
score: 0.568

Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR001523Paired_dom
IPR001356Homeobox_dom
IPR011991WHTH_DNA-bd_dom
IPR009057Homeodomain-like
IPR017970Homeobox_CS
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO:0006351transcription, DNA-templated
GO:0007275multicellular organism development
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0043565sequence-specific DNA binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
Vocabulary: Schmidtea mediterranea Developmental Stages
TermDefinition
PLANA:0000007Stage 7
PLANA:0000005Stage 5
PLANA:0000006Stage 6
PLANA:0000008Stage 8
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000012neural progenitor
PLANA:0000044cephalic ganglia
PLANA:0000025nervous system
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024586 ID=SMED30024586|Name=Pax6A|organism=Schmidtea mediterranea sexual|type=transcript|length=1992bp
GTTGGTTTTTCTAACAGATTTATTAATGCTAGATTGGCCGCTCAAGATTA
ATCATAATATTCTGCTACTTTACTGATATAATTTTTATACACGGTTACTA
CTACTCCTCTACTATTTTCGCATTGTTGGCTTCTCAAATTCAATCCCTGG
GCATAAATCAAACCGCTTCATTGACAAAATCCTTTTTGACACTACAAGAA
ATTGATTCAGTTACTGAAGTAGAAAATATACACAGTCGAAACCTATGACC
GAATCGAATGAAGAGGAAATAAAAAATAAAAAGAAAGTTAAACGAGGACA
TTCAGGAATCAATCAATTAGGTGGAATGTTTGTCAACGGTCGACCTTTGC
CCGATTCGACCCGACAGAGAATCGTTGAGTTGGCTCACTCCGGAGCGAGA
CCATGTGATATTTCCCGAATCCTCCAAGTTTCCAATGGATGCGTCAGTAA
AATCCTATGCAGATACTACGAAACCGGTTCAATTCGACCGAAAGCCATCG
GAGGCAGCAAACCAAGAGTAGCTACCAGTTCAGTTGTGTCGAAAATTGCC
GCCTACAAACGTGAATGCCCGTCGATATTTTCTTGGGAAATTCGCGATAG
ATTATTACAGGAAGGGGTTTGCAATCAGGATAACATTCCCAGTGTCTCTT
CGATAAATCGTGTTCTACGCAGTTTGTCTAATGAAAACCAACGACATTTA
GTTGCAGCAACTGGAATGTATGACAAACTGTCATTGTTAAGCGGCCAGCC
TTGGTCTACTGCAGCTGCTCATGCGGCTTGGTATTCCAGTGCTGCAGCAG
CACATGGGTATGCTTCATCGACATTTCCCAATTGTGGTGCCTATGGAGGC
TTAACCGGAATCGGAATTATCAATGGAATGAGTACAGCCCACGCGGTAGC
GTCAATTAATCAGTCGAATTCCGGGGTCACAAATTACCATGTTCAATCAA
CAACCGATAGTTCCGACAAACACAAATCAGAAAAATATTCAGAATCCATT
GCACATTCTGAATCGAATGCTTCCAGTGAGCCTGGCAACGAATATATGTC
CGGAGTAAAAAGTGAGAATGATGATATGAGAATTAAACTGAAAAGGAAAC
TTCAAAGAAATCGAACATCGTTTTCAACAGATCAGCTTGATTCTTTGGAA
AAAGAATTTGAACGAACTCATTATCCTGATGTATTCGCCAGAGAGAAATT
GGCAGACAAAATCAGTCTTCCAGAGGCGAGAATACAAGTTTGGTTTTCAA
ATCGAAGAGCAAAATGGAGACGAGAAGAAAAACTTCGTCGACAACGGCAA
AATCTTATGCTTGGTTCAAACGGAACAAGTTCTACTGCTGATACTAATGT
AACAACAAATGGAAATACTCAATGTTTGTCGACAACCGGACAAAATTCAA
TGGGATTTTCTGGAATAAATGATATCAGAAACCAATTTGGTGATGTTGGA
ATGCAAACACCTTCATTGTCGGCTGTAGCAGCTGCAGGAATGTACCATTC
GGCAGTTGCCTCTGCTGCAGATCAGTATGCAAAATCAGCCGGTTTACCAA
ATCTTTCGCAATCGTCAATCAATTCTCCATATTCCTACATGGCAAATTTG
CAGTCGAGATCCAGTGGTTCCCAAATTGACTTGCCAAACGTTACAAGCAA
TTCAAATTCTTTTTACAACCCCGGATCAGTTTATCCCCCAAGTTTATTTC
AAGGTGTAATGAGAGGATATGACACCATTGGATATCCCAAGTATCCTTCA
GCAATGTTTCCAGGATCACTCGAAAGTAATAATAATATCAACCCTGCCGG
TTTTCTTGCAAATAATATGTCTTCGAATTCATCTAAACCCGATTACGATT
TCTCAGCATTTAATCGGCCCAGCAATTATTGGACTCCGGTCGCATAAAAT
TGCACAAATGAATGAAAACAATTTCAAAAATTCCGAAACAACAATGATTA
GAACAAAAAAAACATTTTTCTAAAATAGTTGTTAATTTAAAC
back to top

protein sequence of SMED30024586-orf-1

>SMED30024586-orf-1 ID=SMED30024586-orf-1|Name=SMED30024586-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=551bp
MTESNEEEIKNKKKVKRGHSGINQLGGMFVNGRPLPDSTRQRIVELAHSG
ARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSK
IAAYKRECPSIFSWEIRDRLLQEGVCNQDNIPSVSSINRVLRSLSNENQR
HLVAATGMYDKLSLLSGQPWSTAAAHAAWYSSAAAAHGYASSTFPNCGAY
GGLTGIGIINGMSTAHAVASINQSNSGVTNYHVQSTTDSSDKHKSEKYSE
SIAHSESNASSEPGNEYMSGVKSENDDMRIKLKRKLQRNRTSFSTDQLDS
LEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEKLRRQ
RQNLMLGSNGTSSTADTNVTTNGNTQCLSTTGQNSMGFSGINDIRNQFGD
VGMQTPSLSAVAAAGMYHSAVASAADQYAKSAGLPNLSQSSINSPYSYMA
NLQSRSSGSQIDLPNVTSNSNSFYNPGSVYPPSLFQGVMRGYDTIGYPKY
PSAMFPGSLESNNNINPAGFLANNMSSNSSKPDYDFSAFNRPSNYWTPVA
*
back to top
Aliases
The feature 'Pax6A' has the following synonyms
Synonym
pax6A
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30024586
GenBankAFJ24746.1