Peptidase inhibitor 16

Overview
NamePeptidase inhibitor 16
Smed IDSMED30024584
Length (bp)613
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Peptidase inhibitor 16 (SMED30024584) t-SNE clustered cells

Violin plots show distribution of expression levels for Peptidase inhibitor 16 (SMED30024584) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Peptidase inhibitor 16 (SMED30024584) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Peptidase inhibitor 16 (SMED30024584) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024584

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
tail regionSMED30024584h1SMcG0009056 SmedASXL_017330SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
tail regionSMED30024584h1SMcG0009056 SmedASXL_017332SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
tail regionSMED30024584h1SMcG0009056 SmedASXL_017331SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
parenchymaSMED30024584h1SMcG0009055 dd_940dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
parenchymaSMED30024584h1SMcG0009076 dd_940dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
parenchymaSMED30024584h1SMcG0009011 dd_940dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
parenchymaSMED30024584h1SMcG0009056 dd_940dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
secretory systemSMED30024584h1SMcG0009055 dd_Smed_v6_940_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
secretory systemSMED30024584h1SMcG0009011 dd_Smed_v6_940_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
secretory systemSMED30024584h1SMcG0009056 dd_Smed_v6_940_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
secretory systemSMED30024584h1SMcG0009076 dd_Smed_v6_940_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Peptidase inhibitor 16 vs. Ensembl Human
Match: PI16 (peptidase inhibitor 16 [Source:HGNC Symbol;Acc:HGNC:21245])

HSP 1 Score: 102.834 bits (255), Expect = 4.644e-25
Identity = 69/190 (36.32%), Postives = 100/190 (52.63%), Query Frame = 2
Query:   53 GDLTDRQKKEILGDHNGYRSYVASGGAQQPSAANMLKLKWSAESASKAQNLADQCKFDNVTMEDISYGTYKSVGNNSELL--TEDIYISNPVYKFFEWLQDAFSYDVSTNTCKSP--TCEHHAQMIWADSQELGCGMSNCDTSQ-VKQSYI---ICIYGPGGDVNLKPPYISGPPCSQCPIGTSCVNSLC 598
            G LTD +K+ ++  HN YR+ V+      P+A++ML ++W  E A+ A+  A QC           +G  K  G   E L    D  +  P+    EW  +   Y++S  TC SP   C H+ Q++WA ++ +GCG   C+  Q V+++ I   +C Y P G+V  K PY  G PCSQCP G  C NSLC
Sbjct:   26 GALTDEEKRLMVELHNLYRAQVS------PTASDMLHMRWDEELAAFAKAYARQC----------VWGHNKERGRRGENLFAITDEGMDVPL-AMEEWHHEREHYNLSAATC-SPGQMCGHYTQVVWAKTERIGCGSHFCEKLQGVEETNIELLVCNYEPPGNVKGKRPYQEGTPCSQCPSGYHCKNSLC 197          
BLAST of Peptidase inhibitor 16 vs. Ensembl Human
Match: PI16 (peptidase inhibitor 16 [Source:HGNC Symbol;Acc:HGNC:21245])

HSP 1 Score: 102.834 bits (255), Expect = 4.644e-25
Identity = 69/190 (36.32%), Postives = 100/190 (52.63%), Query Frame = 2
Query:   53 GDLTDRQKKEILGDHNGYRSYVASGGAQQPSAANMLKLKWSAESASKAQNLADQCKFDNVTMEDISYGTYKSVGNNSELL--TEDIYISNPVYKFFEWLQDAFSYDVSTNTCKSP--TCEHHAQMIWADSQELGCGMSNCDTSQ-VKQSYI---ICIYGPGGDVNLKPPYISGPPCSQCPIGTSCVNSLC 598
            G LTD +K+ ++  HN YR+ V+      P+A++ML ++W  E A+ A+  A QC           +G  K  G   E L    D  +  P+    EW  +   Y++S  TC SP   C H+ Q++WA ++ +GCG   C+  Q V+++ I   +C Y P G+V  K PY  G PCSQCP G  C NSLC
Sbjct:   26 GALTDEEKRLMVELHNLYRAQVS------PTASDMLHMRWDEELAAFAKAYARQC----------VWGHNKERGRRGENLFAITDEGMDVPL-AMEEWHHEREHYNLSAATC-SPGQMCGHYTQVVWAKTERIGCGSHFCEKLQGVEETNIELLVCNYEPPGNVKGKRPYQEGTPCSQCPSGYHCKNSLC 197          
BLAST of Peptidase inhibitor 16 vs. Ensembl Human
Match: PI16 (peptidase inhibitor 16 [Source:HGNC Symbol;Acc:HGNC:21245])

HSP 1 Score: 102.834 bits (255), Expect = 4.644e-25
Identity = 69/190 (36.32%), Postives = 100/190 (52.63%), Query Frame = 2
Query:   53 GDLTDRQKKEILGDHNGYRSYVASGGAQQPSAANMLKLKWSAESASKAQNLADQCKFDNVTMEDISYGTYKSVGNNSELL--TEDIYISNPVYKFFEWLQDAFSYDVSTNTCKSP--TCEHHAQMIWADSQELGCGMSNCDTSQ-VKQSYI---ICIYGPGGDVNLKPPYISGPPCSQCPIGTSCVNSLC 598
            G LTD +K+ ++  HN YR+ V+      P+A++ML ++W  E A+ A+  A QC           +G  K  G   E L    D  +  P+    EW  +   Y++S  TC SP   C H+ Q++WA ++ +GCG   C+  Q V+++ I   +C Y P G+V  K PY  G PCSQCP G  C NSLC
Sbjct:   26 GALTDEEKRLMVELHNLYRAQVS------PTASDMLHMRWDEELAAFAKAYARQC----------VWGHNKERGRRGENLFAITDEGMDVPL-AMEEWHHEREHYNLSAATC-SPGQMCGHYTQVVWAKTERIGCGSHFCEKLQGVEETNIELLVCNYEPPGNVKGKRPYQEGTPCSQCPSGYHCKNSLC 197          
BLAST of Peptidase inhibitor 16 vs. Ensembl Human
Match: GLIPR1L1 (GLIPR1 like 1 [Source:HGNC Symbol;Acc:HGNC:28392])

HSP 1 Score: 88.9669 bits (219), Expect = 3.717e-21
Identity = 54/174 (31.03%), Postives = 83/174 (47.70%), Query Frame = 2
Query:   95 HNGYRSYVASGGAQQPSAANMLKLKWSAESASKAQNLADQCKFDNVTMEDISYGTYKSVGNNSELLTEDIYIS-----NPVYKFFEWLQDAFSYDVSTNTCKSPTCEHHAQMIWADSQELGCGMSNC-DTSQVKQSYIICIYGPGGDVNLKPPYISGPPCSQCPIGTSCVNSLC 598
            HN +R      G   P AA+M  + W    A  A+  A+QCKF++    D SY  Y +     E + E+I++       P +    W  +   YD  + +C S  C H+ Q++WA+S  +GC ++ C +      +  +C YGP G+    PPY+ G  CS C     CV +LC
Sbjct:   41 HNEWR------GKVNPPAADMKYMIWDKGLAKMAKAWANQCKFEHNDCLDKSYKCYAAF----EYVGENIWLGGIKSFTPRHAITAWYNETQFYDFDSLSC-SRVCGHYTQLVWANSFYVGCAVAMCPNLGGASTAIFVCNYGPAGNFANMPPYVRGESCSLCSKEEKCVKNLC 203          
BLAST of Peptidase inhibitor 16 vs. Ensembl Human
Match: GLIPR1L1 (GLIPR1 like 1 [Source:HGNC Symbol;Acc:HGNC:28392])

HSP 1 Score: 88.1965 bits (217), Expect = 6.478e-21
Identity = 54/174 (31.03%), Postives = 83/174 (47.70%), Query Frame = 2
Query:   95 HNGYRSYVASGGAQQPSAANMLKLKWSAESASKAQNLADQCKFDNVTMEDISYGTYKSVGNNSELLTEDIYIS-----NPVYKFFEWLQDAFSYDVSTNTCKSPTCEHHAQMIWADSQELGCGMSNC-DTSQVKQSYIICIYGPGGDVNLKPPYISGPPCSQCPIGTSCVNSLC 598
            HN +R      G   P AA+M  + W    A  A+  A+QCKF++    D SY  Y +     E + E+I++       P +    W  +   YD  + +C S  C H+ Q++WA+S  +GC ++ C +      +  +C YGP G+    PPY+ G  CS C     CV +LC
Sbjct:   41 HNEWR------GKVNPPAADMKYMIWDKGLAKMAKAWANQCKFEHNDCLDKSYKCYAAF----EYVGENIWLGGIKSFTPRHAITAWYNETQFYDFDSLSC-SRVCGHYTQLVWANSFYVGCAVAMCPNLGGASTAIFVCNYGPAGNFANMPPYVRGESCSLCSKEEKCVKNLC 203          
BLAST of Peptidase inhibitor 16 vs. Ensembl Celegans
Match: scl-7 (SCP-Like extracellular protein [Source:UniProtKB/TrEMBL;Acc:Q18539])

HSP 1 Score: 88.5817 bits (218), Expect = 1.175e-21
Identity = 66/211 (31.28%), Postives = 98/211 (46.45%), Query Frame = 2
Query:   23 LYFICFQSAQGDLTDRQKKEILGDHNGYRSYVASG-----GAQQPSAANMLKLKWSAESASKAQNLADQCKFDNVTMEDISYGTYKSVGNNSELLTE-DIYISNPV------YKFFEWLQDAFSYDVSTNTCKSPTCEHHAQMIWADSQELGCGMSNCDTSQVK----QSYIICIYGPGGDVNLKPPYISGPPCSQCPIGTSCVNS--LCS 601
            L  +C   A    ++  K+ ++  HN  RS +A G     G ++ SA NMLK+KW    A  AQN A+ C   +    D SYG       +S  +T+ D Y+ + V      ++ F W  + F     T    +    H  Q+ W+ + ++GCG  NC    V+    ++ I+C Y   G+   K  Y SG  CS CP GTSC  S  LC+
Sbjct:    7 LALVCV-GAHAQFSEGGKQSMVNAHNAVRSSIAKGEYVAKGTKKDSATNMLKMKWDNSLAQSAQNYANGCPMQH--SPDKSYGENLFWAYSSSPITDLDKYVQSAVDTWVSEFQMFGWNSNKF-----TTALWNTGIGHATQVAWSATGQVGCGAKNCGADSVRVGSYKATIVCQYKVPGNYLFKNIYNSGAKCSACPAGTSCEQSSGLCA 209          
BLAST of Peptidase inhibitor 16 vs. Ensembl Celegans
Match: scl-5 (SCP-Like extracellular protein [Source:UniProtKB/TrEMBL;Acc:Q18543])

HSP 1 Score: 83.5741 bits (205), Expect = 8.640e-20
Identity = 57/199 (28.64%), Postives = 90/199 (45.23%), Query Frame = 2
Query:   47 AQGDLTDRQKKEILGDHNGYRSYVASG-----GAQQPSAANMLKLKWSAESASKAQNLADQCKFDNVTMEDIS-----YGTYKSVGNNSELLTEDIYISNPVYKFFEWLQDAFSYDVSTNTCKSPTCEHHAQMIWADSQELGCGMSNC--DTSQVKQSYIICIYGPGGDVNLKPPYISGPPCSQCPIGTSC--VNSLCS 601
            A    +   +  IL  HN  RS +A G     G  +P+A++MLK+KW A  A+ AQ  A++C   +     +      Y T  ++ N  +            ++ + W  +  S  +      +    H  QM WA +  +GCG+ NC  DT+   +  ++C Y P G+   +  Y SG  CS+CP GTSC     LC+
Sbjct:   15 AYAQFSANGQAAILNVHNTLRSRIAKGTYVAKGTAKPAASDMLKMKWDATVAASAQAYANKCPTGHSGAAGLGENLYWYWTSATITNIDQFGATGSAAWEKEFQDYGWSSNTLSMSLF-----NTGIGHATQMAWAKTNLIGCGVKNCGKDTNGFNKVTVVCQYKPQGNYLNQNIYTSGTTCSKCPSGTSCEAATGLCA 208          
BLAST of Peptidase inhibitor 16 vs. Ensembl Celegans
Match: scl-2 (SCP-Like extracellular protein [Source:UniProtKB/TrEMBL;Acc:Q20603])

HSP 1 Score: 82.4185 bits (202), Expect = 2.042e-19
Identity = 61/212 (28.77%), Postives = 99/212 (46.70%), Query Frame = 2
Query:    5 LILISSLYFICFQSAQGDLTDRQKKEILGDHNGYRSYVASG-----GAQQPSAANMLKLKWSAESASKAQNLADQC----KFDNVTMEDIS-YGTYKSVGNNSELLTEDIYISNPVYKFFEWLQDAFSYDVSTNTCKSPTCEHHAQMIWADSQELGCGMSNC--DTSQVKQSYIICIYGPGGDVNLKPPYISGPPCSQCPIGTSCVNSLCSC 604
            L+L+ +L   C      D     +  I+  HN  RS +A G     G Q+    N+LK+KW +  A+ AQN A+ C      D    E++  Y T  S+G+ ++  +         ++ + W  +  + D+      +    H  QM WA S  +GCG+ +C  D++ + +  ++C Y P G+   +  Y+SG  CS CP GTSC  S   C
Sbjct:    4 LLLVVALAVGC----SADFGSSGQNGIINAHNTLRSKIAKGTYVAKGTQKSPGTNLLKMKWDSAVAASAQNYANGCPTGHSGDAGLGENLYWYWTSGSLGDLNQYGSAASASWEKEFQDYGWKSNLMTIDLF-----NTGIGHATQMAWAKSNLIGCGVKDCGRDSNGLNKVTVVCQYKPQGNFINQYIYVSGATCSGCPSGTSCETSTGLC 206          
BLAST of Peptidase inhibitor 16 vs. Ensembl Celegans
Match: scl-2 (SCP-Like extracellular protein [Source:UniProtKB/TrEMBL;Acc:Q20603])

HSP 1 Score: 82.4185 bits (202), Expect = 2.042e-19
Identity = 61/212 (28.77%), Postives = 99/212 (46.70%), Query Frame = 2
Query:    5 LILISSLYFICFQSAQGDLTDRQKKEILGDHNGYRSYVASG-----GAQQPSAANMLKLKWSAESASKAQNLADQC----KFDNVTMEDIS-YGTYKSVGNNSELLTEDIYISNPVYKFFEWLQDAFSYDVSTNTCKSPTCEHHAQMIWADSQELGCGMSNC--DTSQVKQSYIICIYGPGGDVNLKPPYISGPPCSQCPIGTSCVNSLCSC 604
            L+L+ +L   C      D     +  I+  HN  RS +A G     G Q+    N+LK+KW +  A+ AQN A+ C      D    E++  Y T  S+G+ ++  +         ++ + W  +  + D+      +    H  QM WA S  +GCG+ +C  D++ + +  ++C Y P G+   +  Y+SG  CS CP GTSC  S   C
Sbjct:    4 LLLVVALAVGC----SADFGSSGQNGIINAHNTLRSKIAKGTYVAKGTQKSPGTNLLKMKWDSAVAASAQNYANGCPTGHSGDAGLGENLYWYWTSGSLGDLNQYGSAASASWEKEFQDYGWKSNLMTIDLF-----NTGIGHATQMAWAKSNLIGCGVKDCGRDSNGLNKVTVVCQYKPQGNFINQYIYVSGATCSGCPSGTSCETSTGLC 206          
BLAST of Peptidase inhibitor 16 vs. Ensembl Celegans
Match: scl-8 (SCP-Like extracellular protein [Source:UniProtKB/TrEMBL;Acc:Q18540])

HSP 1 Score: 79.7221 bits (195), Expect = 2.178e-18
Identity = 61/198 (30.81%), Postives = 89/198 (44.95%), Query Frame = 2
Query:   59 LTDRQKKEILGDHNGYRSYVASG-----GAQQPSAANMLKLKWSAESASKAQNLADQCKFDNVTMEDISYGT---YKSVGNNSELLTEDIYISNPVYKF----FEWLQDAFSYDVSTNTCKSPTCEHHAQMIWADSQELGCGMSNCDTSQVK----QSYIICIYGPGGDVNLKPPYISGPPCSQCPIGTSCVNSLCSC 604
             ++  K+ IL  HN  RS +A G     G ++ SA NMLK+KW +     AQN A+ C   + T  D + G    ++  G+    L +   I+   +      F W  + FS  +      +    H  Q+ WA + ++GCG+ NC     +    Q  I+C Y   G+   K  Y SG  CS CP GTSC  S   C
Sbjct:   18 FSEGGKQSILNAHNDIRSRIAKGNYVAKGNRKESATNMLKMKWDSSLEQSAQNYANGCHMQHST-NDKTIGENLYWEWSGDPFSDLDKFGKIATVAWDHEFEQFGWNSNKFSLALF-----NTGVAHATQIAWAPTGKIGCGVKNCGRDARRGGLFQVAIVCQYRVRGNFFFKNIYNSGATCSACPAGTSCEQSTGLC 209          
BLAST of Peptidase inhibitor 16 vs. Ensembl Fly
Match: CG8483 (gene:FBgn0038126 transcript:FBtr0082782)

HSP 1 Score: 76.6406 bits (187), Expect = 2.995e-16
Identity = 57/189 (30.16%), Postives = 92/189 (48.68%), Query Frame = 2
Query:    2 VLILISSLYFIC-FQSAQGDLTDRQKKEILGDHNGYRSYVASGG-AQQPSAANMLKLKWSAESASKAQNLADQCKFDNVTMEDISYGTYKSVGNNSELLTEDIYISNPVYKFFEWLQDAFS--YDVSTNTCKSPTCEHHAQMIWADSQELGCGMSNC-DTSQVKQSYIICIYGPGGDVNLKPPYISGPP 553
            ++I+   + F C  +     +T  ++  IL +HN  R  VA+G    QP A NM ++ W  E A++AQ  AD C+F +     I+  T   +G N  ++     +      F   +Q  F+     S     SP   H++Q++W ++  +GCG +   DTS+  + Y+ C YGPGG+V    PY  G P
Sbjct:   12 IMIISCEVAFACNGKIIASGITAEERSIILQEHNRLRQIVATGRYPGQPGAENMREIVWDDELAARAQKWADNCQFRHDPHRTINRFT---MGQNLAIIWSTAPLDADDGDFPSRIQSWFNEVQKYSFGDAWSPKTGHYSQLVWGETSLVGCGYAEYKDTSKYNKLYV-CNYGPGGNVVGYNPYEVGKP 196          
BLAST of Peptidase inhibitor 16 vs. Ensembl Fly
Match: CG34002 (gene:FBgn0054002 transcript:FBtr0302155)

HSP 1 Score: 57.3806 bits (137), Expect = 1.053e-9
Identity = 51/182 (28.02%), Postives = 74/182 (40.66%), Query Frame = 2
Query:   56 DLTDRQKKEILGDHNGYRSYVASGGAQQ-PSAANMLKLKWSAESASKAQNLADQCKFDN----VTMEDISYGTYKSVGNNSELLTEDIYIS----NPVYKFFEWLQDAFSYDVSTNTCKSPTCEHHAQMIWADSQELGCGMSNCDTSQVKQSYIICIYGPGGDVNLKPPYISGPPCSQCPIG 574
            D+    KK IL  HN YR  VA G   + P AA MLKLKW  E A  A  L  +C        ++ E+ S  +Y +V N  +   +   I     N  Y  ++ +  +   D  +   K     H  +MI   S  LGC +++ +       ++ C+Y      N      SG P   C  G
Sbjct:   63 DVPKHIKKLILNHHNTYRDIVAGGQMHRLPIAARMLKLKWDHELALLATILVKRCDLQPTDHCISTEEFSSPSYHAVYNKFKAKEDTFRIVRSQLNAWYDQYKHVSSSSLIDGLSTAKKE--IGHFLRMIVGPSNRLGCAIASIEKGGWTHQWLACLYSCSPQKNSLLYEYSGKPGVYCTTG 242          
BLAST of Peptidase inhibitor 16 vs. Ensembl Fly
Match: CG32679 (gene:FBgn0052679 transcript:FBtr0071469)

HSP 1 Score: 56.225 bits (134), Expect = 2.127e-9
Identity = 46/179 (25.70%), Postives = 75/179 (41.90%), Query Frame = 2
Query:   62 TDRQKKEILGDHNGYRSYVASGGAQQ-PSAANMLKLKWSAESASKAQNLADQCKFDNVTMEDISYGTYKSVGNNSELLTED-----IYISNPVYKFFEWLQDAFSYDVSTNTCKS-PTCEHHAQMIWADSQELGCGMSN-CDTSQVKQSYIICIYGPGGDVNLKPPYISGPPCSQCPIG 574
             D     IL  HN  R+ +A GG    PSA  M  + W    A  A   A QC+  +    + +  TY+  G N  +L        +++   +  +F+  +DA S D+     +  P   H   M+   +  +GC ++   D + V+ + + C Y     VN  P Y +G   S+C  G
Sbjct:   57 VDAHIPLILQLHNERRNLIAGGGVSGFPSAVQMATMSWDTTLAQLAAYNALQCRMAHDECRNTN--TYRYAGQNLSILFTRSVDVAVFLRQRIAAWFDENRDATSGDMEDYQMRGGPAIGHFTTMVNERNNRVGCAIARFTDANNVQATLLACNYAVTNVVN-NPVYRAGTAASECTTG 232          
BLAST of Peptidase inhibitor 16 vs. Ensembl Zebrafish
Match: glipr1a (GLI pathogenesis-related 1a [Source:ZFIN;Acc:ZDB-GENE-110309-2])

HSP 1 Score: 84.7297 bits (208), Expect = 1.098e-19
Identity = 62/217 (28.57%), Postives = 100/217 (46.08%), Query Frame = 2
Query:    8 ILISSLYFICFQSAQ--GDLTDRQ-KKEILGDHNGYRSYVASGGAQQPSAANMLKLKWSAESASKAQNLADQCKFD-NVTMEDIS--YGTYKSVGNNSELLTEDIYISNPVYKF------FEWLQDAFSYDVSTNTCK-SPTCEHHAQMIWADSQELGCGMSNCDT-------SQVKQSYIICIYGPGGDVNLKPPYISGPPCSQCPIGTSCVNSLC 598
            +LIS+ + +   S++   D+TDR    E + +HN  RS V+      P+AANM  + W A  A  A+  A  C F  N+ + +    + T+ +VG       E+I+   P  +F      F W+ +   Y+ + N C     C H+ Q++WADS ++GC +  C         S ++    +C Y   G+   + PY  G  CS C     C  +LC
Sbjct:    7 LLISACFLLGVFSSEYLFDITDRAFIDECVREHNQNRSSVS------PTAANMRYMTWDAALAVTARAWARFCLFKHNIHLREAKRVHPTFTTVG-------ENIWAGAPYSRFTVKSAVFSWVNELKDYNYNNNQCNDKKVCGHYTQVVWADSYKVGCAVQTCPNGVAETHFSNIQGVIFVCNYATAGNFAGRSPYKQGASCSGCGGSDKCERNLC 210          
BLAST of Peptidase inhibitor 16 vs. Ensembl Zebrafish
Match: glipr1a (GLI pathogenesis-related 1a [Source:ZFIN;Acc:ZDB-GENE-110309-2])

HSP 1 Score: 83.5741 bits (205), Expect = 3.672e-19
Identity = 62/217 (28.57%), Postives = 100/217 (46.08%), Query Frame = 2
Query:    8 ILISSLYFICFQSAQ--GDLTDRQ-KKEILGDHNGYRSYVASGGAQQPSAANMLKLKWSAESASKAQNLADQCKFD-NVTMEDIS--YGTYKSVGNNSELLTEDIYISNPVYKF------FEWLQDAFSYDVSTNTCK-SPTCEHHAQMIWADSQELGCGMSNCDT-------SQVKQSYIICIYGPGGDVNLKPPYISGPPCSQCPIGTSCVNSLC 598
            +LIS+ + +   S++   D+TDR    E + +HN  RS V+      P+AANM  + W A  A  A+  A  C F  N+ + +    + T+ +VG       E+I+   P  +F      F W+ +   Y+ + N C     C H+ Q++WADS ++GC +  C         S ++    +C Y   G+   + PY  G  CS C     C  +LC
Sbjct:   15 LLISACFLLGVFSSEYLFDITDRAFIDECVREHNQNRSSVS------PTAANMRYMTWDAALAVTARAWARFCLFKHNIHLREAKRVHPTFTTVG-------ENIWAGAPYSRFTVKSAVFSWVNELKDYNYNNNQCNDKKVCGHYTQVVWADSYKVGCAVQTCPNGVAETHFSNIQGVIFVCNYATAGNFAGRSPYKQGASCSGCGGSDKCERNLC 218          
BLAST of Peptidase inhibitor 16 vs. Ensembl Zebrafish
Match: crispld2 (cysteine-rich secretory protein LCCL domain containing 2 [Source:ZFIN;Acc:ZDB-GENE-130131-1])

HSP 1 Score: 78.5666 bits (192), Expect = 1.027e-16
Identity = 55/195 (28.21%), Postives = 83/195 (42.56%), Query Frame = 2
Query:   74 KKEILGDHNGYRSYVASGGAQQPSAANMLKLKWSAESASKAQNLADQCKFDNVTMEDISYGTYKSVGNNSELLTEDIYISNPVYKFFEWLQDAFSYDVS---------TNTCKSPTCEHHAQMIWADSQELGCGMSNCDTSQV------KQSYIICIYGPGGDVNLKPPYISGPPCSQCP--IGTSCVNSLCSCR 607
            ++EIL  HN  R      G   P+A+NM  + W  E    A + A+QC++++   + +      S+G N  L        +P Y    W  +   Y               C  P C H+ Q++WA +  +GC +  C    V         Y++C Y P G+   + PY  G PCSQCP   G  C ++LC  R
Sbjct:   65 REEILKLHNKLR------GEVYPTASNMEYMIWDDELERSATSWAEQCQWEHGPQDLL-----MSIGQN--LAVHWGRYRSPAYHVQAWYDEVKDYTYPYPHECNPWCPERCSGPMCTHYTQLVWATTNRVGCAVHVCPRMNVWGEIWENAVYLVCNYSPKGNWIGEAPYQHGRPCSQCPPSYGGVCRDNLCYKR 246          
BLAST of Peptidase inhibitor 16 vs. Ensembl Zebrafish
Match: pi15a (peptidase inhibitor 15a [Source:NCBI gene;Acc:561978])

HSP 1 Score: 73.559 bits (179), Expect = 1.538e-15
Identity = 55/187 (29.41%), Postives = 84/187 (44.92%), Query Frame = 2
Query:   83 ILGDHNGYRSYVASGGAQQPSAANMLKLKWSAESASKAQNLADQCKFDNVTMEDISYGTYKSVGNNSELLTEDIY-ISNPVYKFFEWLQD-AFSYDVSTN-----TCKSPTCEHHAQMIWADSQELGCGMSNCDTSQV------KQSYIICIYGPGGDVNLKPPYISGPPCSQCP--IGTSCVNSLC 598
            IL  HN  R      G   P A+NM  + W    A  A+  A  C +++     + +     +G N  + T     I   V  + + ++D +F Y    N      C  P C H+ QM+WA S ++GC ++ C    V      + +Y++C Y P G+   + PY  G PCS CP   G SC N++C
Sbjct:   72 ILDYHNKVR------GKVFPPASNMEYMVWDDTLAKTAEQWASTCIWEHGPRNLLRF-----LGQNLSVRTGRYRSILQLVKPWHDEVKDYSFPYPRDCNPRCPLKCYGPMCTHYTQMVWATSNKVGCAINTCHNMNVWGSVWKRATYLVCNYSPKGNWIGEAPYKVGVPCSMCPPSYGGSCSNNMC 247          
BLAST of Peptidase inhibitor 16 vs. Ensembl Zebrafish
Match: pi15b (peptidase inhibitor 15b [Source:ZFIN;Acc:ZDB-GENE-070912-590])

HSP 1 Score: 72.7886 bits (177), Expect = 2.370e-15
Identity = 57/187 (30.48%), Postives = 84/187 (44.92%), Query Frame = 2
Query:   83 ILGDHNGYRSYVASGGAQQPSAANMLKLKWSAESASKAQNLADQCKFDNVTMEDISYGTYKSVGNNSELLTEDIY-ISNPVYKFFEWLQD-AFSYDVSTN-----TCKSPTCEHHAQMIWADSQELGCGMSNCDTSQV------KQSYIICIYGPGGDVNLKPPYISGPPCSQCP--IGTSCVNSLC 598
            IL  HN  R+ V       P AANM  + W    A  A+  A  C +++     + Y     +G N  + T +   I   V  +++ ++D  F Y    N      C  P C H+ QM+WA S  +GC +  C    V      + +Y++C Y P G+   + PY  G PCS CP   G SC N++C
Sbjct:   54 ILDYHNKVRANVF------PPAANMEYMLWDDGLARSAEAWAATCIWEHGPPYLLRY-----LGQNLSVRTGNYRSILQLVKPWYDEVRDYMFPYPRDCNPHCPMRCYGPMCTHYTQMVWASSNRVGCAIQTCFNMVVWGAVWREATYLVCNYSPKGNWIGEAPYRVGVPCSACPPSYGGSCSNNMC 229          
BLAST of Peptidase inhibitor 16 vs. Ensembl Xenopus
Match: ENSXETT00000036788.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:KV464547.1:593:5826:1 gene:ENSXETG00000015856.1 transcript:ENSXETT00000036788.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 79.7221 bits (195), Expect = 4.173e-17
Identity = 48/190 (25.26%), Postives = 89/190 (46.84%), Query Frame = 2
Query:   59 LTDRQKKEILGDHNGYRSYVASGGAQQPSAANMLKLKWSAESASKAQNLADQCKFDNVTMEDISYGTYKSVGNNSELLTEDIYIS-----NPVYKFFEWLQDAFSYDVSTNTCKS-PTCEHHAQMIWADSQELGCGMSNC----DTSQVKQSYIICIYGPGGDVNLKPPYISGPPCSQCPIGTSCVNSLC 598
            L   +K+ IL  HN YRS        +PSA++M+KL W +   + A++ A++C +++                +   + E++++      +      +W ++   Y+ +T  C+    C H+ QM+WA ++ +GCG + C             ++C Y P G+   + PY  G  C++CP    C+ SLC
Sbjct:   30 LNYEEKRIILDKHNFYRSQT------EPSASDMIKLTWDSALEAMAKSYAEKCIWEH--------------NKDRGFIGENLFVMSGSSLDVALGLDDWHKERGYYNFTTGMCQEGQMCGHYTQMVWAGTERVGCGQNFCPKLEGVDDENMYLLVCNYEPPGNFEGESPYKEGSRCTECPSDHVCIGSLC 199          
BLAST of Peptidase inhibitor 16 vs. Ensembl Xenopus
Match: R3HDML (R3H domain containing-like [Source:NCBI gene;Acc:100492715])

HSP 1 Score: 77.411 bits (189), Expect = 8.988e-17
Identity = 59/197 (29.95%), Postives = 87/197 (44.16%), Query Frame = 2
Query:   59 LTDRQKKEILGDHNGYRSYVASGGAQQPSAANMLKLKWSAESASKAQNLADQCKFDNVTMEDISY---------GTYKSVGNNSELLTEDIYISNPVYKFFEWLQDAFSYDVSTNTCKSPTCEHHAQMIWADSQELGCGMSNCDTSQV------KQSYIICIYGPGGDVNLKPPYISGPPCSQCP--IGTSCVNSLC 598
            ++ R    +L  HN  RS V       P AANM  + W    A  A++ A+QCK+D+   + + Y         G Y+S+ +    L +  Y     Y F    +   S     N C    C H+ QM+WA S  +GC ++ C    V      + SY++C Y   G+   + PY  G PCS CP   G  C N++C
Sbjct:   53 ISPRDMSALLDYHNQVRSKVF------PPAANMEYMVWDERLAKSAESWANQCKWDHGPNQLMRYIGQNLSVHSGRYRSIVD----LVKGWYDERQHYSFPHPRECNPS---CPNKCTGAVCTHYTQMVWASSNRIGCAVNICTNINVWGSTWRQASYLVCNYSIKGNWIGEAPYKLGRPCSACPPSYGGVCSNNMC 236          
BLAST of Peptidase inhibitor 16 vs. Ensembl Xenopus
Match: R3HDML (R3H domain containing-like [Source:NCBI gene;Acc:100492715])

HSP 1 Score: 77.0258 bits (188), Expect = 1.038e-16
Identity = 58/197 (29.44%), Postives = 85/197 (43.15%), Query Frame = 2
Query:   59 LTDRQKKEILGDHNGYRSYVASGGAQQPSAANMLKLKWSAESASKAQNLADQCKFDNVTMEDISY---------GTYKSVGNNSELLTEDIYISNPVYKFFEWLQDAFSYDVSTNTCKSPTCEHHAQMIWADSQELGCGMSNCDTSQV------KQSYIICIYGPGGDVNLKPPYISGPPCSQCP--IGTSCVNSLC 598
            ++ R    +L  HN  RS V       P AANM  + W    A  A++ A+QCK+D+   + + Y         G Y+S+ +    L +  Y     Y F              N C    C H+ QM+WA S  +GC ++ C    V      + SY++C Y   G+   + PY  G PCS CP   G  C N++C
Sbjct:   58 ISPRDMSALLDYHNQVRSKVF------PPAANMEYMVWDERLAKSAESWANQCKWDHGPNQLMRYIGQNLSVHSGRYRSIVD----LVKGWYDERQHYSF---PHPRECNPSCPNKCTGAVCTHYTQMVWASSNRIGCAVNICTNINVWGSTWRQASYLVCNYSIKGNWIGEAPYKLGRPCSACPPSYGGVCSNNMC 241          
BLAST of Peptidase inhibitor 16 vs. Ensembl Xenopus
Match: crispld2 (cysteine-rich secretory protein LCCL domain containing 2 [Source:NCBI gene;Acc:613091])

HSP 1 Score: 78.5666 bits (192), Expect = 1.516e-16
Identity = 55/192 (28.65%), Postives = 81/192 (42.19%), Query Frame = 2
Query:   74 KKEILGDHNGYRSYVASGGAQQPSAANMLKLKWSAESASKAQNLADQCKFDNVTMEDISYGTYKSVGNNSELLTEDIYISNPVYKFFEWLQDAFSYDVS---------TNTCKSPTCEHHAQMIWADSQELGCGMSNCDTSQV------KQSYIICIYGPGGDVNLKPPYISGPPCSQCP--IGTSCVNSLC 598
            K+EI+  HN  R      G   PSA+NM  + W  E    A+  A++C +     E        S+G N  L         P Y    W  +   Y               C  P C H+ Q++WA + ++GC ++ C    V         Y++C Y P G+   + PY +G PCS+CP   G +C N+LC
Sbjct:   57 KEEIIQLHNKLR------GQVHPSASNMEYMTWDDELEKSAEAWAEECIW-----EHGPTALLMSIGQN--LAVHWGRYRQPAYHVQSWYDEVKDYTYPYPHECNPYCPERCSGPMCTHYTQIVWATTTKVGCAVNVCKRMNVWGDIWENAVYLVCNYSPKGNWIGEAPYKNGRPCSECPPSYGGNCQNNLC 235          
BLAST of Peptidase inhibitor 16 vs. Ensembl Xenopus
Match: crispld2 (cysteine-rich secretory protein LCCL domain containing 2 [Source:NCBI gene;Acc:613091])

HSP 1 Score: 78.5666 bits (192), Expect = 1.576e-16
Identity = 55/192 (28.65%), Postives = 81/192 (42.19%), Query Frame = 2
Query:   74 KKEILGDHNGYRSYVASGGAQQPSAANMLKLKWSAESASKAQNLADQCKFDNVTMEDISYGTYKSVGNNSELLTEDIYISNPVYKFFEWLQDAFSYDVS---------TNTCKSPTCEHHAQMIWADSQELGCGMSNCDTSQV------KQSYIICIYGPGGDVNLKPPYISGPPCSQCP--IGTSCVNSLC 598
            K+EI+  HN  R      G   PSA+NM  + W  E    A+  A++C +     E        S+G N  L         P Y    W  +   Y               C  P C H+ Q++WA + ++GC ++ C    V         Y++C Y P G+   + PY +G PCS+CP   G +C N+LC
Sbjct:   57 KEEIIQLHNKLR------GQVHPSASNMEYMTWDDELEKSAEAWAEECIW-----EHGPTALLMSIGQN--LAVHWGRYRQPAYHVQSWYDEVKDYTYPYPHECNPYCPERCSGPMCTHYTQIVWATTTKVGCAVNVCKRMNVWGDIWENAVYLVCNYSPKGNWIGEAPYKNGRPCSECPPSYGGNCQNNLC 235          
BLAST of Peptidase inhibitor 16 vs. Ensembl Mouse
Match: Pi16 (peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:1921366])

HSP 1 Score: 99.3673 bits (246), Expect = 2.223e-25
Identity = 64/187 (34.22%), Postives = 101/187 (54.01%), Query Frame = 2
Query:   59 LTDRQKKEILGDHNGYRSYVASGGAQQPSAANMLKLKWSAESASKAQNLADQCKFDNVTMEDISYGTYKSVGNNSELL--TEDIYISNPVYKFFEWLQDAFSYDVSTNTCK-SPTCEHHAQMIWADSQELGCGMSNCDTSQ-VKQSYI---ICIYGPGGDVNLKPPYISGPPCSQCPIGTSCVNSLC 598
            LT+ +K+ ++  HN YR+ V+      P A++ML+++W  E A+ A+  A +C           +G  K  G   E L    D  +  P+     W ++   Y+ ST TC  +  C H+ Q++W+ ++ +GCG   C+T Q V+++ I   +C Y P G+V  + PY  G PCSQCP+G SC NSLC
Sbjct:   30 LTEDEKQTMVDLHNQYRAQVS------PPASDMLQMRWDDELAAFAKAYAQKC----------VWGHNKERGRRGENLFAITDEGMDVPL-AVGNWHEEHEYYNFSTATCDPNQMCGHYTQVVWSKTERIGCGSHFCETLQGVEEANIHLLVCNYEPPGNVKGRKPYQEGTPCSQCPLGYSCENSLC 199          
BLAST of Peptidase inhibitor 16 vs. Ensembl Mouse
Match: Pi16 (peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:1921366])

HSP 1 Score: 99.3673 bits (246), Expect = 4.926e-25
Identity = 64/187 (34.22%), Postives = 101/187 (54.01%), Query Frame = 2
Query:   59 LTDRQKKEILGDHNGYRSYVASGGAQQPSAANMLKLKWSAESASKAQNLADQCKFDNVTMEDISYGTYKSVGNNSELL--TEDIYISNPVYKFFEWLQDAFSYDVSTNTC-KSPTCEHHAQMIWADSQELGCGMSNCDTSQ-VKQSYI---ICIYGPGGDVNLKPPYISGPPCSQCPIGTSCVNSLC 598
            LT+ +K+ ++  HN YR+ V+      P A++ML+++W  E A+ A+  A +C           +G  K  G   E L    D  +  P+     W ++   Y+ ST TC  +  C H+ Q++W+ ++ +GCG   C+T Q V+++ I   +C Y P G+V  + PY  G PCSQCP+G SC NSLC
Sbjct:   30 LTEDEKQTMVDLHNQYRAQVS------PPASDMLQMRWDDELAAFAKAYAQKC----------VWGHNKERGRRGENLFAITDEGMDVPL-AVGNWHEEHEYYNFSTATCDPNQMCGHYTQVVWSKTERIGCGSHFCETLQGVEEANIHLLVCNYEPPGNVKGRKPYQEGTPCSQCPLGYSCENSLC 199          
BLAST of Peptidase inhibitor 16 vs. Ensembl Mouse
Match: Pi16 (peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:1921366])

HSP 1 Score: 99.3673 bits (246), Expect = 4.926e-25
Identity = 64/187 (34.22%), Postives = 101/187 (54.01%), Query Frame = 2
Query:   59 LTDRQKKEILGDHNGYRSYVASGGAQQPSAANMLKLKWSAESASKAQNLADQCKFDNVTMEDISYGTYKSVGNNSELL--TEDIYISNPVYKFFEWLQDAFSYDVSTNTC-KSPTCEHHAQMIWADSQELGCGMSNCDTSQ-VKQSYI---ICIYGPGGDVNLKPPYISGPPCSQCPIGTSCVNSLC 598
            LT+ +K+ ++  HN YR+ V+      P A++ML+++W  E A+ A+  A +C           +G  K  G   E L    D  +  P+     W ++   Y+ ST TC  +  C H+ Q++W+ ++ +GCG   C+T Q V+++ I   +C Y P G+V  + PY  G PCSQCP+G SC NSLC
Sbjct:   30 LTEDEKQTMVDLHNQYRAQVS------PPASDMLQMRWDDELAAFAKAYAQKC----------VWGHNKERGRRGENLFAITDEGMDVPL-AVGNWHEEHEYYNFSTATCDPNQMCGHYTQVVWSKTERIGCGSHFCETLQGVEEANIHLLVCNYEPPGNVKGRKPYQEGTPCSQCPLGYSCENSLC 199          
BLAST of Peptidase inhibitor 16 vs. Ensembl Mouse
Match: Pi16 (peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:1921366])

HSP 1 Score: 98.5969 bits (244), Expect = 1.247e-23
Identity = 64/187 (34.22%), Postives = 101/187 (54.01%), Query Frame = 2
Query:   59 LTDRQKKEILGDHNGYRSYVASGGAQQPSAANMLKLKWSAESASKAQNLADQCKFDNVTMEDISYGTYKSVGNNSELL--TEDIYISNPVYKFFEWLQDAFSYDVSTNTC-KSPTCEHHAQMIWADSQELGCGMSNCDTSQ-VKQSYI---ICIYGPGGDVNLKPPYISGPPCSQCPIGTSCVNSLC 598
            LT+ +K+ ++  HN YR+ V+      P A++ML+++W  E A+ A+  A +C           +G  K  G   E L    D  +  P+     W ++   Y+ ST TC  +  C H+ Q++W+ ++ +GCG   C+T Q V+++ I   +C Y P G+V  + PY  G PCSQCP+G SC NSLC
Sbjct:   30 LTEDEKQTMVDLHNQYRAQVS------PPASDMLQMRWDDELAAFAKAYAQKC----------VWGHNKERGRRGENLFAITDEGMDVPL-AVGNWHEEHEYYNFSTATCDPNQMCGHYTQVVWSKTERIGCGSHFCETLQGVEEANIHLLVCNYEPPGNVKGRKPYQEGTPCSQCPLGYSCENSLC 199          
BLAST of Peptidase inhibitor 16 vs. Ensembl Mouse
Match: Glipr1 (GLI pathogenesis-related 1 (glioma) [Source:MGI Symbol;Acc:MGI:1920940])

HSP 1 Score: 85.5001 bits (210), Expect = 7.589e-20
Identity = 58/176 (32.95%), Postives = 85/176 (48.30%), Query Frame = 2
Query:   77 KEILGDHNGYRSYVASGGAQQPSAANMLKLKWSAESASKAQNLADQCKFD-NVTMEDISYGTYKSVGNNSELLTEDIY-ISNPVYKFFEWLQDAFSYDVSTNTCKSPTCEHHAQMIWADSQELGCGMSNCDTSQVKQSYIICIYGPGGDVNLKPPYISGPPCSQCPIGTSCVNSLC 598
            KE +  HN  RS V+      P A NML + W  + A  A+     C+F  N  +    +  + ++G N  L +  I+ +S+ +     W ++   YD ST  C+   C H+ Q++WADS +LGC +  C       +  IC YGP G+     PY  G  CS CP    C+NSLC
Sbjct:   35 KECVQVHNQLRSKVS------PPARNMLYMSWDPKLAQIAKAWTKSCEFKHNPQLHSRIHPNFTALGENIWLGSLSIFSVSSAIS---AWYEEIKHYDFSTRKCRH-VCGHYTQVVWADSYKLGCAVQLCPNG----ANFICDYGPAGNYPTW-PYKQGATCSDCPKDDKCLNSLC 195          
BLAST of Peptidase inhibitor 16 vs. UniProt/SwissProt
Match: sp|P0DPU1|VA576_SCODE (Scoloptoxin SSD976 OS=Scolopendra dehaani OX=2609776 PE=1 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 2.040e-26
Identity = 72/203 (35.47%), Postives = 103/203 (50.74%), Query Frame = 2
Query:    8 ILISSLYFIC--FQ---SAQG-DLTDR-----QKKEILGDHNGYRSYVASGG-AQQPSAANMLKLKWSAESASKAQNLADQCKFDNVTMEDISYGTYKSVGNNSELLTEDIYISNPVYKFFEWLQDAFSYDVSTNTCKSPTCEHHAQMIWADSQELGCGMSNCDTSQVKQSYIICIYGPGGDVNLKPPYISGPPCSQCPIGTS 580
            IL+SS  F+   FQ   S  G D+  R      KK IL  HN  R  VA+G  + QPSAANM +L W+ E A+ AQ  A+ C F++          Y  +G N    +    I   V  +++ ++D     V + +   P   H+ QM+WA+++ LGCG+    T+  + SY+ C YGPGG+   +P Y  GPP S C  G S
Sbjct:    3 ILLSSTLFVLLMFQIIGSGMGCDMKVRGLDANMKKMILDLHNKKRQIVANGQQSGQPSAANMKELHWNDEIAANAQRSAETCVFEHTAKSLRKTTKYSYLGENIYKGSYPDPIPRSVNAWYDEVKDVTPAVVKSFSSGGPMIGHYTQMVWANTEALGCGLV---TASDRNSYLFCQYGPGGNYRSQPIYKQGPPASDCKNGKS 202          
BLAST of Peptidase inhibitor 16 vs. UniProt/SwissProt
Match: sp|P0DPV2|VA558_SCODE (Scoloptoxin SSD558 OS=Scolopendra dehaani OX=2609776 PE=1 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 9.316e-25
Identity = 61/175 (34.86%), Postives = 89/175 (50.86%), Query Frame = 2
Query:   59 LTDRQKKEILGDHNGYRSYVASGG-AQQPSAANMLKLKWSAESASKAQNLADQCKFDNVTMEDISYGTYKSVGNNSELLTEDIYISNPVYKFFEWLQDAFSYDVSTNTCKSPTCEHHAQMIWADSQELGCGMSNCDTSQVKQSYIICIYGPGGDVNLKPPYISGPPCSQCPIGTS 580
            L    KK IL  HN  R  VA+G  + QPSAANM +L W+ E A+ AQ  A+ C F++          Y  +G N    +    I   V  +++ ++D     V + +   P   H+ QM+WA+++ L CG+    T+  + SY+ C YGPGG+   +P Y  GPP S C  G S
Sbjct:   31 LDANMKKMILDLHNKKRQIVANGQQSGQPSAANMKELHWNDEIAANAQRSAETCVFEHTAKSLRKTTKYSYLGENIYKGSYPDPIPRSVNAWYDEVKDVTPAVVKSFSSGGPMIGHYTQMVWANTEALDCGLV---TASDRNSYLFCQYGPGGNYRSQPIYKQGPPASDCKNGKS 202          
BLAST of Peptidase inhibitor 16 vs. UniProt/SwissProt
Match: sp|Q6UXB8|PI16_HUMAN (Peptidase inhibitor 16 OS=Homo sapiens OX=9606 GN=PI16 PE=1 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 2.230e-24
Identity = 69/190 (36.32%), Postives = 100/190 (52.63%), Query Frame = 2
Query:   53 GDLTDRQKKEILGDHNGYRSYVASGGAQQPSAANMLKLKWSAESASKAQNLADQCKFDNVTMEDISYGTYKSVGNNSELL--TEDIYISNPVYKFFEWLQDAFSYDVSTNTCKSP--TCEHHAQMIWADSQELGCGMSNCDTSQ-VKQSYI---ICIYGPGGDVNLKPPYISGPPCSQCPIGTSCVNSLC 598
            G LTD +K+ ++  HN YR+ V+      P+A++ML ++W  E A+ A+  A QC           +G  K  G   E L    D  +  P+    EW  +   Y++S  TC SP   C H+ Q++WA ++ +GCG   C+  Q V+++ I   +C Y P G+V  K PY  G PCSQCP G  C NSLC
Sbjct:   26 GALTDEEKRLMVELHNLYRAQVS------PTASDMLHMRWDEELAAFAKAYARQC----------VWGHNKERGRRGENLFAITDEGMDVPL-AMEEWHHEREHYNLSAATC-SPGQMCGHYTQVVWAKTERIGCGSHFCEKLQGVEETNIELLVCNYEPPGNVKGKRPYQEGTPCSQCPSGYHCKNSLC 197          
BLAST of Peptidase inhibitor 16 vs. UniProt/SwissProt
Match: sp|Q9ET66|PI16_MOUSE (Peptidase inhibitor 16 OS=Mus musculus OX=10090 GN=Pi16 PE=1 SV=2)

HSP 1 Score: 98.5969 bits (244), Expect = 8.725e-23
Identity = 64/187 (34.22%), Postives = 101/187 (54.01%), Query Frame = 2
Query:   59 LTDRQKKEILGDHNGYRSYVASGGAQQPSAANMLKLKWSAESASKAQNLADQCKFDNVTMEDISYGTYKSVGNNSELL--TEDIYISNPVYKFFEWLQDAFSYDVSTNTC-KSPTCEHHAQMIWADSQELGCGMSNCDTSQ-VKQSYI---ICIYGPGGDVNLKPPYISGPPCSQCPIGTSCVNSLC 598
            LT+ +K+ ++  HN YR+ V+      P A++ML+++W  E A+ A+  A +C           +G  K  G   E L    D  +  P+     W ++   Y+ ST TC  +  C H+ Q++W+ ++ +GCG   C+T Q V+++ I   +C Y P G+V  + PY  G PCSQCP+G SC NSLC
Sbjct:   30 LTEDEKQTMVDLHNQYRAQVS------PPASDMLQMRWDDELAAFAKAYAQKC----------VWGHNKERGRRGENLFAITDEGMDVPL-AVGNWHEEHEYYNFSTATCDPNQMCGHYTQVVWSKTERIGCGSHFCETLQGVEEANIHLLVCNYEPPGNVKGRKPYQEGTPCSQCPLGYSCENSLC 199          
BLAST of Peptidase inhibitor 16 vs. UniProt/SwissProt
Match: sp|Q8JI38|CRVP_LATSE (Cysteine-rich venom protein latisemin OS=Laticauda semifasciata OX=8631 PE=2 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 1.985e-22
Identity = 60/184 (32.61%), Postives = 99/184 (53.80%), Query Frame = 2
Query:   74 KKEILGDHNGYRSYVASGGAQQPSAANMLKLKWSAESASKAQNLADQCKFDNVTMEDISYGTYKSVGNNSELLTEDIYISNPVYKFFEWLQDAFSYDVSTNTCKSPTCEHHAQMIWADSQELGCGMSNCDTSQVKQSYIICIYGPGGDV--NLKPPYISGPPCSQCPIGTSCVNSLCS--CRSE 613
            +KEI+  HN  R  V      +P+A NML+++W++++A  AQ  AD+C F +      + G + S G N  + ++    S  +  +++  ++ F YDV  N   S    H+ Q++W  S  LGC  + C +S+      +C Y P G++  ++  PY SGPPC  CP  ++CVN LC+  C+ E
Sbjct:   34 QKEIVDKHNALRRSV------RPTARNMLQMEWNSDAAQNAQRWADRCSFAHSPSHLRTVGKF-SCGENLFMSSQPYAWSRVIQSWYDENKN-FIYDVGANPPGS-VIGHYTQIVWYKSHLLGCAAARCSSSKY---LYVCQYCPAGNIIGSIATPYKSGPPCGDCP--SACVNGLCTNPCKHE 203          
BLAST of Peptidase inhibitor 16 vs. TrEMBL
Match: A0A093RUZ0 (Peptidase inhibitor 16 (Fragment) OS=Manacus vitellinus OX=328815 GN=N305_03369 PE=4 SV=1)

HSP 1 Score: 111.309 bits (277), Expect = 7.927e-27
Identity = 64/186 (34.41%), Postives = 99/186 (53.23%), Query Frame = 2
Query:   59 LTDRQKKEILGDHNGYRSYVASGGAQQPSAANMLKLKWSAESASKAQNLADQCKFDNVTMEDISYGTYKSVGNNSELLTEDIYISNPVYKFFEWLQDAFSYDVSTNTC-KSPTCEHHAQMIWADSQELGCGMSNCDTSQVKQS----YIICIYGPGGDVNLKPPYISGPPCSQCPIGTSCVNSLCS 601
            L++ +KK IL +HN YRS V+      P A  M+KL W  E  S AQ+ A++C +D+           K  G   E L     +    +   +W  +   Y+++T+TC     C H+ Q++W+D++++GCG   C+  +  ++     ++C Y P G+V  K PY  GPPCS CP GT CVN+LC 
Sbjct:   17 LSEEEKKIILDEHNRYRSQVS------PPARAMMKLTWDKELESLAQSYAEKCIWDH----------NKERGRRGENLFAMAPMLELEFAVEDWNGEEKFYNLTTSTCVPGQMCGHYTQVVWSDTKQIGCGAKFCEKIEGIETENMHLLVCNYYPAGNVKGKKPYWEGPPCSTCPEGTVCVNNLCE 186          
BLAST of Peptidase inhibitor 16 vs. TrEMBL
Match: A0A0R3WJL8 (SCP domain-containing protein OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS874 PE=3 SV=1)

HSP 1 Score: 110.923 bits (276), Expect = 1.589e-26
Identity = 71/205 (34.63%), Postives = 106/205 (51.71%), Query Frame = 2
Query:   11 LISSLYFICFQSAQGDLTDRQKKEILGDHNGYRSYVASGGAQQPSAANMLKLKWSAESASKAQNLADQCKFDNVTMEDISYGTYKSVGNNSELLTEDIYISNPVYKFFEWLQDAFSYDVSTNTCKSPT-CEHHAQMIWADSQELGCGMSNCDTSQVKQS----YIICIYGPGGDVNLKPPYISGPPCSQCPIGTSCVNSLCSCRS 610
            LI +L  +   +++   T++++K++L  HN  R+ V       PSA NML++ +SAE    A +   +CKF++       Y  Y  +G N  L T  +   N V +  +W  +   Y   +N C   T C H+ QM+WA S+ELGC +  CD+           + C Y P G+     PY SG  CSQCP+GT+CVN LCS R+
Sbjct:    4 LICTLLLVSLVASEAP-TEQERKDLLDFHNNKRATV------NPSATNMLEMVYSAELEKLAIDWVAKCKFEHPNSSQ--YPQYNGIGQNLAL-TGGVG-RNLVSQATQWWNEVSGYTYGSNACTVGTVCGHYIQMVWATSEELGCAVKQCDSLMPNWPSPVFLLTCQYKPAGNYIGIRPYTSGISCSQCPVGTTCVNKLCSRRN 197          
BLAST of Peptidase inhibitor 16 vs. TrEMBL
Match: A0A091GQ72 (Peptidase inhibitor 16 (Fragment) OS=Buceros rhinoceros silvestris OX=175836 GN=N320_01955 PE=4 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 4.075e-26
Identity = 65/185 (35.14%), Postives = 98/185 (52.97%), Query Frame = 2
Query:   59 LTDRQKKEILGDHNGYRSYVASGGAQQPSAANMLKLKWSAESASKAQNLADQCKFDNVTMEDISYGTYKSVGNNSELLTEDIYISNPVYKFFEWLQDAFSYDVSTNTCK-SPTCEHHAQMIWADSQELGCGMSNC---DTSQVKQSYI-ICIYGPGGDVNLKPPYISGPPCSQCPIGTSCVNSLC 598
            LTD +KK IL +HN YRS V+      P+A +MLK+ W  E  + AQ  A++C +D+           K  G   E L       +  +   +W  +   Y+++T+TC     C H+ Q++WA + ++GCG + C   D  + +  Y+ +C Y P G++  + PY  GP CSQCP G  CVNSLC
Sbjct:   17 LTDEEKKIILDEHNKYRSQVS------PTAVDMLKMSWDTELEAFAQAYAEKCIWDH----------NKERGRRGENLFAMAPTLDLEFAVEDWNGEEKYYNLTTSTCAPGQMCGHYTQVVWASTHQIGCGATFCEKIDGIETENMYLLVCNYYPPGNMKGRKPYQEGPSCSQCPEGRVCVNSLC 185          
BLAST of Peptidase inhibitor 16 vs. TrEMBL
Match: A0A091S7R2 (Peptidase inhibitor 16 (Fragment) OS=Nestor notabilis OX=176057 GN=N333_02097 PE=4 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 4.338e-26
Identity = 68/190 (35.79%), Postives = 99/190 (52.11%), Query Frame = 2
Query:   44 SAQGDLTDRQKKEILGDHNGYRSYVASGGAQQPSAANMLKLKWSAESASKAQNLADQCKFDNVTMEDISYGTYKSVGNNSELLTEDIYISNPVYKFFEWLQDAFSYDVSTNTCKS-PTCEHHAQMIWADSQELGCGMSNC---DTSQVKQSYI-ICIYGPGGDVNLKPPYISGPPCSQCPIGTSCVNSLC 598
            +A   L+D +KK IL  HN YRS V+      P A +MLK+ W AE  + AQ  A++C +D+           K  G   E L       +  +   +W  +   Y++ST+TC S   C H+ Q++WA + ++GCG   C   D  + +  Y+ +C Y P G++  + PY  GP CSQCP G  CVNSLC
Sbjct:   16 AAGASLSDEEKKIILDGHNKYRSQVS------PPAMDMLKMSWDAELEAFAQAYAEKCIWDH----------NKERGRRGENLFAMAPTLDLEFAVEDWNGEEKYYNLSTSTCVSGQMCGHYTQVVWASTHQIGCGAKFCEKIDGIETEGMYLLVCNYYPPGNMKGRKPYKEGPSCSQCPEGRVCVNSLC 189          
BLAST of Peptidase inhibitor 16 vs. TrEMBL
Match: A0A068YBI2 (GLIPR1 protein 1 OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000709300 PE=3 SV=1)

HSP 1 Score: 109.768 bits (273), Expect = 7.476e-26
Identity = 69/207 (33.33%), Postives = 107/207 (51.69%), Query Frame = 2
Query:    2 VLILISSLYFICFQSAQGDLTDRQKKEILGDHNGYRSYVASGGAQQPSAANMLKLKWSAESASKAQNLADQCKFDNVTMEDISYGTYKSVGNNSELLTEDIYISNPVYKFFEWLQDAFSYDVSTNTCKS-PTCEHHAQMIWADSQELGCGMSNCDTSQVKQSY------IICIYGPGGDVNLKPPYISGPPCSQCPIGTSCVNSLCS 601
            ++  I +L  I   +++   T+++++++L  HNG R  V       PSAANML++ +S E  + A     +CKF++   ++  Y  Y+ +G N  L        N V +   W  +   Y  + NTC S   C H+ Q++WA S ELGC +  CD   +K  +      + C Y P G+   + PY SG  CS+CP GT+CVN LCS
Sbjct:   23 MIKFICALVLITLVASEAP-TEQERRDLLNFHNGKRRSV------NPSAANMLEMVYSKELENLAVEWVARCKFEHPNWKE--YPAYRGIGQNLALSGGSR--RNLVAQATGWWNEVAYYTYANNTCASGKVCGHYTQLVWASSGELGCAVQRCD--DIKPDWPKPIFLMACQYKPPGNYAGEKPYTSGTSCSKCPNGTTCVNKLCS 216          
BLAST of Peptidase inhibitor 16 vs. Ensembl Cavefish
Match: ENSAMXT00000036030.1 (peptidase inhibitor 16 [Source:NCBI gene;Acc:103029846])

HSP 1 Score: 84.7297 bits (208), Expect = 7.926e-20
Identity = 56/202 (27.72%), Postives = 97/202 (48.02%), Query Frame = 2
Query:   11 LISSLYFICFQSAQGDLTDRQKKEILGDHNGYRSYVASGGAQQPSAANMLKLKWSAESASKAQNLADQCKFDNVTMEDISYGTYKSVGNNSELLTEDIYISNPVYKFFEWLQDAFSYDVSTNTC-KSPTCEHHAQMIWADSQELGCGMSNCDTSQV----KQSYIICIYGPGGDVNLKPPYISGPPCSQCPIG-TSCVNSLC 598
            LI +  ++     +G      ++ I+  HN +RS V      +P AA+M+ +KWS E A  A+  A +C +++      +  +   +G N  + T  + I        +W  +   Y    NTC ++  C H+ QM+WA ++E+GCG   C+T +       + ++C Y P G+   + PY  G  CS+CP    +CV+  C
Sbjct:    9 LICAGLWMLLAPGRGQFPKEDQQRIVNLHNHHRSTV------EPPAADMIHMKWSGELALIAKEYATKCIWEH------NPDSQNIMGENLFITTGPLDIEK---ALSDWFMEHKHYSYDNNTCAENEMCGHYTQMVWAKTKEVGCGSHLCETVEALGFKNATLLVCNYLPLGNYMGQKPYQVGEQCSKCPDDLKNCVDQAC 195          
BLAST of Peptidase inhibitor 16 vs. Ensembl Cavefish
Match: ENSAMXT00000031557.1 (peptidase inhibitor 16 [Source:NCBI gene;Acc:103029846])

HSP 1 Score: 84.7297 bits (208), Expect = 1.058e-19
Identity = 58/203 (28.57%), Postives = 99/203 (48.77%), Query Frame = 2
Query:   11 LISSLYFICFQSAQGDLTDRQKKEILGDHNGYRSYVASGGAQQPSAANMLKLKWSAESASKAQNLADQCKFD-NVTMEDISYGTYKSVGNNSELLTEDIYISNPVYKFFEWLQDAFSYDVSTNTC-KSPTCEHHAQMIWADSQELGCGMSNCDTSQV----KQSYIICIYGPGGDVNLKPPYISGPPCSQCPIG-TSCVNSLC 598
            LI +  ++     +G      ++ I+  HN +RS V      +P AA+M+ +KWS E A  A+  A +C ++ N   ++I       +G N  + T  + I   +    +W  +   Y    NTC ++  C H+ QM+WA ++E+GCG   C+T +       + ++C Y P G+   + PY  G  CS+CP    +CV+  C
Sbjct:    9 LICAGLWMLLAPGRGQFPKEDQQRIVNLHNHHRSTV------EPPAADMIHMKWSGELALIAKEYATKCIWEHNPDSQNI-------MGENLFITTGPLDIEKALS---DWFMEHKHYSYDNNTCAENEMCGHYTQMVWAKTKEVGCGSHLCETVEALGFKNATLLVCNYLPLGNYMGQKPYQVGEQCSKCPDDLKNCVDQAC 195          
BLAST of Peptidase inhibitor 16 vs. Ensembl Cavefish
Match: ENSAMXT00000029824.1 (peptidase inhibitor 16 [Source:NCBI gene;Acc:103029846])

HSP 1 Score: 84.3445 bits (207), Expect = 1.722e-19
Identity = 56/202 (27.72%), Postives = 97/202 (48.02%), Query Frame = 2
Query:   11 LISSLYFICFQSAQGDLTDRQKKEILGDHNGYRSYVASGGAQQPSAANMLKLKWSAESASKAQNLADQCKFDNVTMEDISYGTYKSVGNNSELLTEDIYISNPVYKFFEWLQDAFSYDVSTNTC-KSPTCEHHAQMIWADSQELGCGMSNCDTSQV----KQSYIICIYGPGGDVNLKPPYISGPPCSQCPIG-TSCVNSLC 598
            LI +  ++     +G      ++ I+  HN +RS V      +P AA+M+ +KWS E A  A+  A +C +++      +  +   +G N  + T  + I        +W  +   Y    NTC ++  C H+ QM+WA ++E+GCG   C+T +       + ++C Y P G+   + PY  G  CS+CP    +CV+  C
Sbjct:    9 LICAGLWMLLAPGRGQFPKEDQQRIVNLHNHHRSTV------EPPAADMIHMKWSGELALIAKEYATKCIWEH------NPDSQNIMGENLFITTGPLDIEK---ALSDWFMEHKHYSYDNNTCAENEMCGHYTQMVWAKTKEVGCGSHLCETVEALGFKNATLLVCNYLPLGNYMGQKPYQVGEQCSKCPDDLKNCVDQAC 195          
BLAST of Peptidase inhibitor 16 vs. Ensembl Cavefish
Match: crispld2 (cysteine-rich secretory protein LCCL domain containing 2 [Source:ZFIN;Acc:ZDB-GENE-130131-1])

HSP 1 Score: 80.4925 bits (197), Expect = 1.728e-17
Identity = 54/192 (28.12%), Postives = 82/192 (42.71%), Query Frame = 2
Query:   74 KKEILGDHNGYRSYVASGGAQQPSAANMLKLKWSAESASKAQNLADQCKFDNVTMEDISYGTYKSVGNNSELLTEDIYISNPVYKFFEWLQDAFSYDVS---------TNTCKSPTCEHHAQMIWADSQELGCGMSNCDTSQV------KQSYIICIYGPGGDVNLKPPYISGPPCSQCP--IGTSCVNSLC 598
            ++EIL  HN  R  V       P+A+NM  + W  E    A + A+QC++++   + +      S+G N  L        +P Y    W  +   Y               C  P C H+ Q++WA +  +GC +  C    V         Y++C Y P G+   + PY  G PCSQCP   G  C ++LC
Sbjct:   61 REEILALHNKLREGV------YPTASNMEYMVWDDELERSATHWAEQCQWEHGPQDLL-----MSIGQN--LAVHWGRYRSPAYHVQAWYDEVKDYTYPYPHECNPWCPERCSGPMCTHYTQLVWATTSRVGCAVHTCSRMNVWGEIWENAIYLVCNYSPKGNWIGEAPYAHGRPCSQCPPSYGGGCRDNLC 239          
BLAST of Peptidase inhibitor 16 vs. Ensembl Cavefish
Match: ENSAMXT00000042591.1 (GLI pathogenesis related 1 [Source:NCBI gene;Acc:111193446])

HSP 1 Score: 76.6406 bits (187), Expect = 1.034e-16
Identity = 60/192 (31.25%), Postives = 90/192 (46.88%), Query Frame = 2
Query:   56 DLTDRQ-KKEILGDHNGYRSYVASGGAQQPSAANMLKLKWSAESASKAQNLADQCKFDNVTM---EDISYGTYKSVGNNSELLTEDIYISNPVYKFFEWLQDAFSYDVSTNTCKSPTCEHHAQMIWADSQELGCGMSNCDTS------QVKQSYI-ICIYGPGGDVNLKPPYISGPPCSQCPIGTSCVNSLC 598
            D+TD    K  + +HN +R+ V      QP+A+NM  + W    A  A+  A +C F + T    E   +  + SVG N  L     +      K   W  +   Y  ST TCK   C H+ Q++WA++ ++GC +  C           +Q++I +C YG  G+V  + PY +GP C  C  G  C N LC
Sbjct:   24 DITDLPFIKTCVTEHNQHRANV------QPAASNMRYMTWDEGLAVTARAWARKCLFIHNTHLKEEGRVHPVFSSVGEN--LWAGTHFSVQGAIK--SWADEVKDYSYSTMTCKQ-VCGHYTQVVWANTYKVGCAVQYCPNGVEQTPFYPRQAFIFVCNYGTAGNVFNQKPYRTGPECRDC-TGELCENRLC 203          
BLAST of Peptidase inhibitor 16 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000374.1 (pep scaffold:Pmarinus_7.0:GL476650:75849:87118:-1 gene:ENSPMAG00000000334.1 transcript:ENSPMAT00000000374.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 85.5001 bits (210), Expect = 4.875e-20
Identity = 56/195 (28.72%), Postives = 92/195 (47.18%), Query Frame = 2
Query:   59 LTDRQKKEILGDHNGYRSYVASGGAQQPSAANMLKLKWSAESASKAQNLADQCKFDNVTMEDISYGTYKSVGNNSEL-LTEDIYISNPVYKFF---EWLQDAFSYDVST---NTCKSPTCEHHAQMIWADSQELGCGMSNC------DTSQVKQSYIICIYGPGGDVNLKPPYISGPPCSQCP--IGTSCVNSLC 598
            + D +++ +   HN  R+ V       P AA+M  + W  E A  A+  A QCK+ +   + +      ++G N  + +  +  ++  V  +F   EW Q     + S    +TC+ P C H+ Q++WA+S+ +GC +  C      D       Y++C Y P G+   + PY  G PCS+CP   G SC   LC
Sbjct:    1 IADDERRALTEYHNRLRASV------HPQAADMEHMSWDWELAGMAEAWAKQCKWGHGPSDQLD-----AIGQNLAVYVGSERPLAYHVQAWFDEEEWYQYPEEKECSPECPHTCRGPICTHYTQLVWAESRRVGCAVHTCLDISVWDAVWPYALYLVCNYSPKGNWIGEAPYRQGTPCSRCPPRYGGSCRGGLC 184          
BLAST of Peptidase inhibitor 16 vs. Ensembl Sea Lamprey
Match: CRISP3 (cysteine rich secretory protein 3 [Source:HGNC Symbol;Acc:HGNC:16904])

HSP 1 Score: 68.9366 bits (167), Expect = 1.262e-14
Identity = 52/179 (29.05%), Postives = 84/179 (46.93%), Query Frame = 2
Query:   83 ILGDHNGYRSYVASGGAQQPSAANMLKLKWSAESASKAQNLADQCKFDNVTMEDISYGTYKSVGNNSELLTEDIYISNPVYKFFEWLQD----AFSYDVSTNTCKSPTCEHHAQMIWADSQELGCGMSNCDTSQVKQSYI-ICIYGPGGDVN--LKPPYISGPPCSQCPIGTSCVNSLC 598
            I+  HN  R  V       PSA NML++ W  E+   A + A+ C F +    D    T +     +  ++   +  N  Y   +W  +     F YDV + T  +    H+ Q++W +S +LGC ++ C  +     Y+ +C Y P G++N  +  PY  G  C+ CP   +CVN+LC
Sbjct:   47 IVDLHNDLRRNVT------PSAGNMLQMMWKKEAYLNALSWANNCTFGH--SPDARRKTTQWTCGENIFMSSAPFTWN--YAIRDWYNEVISPGFQYDVGSTT--TGAVGHYTQLVWYNSFQLGCAVNYCPKNPGVAKYLYVCHYCPMGNLNTRINRPYDLGTSCASCP--KNCVNNLC 211          
BLAST of Peptidase inhibitor 16 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002250.1 (pep scaffold:Pmarinus_7.0:GL477299:1626:22672:-1 gene:ENSPMAG00000002049.1 transcript:ENSPMAT00000002250.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 61.6178 bits (148), Expect = 2.066e-12
Identity = 46/176 (26.14%), Postives = 73/176 (41.48%), Query Frame = 2
Query:  128 GAQQPSAANMLKLKWSAESASKAQNLADQCKFDNVTMEDISYGTYKSVGNNSELLTEDIYISN--PVYKFFEWLQDA----FSYDVSTN-----TCKSPTCEHHAQMIWADSQELGCGMSNCDTSQV------KQSYIICIYGPGGDVNLKPPYISGPPCSQCP--IGTSCVNSLC 598
            G   P ++NM  + W  +   +A     +C      M  I +            L +  ++S+  P +    W  +A    + Y+   N      C    C H+ Q++WA +  +GC ++ C    V      K  Y++C Y P G+     PY SG  CS+CP   G SC N+LC
Sbjct:    8 GEVHPPSSNMEYMAWVKKLIKEAARYPGRCLRLMQPMAMIHF------------LGQPHWLSHRPPSFHVQAWYDEAKDYQYPYEQECNPWCPFRCNGAVCTHYTQLVWATTNRVGCAINTCYNMNVWGQIWEKAVYLVCNYSPKGNWIGLSPYKSGRACSECPPSYGGSCRNNLC 171          
BLAST of Peptidase inhibitor 16 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000359.1 (pep scaffold:Pmarinus_7.0:GL487788:450:5784:1 gene:ENSPMAG00000000319.1 transcript:ENSPMAT00000000359.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.1434 bits (126), Expect = 7.753e-10
Identity = 37/113 (32.74%), Postives = 57/113 (50.44%), Query Frame = 2
Query:  296 EDIYISNP----VYKFFEWLQD----AFSYDVSTNTCKSPTCEHHAQ-MIWADSQELGCGMSNCDTSQVKQSYIICIYGPGGDVNLK--PPYISGPPCSQCPIGTSCVNSLCS 601
            E++YI N      Y   EW  +     F YD +    +    EH+ Q ++W  S ++GC ++ C T+  K+ + +C Y P G++N +   PY  G  C+ CP   SCVN LC 
Sbjct:    5 ENLYIGNAPFTWKYVIGEWYNEVTAPGFVYDKAG---QGAGVEHYTQQLVWYSSFQIGCSVNFCATA--KKYFYVCHYCPAGNLNTRVFRPYDKGSACTSCP--KSCVNKLCG 110          
BLAST of Peptidase inhibitor 16 vs. Ensembl Sea Lamprey
Match: CRISP2 (cysteine rich secretory protein 2 [Source:HGNC Symbol;Acc:HGNC:12024])

HSP 1 Score: 50.0618 bits (118), Expect = 2.478e-8
Identity = 28/69 (40.58%), Postives = 38/69 (55.07%), Query Frame = 2
Query:  401 HHAQMIWADSQELGCGMSNCDTSQVKQSYIICIYGPGGDVN--LKPPYISGPPCSQCPIGTSCVNSLCS 601
            H+ Q++W  S +LGC ++ C  +  K  Y +C Y P G++N  L  PY  G PC  CP    C N LCS
Sbjct:   44 HYTQVVWYSSFQLGCAVNYCPEAIYKYVY-VCHYCPAGNLNTRLSRPYNEGSPCRSCP--NDCENDLCS 109          
BLAST of Peptidase inhibitor 16 vs. Ensembl Yeast
Match: PRY3 (Cell wall-associated protein involved in export of acetylated sterols; member of the CAP protein superfamily (cysteine-rich secretory proteins (CRISP), antigen 5, and pathogenesis related 1 proteins); role in mating efficiency; expression of full-length transcript is daughter cell-specific; in response to alpha factor, a short transcript starting at +452 is expressed and the long form is repressed by Ste12p [Source:SGD;Acc:S000003614])

HSP 1 Score: 46.2098 bits (108), Expect = 1.553e-6
Identity = 41/149 (27.52%), Postives = 62/149 (41.61%), Query Frame = 2
Query:   74 KKEILGDHNGYRSYVASGGAQQPSAANMLKLKWSAESASKAQNLADQCKFDNV-TMEDISYGTYKSVGNNSELLTEDIYISNPVYKFFEWLQDAFSYDVSTNTCKSPTCEHHAQMIWADSQELGCGMSNCDTSQVKQSYIICIYGPGGD 517
            + ++L +HN +R+             +   L WS   A+ AQN ADQ     V T  D  YG   ++G          Y          W  +   Y+ S N   S +  H  Q++W  + E+GCG   C T+    +YI+C Y P G+
Sbjct:   26 ESDVLNEHNKFRAL----------HVDTAPLTWSDTLATYAQNYADQYDCSGVLTHSDGPYGENLALG----------YTDTGAVD--AWYGEISKYNYS-NPGFSESTGHFTQVVWKSTAEIGCGYKYCGTTW--NNYIVCSYNPPGN 149          
BLAST of Peptidase inhibitor 16 vs. Ensembl Nematostella
Match: EDO48881 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHM8])

HSP 1 Score: 47.7506 bits (112), Expect = 2.628e-7
Identity = 42/159 (26.42%), Postives = 69/159 (43.40%), Query Frame = 2
Query:   74 KKEILGDHNGYRSYVASGGAQQPSAANMLKLKWSAESASKAQNLADQCKFDNVTMEDISYGTYKSVGNNSELLTEDIYISNPVYKFFEWLQDAFSYDVSTNTCKSPTCEHHAQMIWADSQELGCGMSNCDTSQVKQSYIICIYGPGGDV------NLKP 532
            K +IL  HN YR       AQ  + A    LKW+A  AS+AQ+ A+     N     I + + +  G +   ++  +         +    D + ++   N   S +  H  Q++WA S E+G G +   TS     +++  Y P G+V      N+KP
Sbjct:    3 KNDILKTHNDYR-------AQHGTKA----LKWNARLASEAQSWAENLAQRNA----IQHSSSREYGESIAYMSGAVLTGRKATDMWYGEVDKYRFE---NPGFSTSSGHFTQVVWAGSTEMGAGKA---TSSSGAHFVVARYTPPGNVMGQFPENVKP 140          
BLAST of Peptidase inhibitor 16 vs. Ensembl Nematostella
Match: EDO35287 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLZ5])

HSP 1 Score: 47.3654 bits (111), Expect = 1.822e-6
Identity = 39/157 (24.84%), Postives = 69/157 (43.95%), Query Frame = 2
Query:   50 QGDLTDRQKKEILGDHNGYRSYVASGGAQQPSAANMLKLKWSAESASKAQNLADQCKFDNVTMEDISYGTYKSVGNNSELLTEDIYISNPVYKFFEWLQDAFSYDVSTNTCKSPTCEHHAQMIWADSQELGCGMSNCDTSQVKQSYIICIYGPGGDV 520
            QG   +   K  L  HN +R +      + PS      LKWS + A KAQ LA     D+   +D +Y   +  G N  +   D  I+       +W ++   Y   +      T +H +Q++W  ++ +G G++        ++Y++ +Y P G+V
Sbjct:  694 QGPCPEEIAKAGLKLHNQFRRW-----HKTPS------LKWSDKLAKKAQKLAQSMAADSNHTDDEAYSQNELPGENIAVFKHDYDIAAE-RATRKWYEEVEGYRFGSPVLGEAT-KHFSQLVWKGTKSVGIGVAR---GARDRTYVVALYDPPGNV 834          
BLAST of Peptidase inhibitor 16 vs. Ensembl Nematostella
Match: EDO37114 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGM4])

HSP 1 Score: 45.4394 bits (106), Expect = 1.868e-6
Identity = 37/149 (24.83%), Postives = 64/149 (42.95%), Query Frame = 2
Query:   77 KEILGDHNGYRSYVASGGAQQPSAANMLKLKWSAESASKAQNLADQCKFDNVTMEDISYGTYKSVGNNSELLTEDIYISNPVYKFFE-WLQDAFSYDVSTNTCKSPTCEHHAQMIWADSQELGCGMSNCDTSQVKQSYIICIYGPGGDV 520
            K  L  HN YR      GA++        + WSA  A+ AQ  AD+    +    D +    KS G N    T     +  +   F+ W  ++  YD + N   S    H  Q++W  +Q++G G +    ++  + Y++  + P G++
Sbjct:    3 KNCLEAHNEYRK---RHGAKE--------MTWSASLAADAQKWADKLSQTDAFKHDYASINSKSQGENLAYFTPQKPNNTAIMDAFDAWYDESSKYDYA-NAKFSKETGHFTQLVWKATQKMGIGTAK--NAKGDKEYVVARFSPAGNI 137          
BLAST of Peptidase inhibitor 16 vs. Ensembl Medaka
Match: ENSORLT00000023160.2 (peptidase inhibitor 16 [Source:NCBI gene;Acc:101164782])

HSP 1 Score: 93.2041 bits (230), Expect = 2.875e-22
Identity = 60/187 (32.09%), Postives = 91/187 (48.66%), Query Frame = 2
Query:   59 LTDRQKKEILGDHNGYRSYVASGGAQQPSAANMLKLKWSAESASKAQNLADQCKFD-NVTMEDISYGTYKSVGNNSELLTEDIYISNPVYKFFEWLQDAFSYDVSTNTC-KSPTCEHHAQMIWADSQELGCGMSNCDTSQV----KQSYIICIYGPGGDVNLKPPYISGPPCSQCPIGTS-CVNSLC 598
            LTD+Q++ ++  HN YR  V+      PSAA ML LKW       A+  A +C ++ N  +ED     +   G         + +S  V K   W  +   Y    N+C +   C H+ QM+WAD+  +GC +  C+T +       SY++C Y P G+ + + PY+ G  CS+CP     C N LC
Sbjct:   57 LTDQQEEMLVELHNHYRGQVS------PSAAAMLPLKWDGNLKLVAEGYAAKCIWEHNTELEDTGENLFAGTGK--------LDLSEAVEK---WFLERLDYSYENNSCDEDKMCGHYTQMVWADTHRVGCAVHFCNTIENLDWNNVSYLVCNYFPAGNYDDERPYVEGDWCSRCPEDLDVCQNHLC 226          
BLAST of Peptidase inhibitor 16 vs. Ensembl Medaka
Match: crispld2 (cysteine rich secretory protein LCCL domain containing 2 [Source:NCBI gene;Acc:101174090])

HSP 1 Score: 82.4185 bits (202), Expect = 4.652e-18
Identity = 56/192 (29.17%), Postives = 82/192 (42.71%), Query Frame = 2
Query:   74 KKEILGDHNGYRSYVASGGAQQPSAANMLKLKWSAESASKAQNLADQCKFDNVTMEDISYGTYKSVGNNSELLTEDIYISNPVYKFFEWLQDAFSYDVS---------TNTCKSPTCEHHAQMIWADSQELGCGMSNCDTSQV------KQSYIICIYGPGGDVNLKPPYISGPPCSQCP--IGTSCVNSLC 598
            ++EIL  HN  RS V       PSAANM  + W  E    A   A++C++++   + +      S+G N  L        +P +    W  +   Y               C  P C H+ Q++WA +  +GC +  C    V         Y++C Y P G+   + PY  G PCSQCP   G  C N+LC
Sbjct:   76 REEILLLHNKLRSSV------YPSAANMEHMVWDDELERSATQWAEECRWEHGPQDLL-----MSIGQN--LAVHWGRYRSPAFHVQAWYDEVKDYTYPYPSECNPWCPERCSGPMCTHYTQLVWATTNRVGCAVHVCPKMNVWGEIWETAVYLVCNYSPKGNWIGEAPYRHGRPCSQCPPSFGGGCRNNLC 254          
BLAST of Peptidase inhibitor 16 vs. Ensembl Medaka
Match: pi15a (peptidase inhibitor 15 [Source:NCBI gene;Acc:101173911])

HSP 1 Score: 75.0998 bits (183), Expect = 4.375e-16
Identity = 55/187 (29.41%), Postives = 85/187 (45.45%), Query Frame = 2
Query:   83 ILGDHNGYRSYVASGGAQQPSAANMLKLKWSAESASKAQNLADQCKFDNVTMEDISYGTYKSVGNNSELLTEDIY-ISNPVYKFFEWLQD-AFSYDVSTN-----TCKSPTCEHHAQMIWADSQELGCGMSNCDTSQV------KQSYIICIYGPGGDVNLKPPYISGPPCSQCP--IGTSCVNSLC 598
            IL  HN  R      G   P A+NM  + W    A  A++ A  C +++     + +     +G N  + T     I   V  +++ ++D +F Y    N      C  P C H+ QM+WA S ++GC +  C    V      + +Y++C Y P G+   + PY  G PCS CP   G SC N++C
Sbjct:   69 ILDYHNKVR------GKVFPPASNMEYMVWDETLAKTAEDWAHACLWEHGPSHLLRF-----LGQNLSVRTGRYRSILQLVKPWYDEVKDYSFPYPRDCNPRCPLRCYGPMCTHYTQMVWATSNKVGCAIHTCYNMNVWGSVWKRATYLVCNYSPKGNWIGEAPYKVGVPCSACPPSYGGSCSNNMC 244          
BLAST of Peptidase inhibitor 16 vs. Ensembl Medaka
Match: crispld1a (cysteine rich secretory protein LCCL domain containing 1 [Source:NCBI gene;Acc:101172850])

HSP 1 Score: 74.7146 bits (182), Expect = 1.954e-15
Identity = 56/203 (27.59%), Postives = 82/203 (40.39%), Query Frame = 2
Query:   41 QSAQGDLTDRQKKEILGDHNGYRSYVASGGAQQPSAANMLKLKWSAESASKAQNLADQCKFDNVTMEDISYGTYKSVGNNSELLTEDIYISNPVYKFFEWLQD----AFSYDVSTN-----TCKSPTCEHHAQMIWADSQELGCGMSNCDTSQV------KQSYIICIYGPGGDVNLKPPYISGPPCSQCP--IGTSCVNSLC 598
            Q  +  +TD   + IL  HN  R      G   P A+NM  + W  E    A+  A+ C +++     +       +G N  L         P +    W  +    +F Y    N      C  P C H+ Q++WA S  +GC ++ C    V      K  Y++C Y P G+     PY  G PCS CP   G  C ++LC
Sbjct:   78 QRGKRAITDSDAQLILDLHNKLR------GQVYPPASNMEYMMWDTELERSAEEWAETCLWEHGPASLLP-----QIGQN--LGAHWGRYQPPTFHVQAWYDEVKDYSFPYPQECNPYCPFRCSGPVCTHYTQLVWATSSRIGCAINLCHNMDVWGQIWAKAVYLVCNYSPKGNWWGHAPYKHGTPCSACPPSYGGGCRDNLC 267          
BLAST of Peptidase inhibitor 16 vs. Ensembl Medaka
Match: crispld1a (cysteine rich secretory protein LCCL domain containing 1 [Source:NCBI gene;Acc:101172850])

HSP 1 Score: 74.3294 bits (181), Expect = 2.295e-15
Identity = 56/203 (27.59%), Postives = 82/203 (40.39%), Query Frame = 2
Query:   41 QSAQGDLTDRQKKEILGDHNGYRSYVASGGAQQPSAANMLKLKWSAESASKAQNLADQCKFDNVTMEDISYGTYKSVGNNSELLTEDIYISNPVYKFFEWLQD----AFSYDVSTN-----TCKSPTCEHHAQMIWADSQELGCGMSNCDTSQV------KQSYIICIYGPGGDVNLKPPYISGPPCSQCP--IGTSCVNSLC 598
            Q  +  +TD   + IL  HN  R      G   P A+NM  + W  E    A+  A+ C +++     +       +G N  L         P +    W  +    +F Y    N      C  P C H+ Q++WA S  +GC ++ C    V      K  Y++C Y P G+     PY  G PCS CP   G  C ++LC
Sbjct:   50 QRGKRAITDSDAQLILDLHNKLR------GQVYPPASNMEYMMWDTELERSAEEWAETCLWEHGPASLLP-----QIGQN--LGAHWGRYQPPTFHVQAWYDEVKDYSFPYPQECNPYCPFRCSGPVCTHYTQLVWATSSRIGCAINLCHNMDVWGQIWAKAVYLVCNYSPKGNWWGHAPYKHGTPCSACPPSYGGGCRDNLC 239          
BLAST of Peptidase inhibitor 16 vs. Planmine SMEST
Match: SMESG000072679.1 (SMESG000072679.1)

HSP 1 Score: 374.4 bits (960), Expect = 5.547e-134
Identity = 182/201 (90.55%), Postives = 189/201 (94.03%), Query Frame = 2
Query:    2 VLILISSLYFICFQSAQGDLTDRQKKEILGDHNGYRSYVASG-GAQQPSAANMLKLKWSAESASKAQNLADQCKFDNVTMEDISYGTYKSVGNNSELLTEDIYISNPVYKFFEWLQDAFSYDVSTNTCKSPTCEHHAQMIWADSQELGCGMSNCDTSQVKQSYIICIYGPGGDVNLKPPYISGPPCSQCPIGTSCVNSLCS 601
            VLILISSLYFICFQSAQGDLTD QKKEIL  HN +R+ VASG G  QPSAANMLKLKWSAESASKAQNLADQCKFDNVTMEDISYGTYKSVG+NS LLT+ +YISNPV+KFFEWLQDAFSYDVSTNTCKSPTCEHHAQMIWADSQELGCGMSNCDTSQVKQSY+ICIYGPGGDV LKPPYISGPPCSQCPIGT CVNSLCS
Sbjct:    7 VLILISSLYFICFQSAQGDLTDGQKKEILEFHNDFRAAVASGRGGPQPSAANMLKLKWSAESASKAQNLADQCKFDNVTMEDISYGTYKSVGSNSALLTDSLYISNPVFKFFEWLQDAFSYDVSTNTCKSPTCEHHAQMIWADSQELGCGMSNCDTSQVKQSYLICIYGPGGDVKLKPPYISGPPCSQCPIGTYCVNSLCS 207          
BLAST of Peptidase inhibitor 16 vs. Planmine SMEST
Match: SMESG000072936.1 (SMESG000072936.1)

HSP 1 Score: 364.385 bits (934), Expect = 4.373e-130
Identity = 178/201 (88.56%), Postives = 186/201 (92.54%), Query Frame = 2
Query:    2 VLILISSLYFICFQSAQGDLTDRQKKEILGDHNGYRSYVASG-GAQQPSAANMLKLKWSAESASKAQNLADQCKFDNVTMEDISYGTYKSVGNNSELLTEDIYISNPVYKFFEWLQDAFSYDVSTNTCKSPTCEHHAQMIWADSQELGCGMSNCDTSQVKQSYIICIYGPGGDVNLKPPYISGPPCSQCPIGTSCVNSLCS 601
            VLILISSL FICFQSAQGDLTD QK EIL  HN  RS+VASG GA QPSAANMLK+KWSAESASKAQNLADQCKFDNVTMEDISYGTYKSVGNNSELLTEDIYISNP YKF+E L D F YD+STNTCKSPTCEHHAQM+WADSQELGCGMSNCDTSQ+KQSY+ICIYGPGGDV LKPPYISGPPCSQCPIGTSCV+SLCS
Sbjct:    3 VLILISSLLFICFQSAQGDLTDGQKMEILDVHNWLRSHVASGEGAPQPSAANMLKMKWSAESASKAQNLADQCKFDNVTMEDISYGTYKSVGNNSELLTEDIYISNPAYKFYELLDDFFYYDMSTNTCKSPTCEHHAQMMWADSQELGCGMSNCDTSQIKQSYLICIYGPGGDVKLKPPYISGPPCSQCPIGTSCVDSLCS 203          
BLAST of Peptidase inhibitor 16 vs. Planmine SMEST
Match: SMESG000072936.1 (SMESG000072936.1)

HSP 1 Score: 364.385 bits (934), Expect = 5.623e-130
Identity = 178/201 (88.56%), Postives = 186/201 (92.54%), Query Frame = 2
Query:    2 VLILISSLYFICFQSAQGDLTDRQKKEILGDHNGYRSYVASG-GAQQPSAANMLKLKWSAESASKAQNLADQCKFDNVTMEDISYGTYKSVGNNSELLTEDIYISNPVYKFFEWLQDAFSYDVSTNTCKSPTCEHHAQMIWADSQELGCGMSNCDTSQVKQSYIICIYGPGGDVNLKPPYISGPPCSQCPIGTSCVNSLCS 601
            VLILISSL FICFQSAQGDLTD QK EIL  HN  RS+VASG GA QPSAANMLK+KWSAESASKAQNLADQCKFDNVTMEDISYGTYKSVGNNSELLTEDIYISNP YKF+E L D F YD+STNTCKSPTCEHHAQM+WADSQELGCGMSNCDTSQ+KQSY+ICIYGPGGDV LKPPYISGPPCSQCPIGTSCV+SLCS
Sbjct:    7 VLILISSLLFICFQSAQGDLTDGQKMEILDVHNWLRSHVASGEGAPQPSAANMLKMKWSAESASKAQNLADQCKFDNVTMEDISYGTYKSVGNNSELLTEDIYISNPAYKFYELLDDFFYYDMSTNTCKSPTCEHHAQMMWADSQELGCGMSNCDTSQIKQSYLICIYGPGGDVKLKPPYISGPPCSQCPIGTSCVDSLCS 207          
BLAST of Peptidase inhibitor 16 vs. Planmine SMEST
Match: SMESG000072928.1 (SMESG000072928.1)

HSP 1 Score: 340.502 bits (872), Expect = 1.101e-120
Identity = 163/201 (81.09%), Postives = 179/201 (89.05%), Query Frame = 2
Query:    2 VLILISSLYFICFQSAQGDLTDRQKKEILGDHNGYRSYVASG-GAQQPSAANMLKLKWSAESASKAQNLADQCKFDNVTMEDISYGTYKSVGNNSELLTEDIYISNPVYKFFEWLQDAFSYDVSTNTCKSPTCEHHAQMIWADSQELGCGMSNCDTSQVKQSYIICIYGPGGDVNLKPPYISGPPCSQCPIGTSCVNSLCS 601
            VLILISSL FICFQSAQG+LTD QK ++L  HN +R+ VASG  A  PSAANM+ +KWS ESASKAQ LA+QCKFD+ TMEDISYGTYKSVGNNSELLTEDIYISNPVYKF++ L D F YD+STN CKSP CEHHAQM+WADSQELGCGMSNCDTSQ+KQSY+ICIYGPGGDV LKPPYISGPPCSQCPIGTSCV+SLCS
Sbjct:    3 VLILISSLLFICFQSAQGNLTDEQKNDLLAVHNEFRAAVASGQRAPLPSAANMMNMKWSDESASKAQKLANQCKFDDFTMEDISYGTYKSVGNNSELLTEDIYISNPVYKFYQLLDDFFYYDMSTNICKSPKCEHHAQMVWADSQELGCGMSNCDTSQLKQSYLICIYGPGGDVKLKPPYISGPPCSQCPIGTSCVDSLCS 203          
BLAST of Peptidase inhibitor 16 vs. Planmine SMEST
Match: SMESG000072928.1 (SMESG000072928.1)

HSP 1 Score: 340.502 bits (872), Expect = 1.324e-120
Identity = 163/201 (81.09%), Postives = 179/201 (89.05%), Query Frame = 2
Query:    2 VLILISSLYFICFQSAQGDLTDRQKKEILGDHNGYRSYVASG-GAQQPSAANMLKLKWSAESASKAQNLADQCKFDNVTMEDISYGTYKSVGNNSELLTEDIYISNPVYKFFEWLQDAFSYDVSTNTCKSPTCEHHAQMIWADSQELGCGMSNCDTSQVKQSYIICIYGPGGDVNLKPPYISGPPCSQCPIGTSCVNSLCS 601
            VLILISSL FICFQSAQG+LTD QK ++L  HN +R+ VASG  A  PSAANM+ +KWS ESASKAQ LA+QCKFD+ TMEDISYGTYKSVGNNSELLTEDIYISNPVYKF++ L D F YD+STN CKSP CEHHAQM+WADSQELGCGMSNCDTSQ+KQSY+ICIYGPGGDV LKPPYISGPPCSQCPIGTSCV+SLCS
Sbjct:    7 VLILISSLLFICFQSAQGNLTDEQKNDLLAVHNEFRAAVASGQRAPLPSAANMMNMKWSDESASKAQKLANQCKFDDFTMEDISYGTYKSVGNNSELLTEDIYISNPVYKFYQLLDDFFYYDMSTNICKSPKCEHHAQMVWADSQELGCGMSNCDTSQLKQSYLICIYGPGGDVKLKPPYISGPPCSQCPIGTSCVDSLCS 207          
The following BLAST results are available for this feature:
BLAST of Peptidase inhibitor 16 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PI164.644e-2536.32peptidase inhibitor 16 [Source:HGNC Symbol;Acc:HGN... [more]
PI164.644e-2536.32peptidase inhibitor 16 [Source:HGNC Symbol;Acc:HGN... [more]
PI164.644e-2536.32peptidase inhibitor 16 [Source:HGNC Symbol;Acc:HGN... [more]
GLIPR1L13.717e-2131.03GLIPR1 like 1 [Source:HGNC Symbol;Acc:HGNC:28392][more]
GLIPR1L16.478e-2131.03GLIPR1 like 1 [Source:HGNC Symbol;Acc:HGNC:28392][more]
back to top
BLAST of Peptidase inhibitor 16 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
scl-71.175e-2131.28SCP-Like extracellular protein [Source:UniProtKB/... [more]
scl-58.640e-2028.64SCP-Like extracellular protein [Source:UniProtKB/... [more]
scl-22.042e-1928.77SCP-Like extracellular protein [Source:UniProtKB/... [more]
scl-22.042e-1928.77SCP-Like extracellular protein [Source:UniProtKB/... [more]
scl-82.178e-1830.81SCP-Like extracellular protein [Source:UniProtKB/... [more]
back to top
BLAST of Peptidase inhibitor 16 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CG84832.995e-1630.16gene:FBgn0038126 transcript:FBtr0082782[more]
CG340021.053e-928.02gene:FBgn0054002 transcript:FBtr0302155[more]
CG326792.127e-925.70gene:FBgn0052679 transcript:FBtr0071469[more]
back to top
BLAST of Peptidase inhibitor 16 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
glipr1a1.098e-1928.57GLI pathogenesis-related 1a [Source:ZFIN;Acc:ZDB-G... [more]
glipr1a3.672e-1928.57GLI pathogenesis-related 1a [Source:ZFIN;Acc:ZDB-G... [more]
crispld21.027e-1628.21cysteine-rich secretory protein LCCL domain contai... [more]
pi15a1.538e-1529.41peptidase inhibitor 15a [Source:NCBI gene;Acc:5619... [more]
pi15b2.370e-1530.48peptidase inhibitor 15b [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of Peptidase inhibitor 16 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000036788.14.173e-1725.26pep primary_assembly:Xenopus_tropicalis_v9.1:KV464... [more]
R3HDML8.988e-1729.95R3H domain containing-like [Source:NCBI gene;Acc:1... [more]
R3HDML1.038e-1629.44R3H domain containing-like [Source:NCBI gene;Acc:1... [more]
crispld21.516e-1628.65cysteine-rich secretory protein LCCL domain contai... [more]
crispld21.576e-1628.65cysteine-rich secretory protein LCCL domain contai... [more]
back to top
BLAST of Peptidase inhibitor 16 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pi162.223e-2534.22peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:... [more]
Pi164.926e-2534.22peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:... [more]
Pi164.926e-2534.22peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:... [more]
Pi161.247e-2334.22peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:... [more]
Glipr17.589e-2032.95GLI pathogenesis-related 1 (glioma) [Source:MGI Sy... [more]
back to top
BLAST of Peptidase inhibitor 16 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P0DPU1|VA576_SCODE2.040e-2635.47Scoloptoxin SSD976 OS=Scolopendra dehaani OX=26097... [more]
sp|P0DPV2|VA558_SCODE9.316e-2534.86Scoloptoxin SSD558 OS=Scolopendra dehaani OX=26097... [more]
sp|Q6UXB8|PI16_HUMAN2.230e-2436.32Peptidase inhibitor 16 OS=Homo sapiens OX=9606 GN=... [more]
sp|Q9ET66|PI16_MOUSE8.725e-2334.22Peptidase inhibitor 16 OS=Mus musculus OX=10090 GN... [more]
sp|Q8JI38|CRVP_LATSE1.985e-2232.61Cysteine-rich venom protein latisemin OS=Laticauda... [more]
back to top
BLAST of Peptidase inhibitor 16 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A093RUZ07.927e-2734.41Peptidase inhibitor 16 (Fragment) OS=Manacus vitel... [more]
A0A0R3WJL81.589e-2634.63SCP domain-containing protein OS=Hydatigena taenia... [more]
A0A091GQ724.075e-2635.14Peptidase inhibitor 16 (Fragment) OS=Buceros rhino... [more]
A0A091S7R24.338e-2635.79Peptidase inhibitor 16 (Fragment) OS=Nestor notabi... [more]
A0A068YBI27.476e-2633.33GLIPR1 protein 1 OS=Echinococcus multilocularis OX... [more]
back to top
BLAST of Peptidase inhibitor 16 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000036030.17.926e-2027.72peptidase inhibitor 16 [Source:NCBI gene;Acc:10302... [more]
ENSAMXT00000031557.11.058e-1928.57peptidase inhibitor 16 [Source:NCBI gene;Acc:10302... [more]
ENSAMXT00000029824.11.722e-1927.72peptidase inhibitor 16 [Source:NCBI gene;Acc:10302... [more]
crispld21.728e-1728.13cysteine-rich secretory protein LCCL domain contai... [more]
ENSAMXT00000042591.11.034e-1631.25GLI pathogenesis related 1 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Peptidase inhibitor 16 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000374.14.875e-2028.72pep scaffold:Pmarinus_7.0:GL476650:75849:87118:-1 ... [more]
CRISP31.262e-1429.05cysteine rich secretory protein 3 [Source:HGNC Sym... [more]
ENSPMAT00000002250.12.066e-1226.14pep scaffold:Pmarinus_7.0:GL477299:1626:22672:-1 g... [more]
ENSPMAT00000000359.17.753e-1032.74pep scaffold:Pmarinus_7.0:GL487788:450:5784:1 gene... [more]
CRISP22.478e-840.58cysteine rich secretory protein 2 [Source:HGNC Sym... [more]
back to top
BLAST of Peptidase inhibitor 16 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
PRY31.553e-627.52Cell wall-associated protein involved in export of... [more]
back to top
BLAST of Peptidase inhibitor 16 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO488812.628e-726.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO352871.822e-624.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO371141.868e-624.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Peptidase inhibitor 16 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000023160.22.875e-2232.09peptidase inhibitor 16 [Source:NCBI gene;Acc:10116... [more]
crispld24.652e-1829.17cysteine rich secretory protein LCCL domain contai... [more]
pi15a4.375e-1629.41peptidase inhibitor 15 [Source:NCBI gene;Acc:10117... [more]
crispld1a1.954e-1527.59cysteine rich secretory protein LCCL domain contai... [more]
crispld1a2.295e-1527.59cysteine rich secretory protein LCCL domain contai... [more]
back to top
BLAST of Peptidase inhibitor 16 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000072679.15.547e-13490.55SMESG000072679.1[more]
SMESG000072936.14.373e-13088.56SMESG000072936.1[more]
SMESG000072936.15.623e-13088.56SMESG000072936.1[more]
SMESG000072928.11.101e-12081.09SMESG000072928.1[more]
SMESG000072928.11.324e-12081.09SMESG000072928.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024584 ID=SMED30024584|Name=Peptidase inhibitor 16|organism=Schmidtea mediterranea sexual|type=transcript|length=613bp
TGTTCTCATTTTAATTTCATCTTTATATTTTATTTGTTTCCAAAGTGCCC
AAGGAGATCTTACAGATCGACAGAAGAAGGAAATCCTTGGTGACCACAAT
GGGTACAGATCATATGTTGCTAGTGGAGGAGCTCAGCAGCCTAGTGCTGC
AAATATGCTGAAATTGAAATGGAGCGCTGAATCGGCATCGAAGGCGCAAA
ACCTAGCGGACCAATGTAAGTTTGATAACGTCACGATGGAGGATATAAGC
TACGGAACGTACAAAAGCGTTGGGAATAATAGTGAGCTGCTTACAGAGGA
TATATATATCAGCAATCCGGTTTACAAATTCTTCGAGTGGTTACAAGACG
CTTTTTCTTACGACGTTTCAACAAATACATGCAAATCTCCTACTTGTGAA
CATCATGCTCAAATGATATGGGCTGATTCTCAAGAACTTGGATGTGGTAT
GTCCAACTGTGACACTTCCCAGGTTAAGCAAAGTTATATTATCTGCATTT
ACGGACCTGGAGGAGATGTGAATCTCAAACCTCCATATATAAGCGGACCT
CCTTGCTCGCAATGTCCAATTGGAACATCTTGTGTCAATTCATTATGCAG
CTGTAGATCGGAA
back to top

protein sequence of SMED30024584-orf-1

>SMED30024584-orf-1 ID=SMED30024584-orf-1|Name=SMED30024584-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=204bp
VLILISSLYFICFQSAQGDLTDRQKKEILGDHNGYRSYVASGGAQQPSAA
NMLKLKWSAESASKAQNLADQCKFDNVTMEDISYGTYKSVGNNSELLTED
IYISNPVYKFFEWLQDAFSYDVSTNTCKSPTCEHHAQMIWADSQELGCGM
SNCDTSQVKQSYIICIYGPGGDVNLKPPYISGPPCSQCPIGTSCVNSLCS
CRSE
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000421tail
PLANA:0000484secretory system
PLANA:0002142parenchyma
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR035940CAP_sf
IPR001283CRISP-related
IPR002413V5_allergen-like
IPR014044CAP_domain
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002413Venom allergen 5-likePRINTSPR00838V5ALLERGENcoord: 19..35
score: 37.5
coord: 132..151
score: 42.19
IPR001283Cysteine-rich secretory protein-relatedPRINTSPR00837V5TPXLIKEcoord: 56..74
score: 36.62
coord: 133..149
score: 40.99
coord: 163..176
score: 28.72
IPR001283Cysteine-rich secretory protein-relatedPANTHERPTHR10334CYSTEINE-RICH SECRETORY PROTEIN-RELATEDcoord: 16..192
IPR014044CAP domainSMARTSM00198SCP_3coord: 23..175
e-value: 4.1E-20
score: 82.8
IPR014044CAP domainPFAMPF00188CAPcoord: 29..168
e-value: 1.0E-19
score: 71.6
IPR035940CAP superfamilyGENE3DG3DSA:3.40.33.10coord: 14..200
e-value: 9.9E-44
score: 151.2
IPR035940CAP superfamilySUPERFAMILYSSF55797PR-1-likecoord: 17..183
NoneNo IPR availablePANTHERPTHR10334:SF344AT27079P-RELATEDcoord: 16..192
NoneNo IPR availableCDDcd05380CAP_eukcoord: 25..169
e-value: 6.97612E-32
score: 110.622
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..18
score: 0.686