Nipped-B protein

Overview
NameNipped-B protein
Smed IDSMED30024574
Length (bp)7827
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Nipped-B protein (SMED30024574) t-SNE clustered cells

Violin plots show distribution of expression levels for Nipped-B protein (SMED30024574) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Nipped-B protein (SMED30024574) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Nipped-B protein (SMED30024574) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024574

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30024574SMESG000051020.1 dd_Smed_v4_3927_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30024574SMESG000051020.1 dd_Smed_v4_3927_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30024574SMESG000051020.1 dd_Smed_v4_3927_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30024574SMESG000051020.1 dd_Smed_v4_3927_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30024574SMESG000051020.1 Contig39437uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30024574SMESG000051020.1 Contig39437newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30024574SMESG000051020.1 Contig38270newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30024574SMESG000051020.1 Contig38270uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
gutSMED30024574SMESG000051020.1 Contig24429newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30024574SMESG000051020.1 Contig24429newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
whole organismSMED30024574SMESG000051020.1 Contig24429newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
cholinergic neuronSMED30024574SMESG000051020.1 dd_Smed_v6_3927_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30024574SMESG000051020.1 dd_Smed_v4_3927_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Nipped-B protein vs. Ensembl Human
Match: NIPBL (NIPBL cohesin loading factor [Source:HGNC Symbol;Acc:HGNC:28862])

HSP 1 Score: 704.131 bits (1816), Expect = 0.000e+0
Identity = 407/1066 (38.18%), Postives = 637/1066 (59.76%), Query Frame = 1
Query: 4285 KLLKNI----DKVQILRDALLDYLNAD-KFDTTAKYAREFYFGQWYTDCV----KELKSQNNQAIAISXXXXXXXXXXXXXXXXXXXXXXXXXXXXISIFQKAEDRRNHLLYKMFGTLPDESKKSKNNRINKLRIGSNPENNRYDIRLKGSLDYEDACLVCRYLASLKSSSQSFDIYLTKICRLLHDPSVALRTKAMRCLSAVVEADPTILRRDDIEKAVHLRFLDSSTSVREAAVELVGKYLLTRPELIDQYYPMIAERILDKGTSVRKRVIRIFRDICVEHTEFSKIPEICVKMIKRINDEEAIKKLVNEVFQNMWFSPVREKEGVKLLQKVMNITDVVSSCKDIGYEWFDQLLESLLKKEDSDKLRVVEKACKQIVDCLVQNIMRLEE-ISRDDNQ-----RLVSCMATLHLFTKIRPELMVQYTMTLQPYLNIRNVNDNDTYILHYVARILEVTVPLIEHPAQNHINQLEVDMVNLIDKQGKMVLESCVACLAASVNKISHNYSLVKDCFDNYFDTL--LKYRMEKDQTKTLPQATKRRILSRGLFTVGLLCKYFDFNC--LQLGKDINI--RIFETLMFYAEDNTLSCDIRTQAISGIGFLCIRYRELLICPRLLSFYHSILMNSLENTKTEDFPNLICCVLDNIYLFLVEEDDRLRHLDSSWKNNEKKESLKEMGDMSSGTGSHIAQLYLNAILENILQPWKPVRLKAVSLVVIIIRQGLINPISSVAYLISAQTDPNPSNRGKADNELAEIDKKFSGFINMKAVQGIRTSCKLQEVLEMYNIPENRLNWCSKHMLTTPVIVRGVYDHNADIPLALNHNLYTMLRSSKQFRRSFLYALLAIFGE-LKSRISLLIYVSENLAQFPYQSQEEPLYLVHNIDIMVSSIGPHFTQQIRDQLYPELVAHEFNSDPSSNHPATKPDTIHIDDEENPEVLYKRLMDN----------------PKALRNMRESIRNSRGCVLLISLKQYLRELYSLTDA*FDFNYG***YXXXXXXXGFRKIQKYSPLDTGKAWERQLTRRNGIRFDPLVALNLTEETVAQENIYQK 7368
            ++LK +    D++Q L+ ALLDYL+ + + D +  ++R+FY  QW+ D      K +KSQ ++  +   +   +++                      I  +AE+R+   L  +  T P        ++ + L++ S+            ++DY+DACL+ RYLAS++  +QSFDIYLT+I R+L + ++A+RTKAM+CLS VV  DP+IL R D+++ VH R +D+STSVREAAVEL+G+++L RP+L +QYY M+ ERILD G SVRKRVI+I RDIC+E   F KI E+CVKMI+R+NDEE IKKLVNE FQ +WF+P    +   + +K++NITDVV++C+D GY+WF+QLL++LLK E+    + V+KAC Q+VD LV++I++ EE ++  DN+     RLV+C+ TL LF+KIRP+LMV++ MT+QPYL  +    ND  ++  VA+ILE+ VPL+EHP++  +  +E D++ LI K G  V++ CV+CL A VNK++ N+  V  CF+ Y+  +  LK + ++D   T    T +  L R LFTVG LC++FDF+    +    +NI  ++ E LM++ + +    +++T+AI G+GF  I++  L+    + + Y++IL  S +N+      NL   VL N+  +L EED R++  D  WK   K+E LKEMGD+SSG  S I QLYL  +LE        VR  A++++ + + QGLI+P+  V YLI+  TDP P+ R KAD +L EIDKK++GFI+MKAV G++ S ++Q+           +N C    L  P  VRG     +    AL  +LY+M+R ++Q RR+FL +LL +F +  K+ +++L+Y+++NLA FPYQ+QEEPL+++H+IDI +S  G +  Q  ++ +  +    E  S PS  + ++       ++   P    KR+  +                P+    + E    S+G +LL+ LKQ+L+ L   +D+                     KIQKYSP ++ K +++ + R+ G+ F P   L+     +A   I ++
Sbjct: 1636 RILKQVSGGEDEIQQLQKALLDYLDENTETDPSLVFSRKFYIAQWFRDTTLETEKAMKSQKDEESSEGTHHAKEIETTGQ------------------IMHRAENRKK-FLRSIIKTTP--------SQFSTLKMNSD------------TVDYDDACLIVRYLASMRPFAQSFDIYLTQILRVLGENAIAVRTKAMKCLSEVVAVDPSILARLDMQRGVHGRLMDNSTSVREAAVELLGRFVLCRPQLAEQYYDMLIERILDTGISVRKRVIKILRDICIEQPTFPKITEMCVKMIRRVNDEEGIKKLVNETFQKLWFTPTPHNDKEAMTRKILNITDVVAACRDTGYDWFEQLLQNLLKSEEDSSYKPVKKACTQLVDNLVEHILKYEESLADSDNKGVNSGRLVACITTLFLFSKIRPQLMVKHAMTMQPYLTTKCSTQNDFMVICNVAKILELVVPLMEHPSETFLATIEEDLMKLIIKYGMTVVQHCVSCLGAVVNKVTQNFKFVWACFNRYYGAISKLKSQHQEDPNNT-SLLTNKPALLRSLFTVGALCRHFDFDLEDFKGNSKVNIKDKVLELLMYFTKHSDE--EVQTKAIIGLGFAFIQHPSLMFEQEVKNLYNNIL--SDKNSSV----NLKIQVLKNLQTYLQEEDTRMQQADRDWKKVAKQEDLKEMGDVSSGMSSSIMQLYLKQVLEAFFHTQSSVRHFALNVIALTLNQGLIHPVQCVPYLIAMGTDPEPAMRNKADQQLVEIDKKYAGFIHMKAVAGMKMSYQVQQA----------INTC----LKDP--VRGFRQDESSS--ALCSHLYSMIRGNRQHRRAFLISLLNLFDDTAKTDVTMLLYIADNLACFPYQTQEEPLFIMHHIDITLSVSGSNLLQSFKESMVKD-KRKERKSSPSKENESSD----SEEEVSRPRKSRKRVDSDSDSDSEDDINSVMKCLPENSAPLIEFANVSQGILLLLMLKQHLKNLCGFSDS---------------------KIQKYSPSESAKVYDKAINRKTGVHFHPKQTLDFLRSDMANSKITEE 2609          

HSP 2 Score: 345.125 bits (884), Expect = 2.311e-94
Identity = 211/478 (44.14%), Postives = 305/478 (63.81%), Query Frame = 1
Query: 2698 LDPSLITESTTYQHFISLVDGCLEVVEDLDLIKTMKEQTEXXXXXXXXXXXXXXREQLQAMCIEIAKLKATGSTKEVPMEKLTKILTLLMLNISSGAKVCLPVTEDG---EDNRLFKELAFERIGRSLDASFITINIMTSPDISNGVFIEDVQEAVVTSVKYQLVNLIFPEYDPAYRTVNHAKDNQSSIKAKRAREKELHKSKNIVYFYNRLVDIISNLSELVVIQTLTDNVILQLSSLGVSVFFVENISELQLVSLRLITTIFSKYEKHRNLIMDDIIASLSRLPSSKKNMRNYRLNSEDS------IQMLTAXXXXXXXXXXXXXKIEMNSNESEETALSVAPDKIVKETPKADSEAVIETSYNNAFATAYSFLRIFLHKSTVK-GEDDYRAIFENFVSDLLVTVNKPEWPAAETMLTLLGSLLTNQFINKHSDQTTRLICIDYLGTVASTLRRDAVSSTINPSDIENLIIDLIKG 4101
            L P  + +S+T++ F + ++  L+ +ED+D        T       +P ++L+ + QL  +  E AK+KA G   ++  +K  K+L +L  NI  G+K+   +  +    E+ RL+++L  ER+ +S DA   TINIMTSP++   V+IEDV E V+   K+ L N ++P+YDP YR   H     SS KAKRA+    HK + IV  YN++ DI+S+LSEL+ IQ LTD  ILQ+SS+G++ FFVEN+SELQL +++L+T +FS+YEKHR LI+++I  SL+RLP+SK+++RN+RLNS D       IQM+TAL L L+Q VV++   E +SN  E++              K D + VI  SY  A  TA +FL IFL K   K GE+DYR +FENFV DLL TVNKPEWPAAE +L+LLG LL +QF NK ++   R+  +DYLGTVA+ LR+DAV+S ++   IE ++  +  G
Sbjct: 1188 LTPEEMMDSSTFKRFTASIENILDNLEDMDF-------TAFGDDDEIPQELLLGKHQLNELGSESAKIKAMGIMDKLSTDKTVKVLNILEKNIQDGSKLSTLLNHNNDTEEEERLWRDLIMERVTKSADACLTTINIMTSPNMPKAVYIEDVIERVIQYTKFHLQNTLYPQYDPVYRLDPHGGGLLSS-KAKRAK-CSTHKQRVIVMLYNKVCDIVSSLSELLEIQLLTDTTILQVSSMGITPFFVENVSELQLCAIKLVTAVFSRYEKHRQLILEEIFTSLARLPTSKRSLRNFRLNSSDMDGEPMYIQMVTALVLQLIQCVVHLPSSEKDSNAEEDS------------NKKIDQDVVITNSYETAMRTAQNFLSIFLKKCGSKQGEEDYRPLFENFVQDLLSTVNKPEWPAAELLLSLLGRLLVHQFSNKSTEMALRVASLDYLGTVAARLRKDAVTSKMDQGSIERILKQVSGG 1644          
BLAST of Nipped-B protein vs. Ensembl Human
Match: NIPBL (NIPBL cohesin loading factor [Source:HGNC Symbol;Acc:HGNC:28862])

HSP 1 Score: 703.745 bits (1815), Expect = 0.000e+0
Identity = 407/1066 (38.18%), Postives = 635/1066 (59.57%), Query Frame = 1
Query: 4285 KLLKNI----DKVQILRDALLDYLNAD-KFDTTAKYAREFYFGQWYTDCV----KELKSQNNQAIAISXXXXXXXXXXXXXXXXXXXXXXXXXXXXISIFQKAEDRRNHLLYKMFGTLPDESKKSKNNRINKLRIGSNPENNRYDIRLKGSLDYEDACLVCRYLASLKSSSQSFDIYLTKICRLLHDPSVALRTKAMRCLSAVVEADPTILRRDDIEKAVHLRFLDSSTSVREAAVELVGKYLLTRPELIDQYYPMIAERILDKGTSVRKRVIRIFRDICVEHTEFSKIPEICVKMIKRINDEEAIKKLVNEVFQNMWFSPVREKEGVKLLQKVMNITDVVSSCKDIGYEWFDQLLESLLKKEDSDKLRVVEKACKQIVDCLVQNIMRLEE-ISRDDNQ-----RLVSCMATLHLFTKIRPELMVQYTMTLQPYLNIRNVNDNDTYILHYVARILEVTVPLIEHPAQNHINQLEVDMVNLIDKQGKMVLESCVACLAASVNKISHNYSLVKDCFDNYFDTL--LKYRMEKDQTKTLPQATKRRILSRGLFTVGLLCKYFDFNC--LQLGKDINI--RIFETLMFYAEDNTLSCDIRTQAISGIGFLCIRYRELLICPRLLSFYHSILMNSLENTKTEDFPNLICCVLDNIYLFLVEEDDRLRHLDSSWKNNEKKESLKEMGDMSSGTGSHIAQLYLNAILENILQPWKPVRLKAVSLVVIIIRQGLINPISSVAYLISAQTDPNPSNRGKADNELAEIDKKFSGFINMKAVQGIRTSCKLQEVLEMYNIPENRLNWCSKHMLTTPVIVRGVYDHNADIPLALNHNLYTMLRSSKQFRRSFLYALLAIFGE-LKSRISLLIYVSENLAQFPYQSQEEPLYLVHNIDIMVSSIGPHFTQQIRDQLYPELVAHEFNSDPSSNHPATKPDTIHIDDEENPEVLYKRLMDN----------------PKALRNMRESIRNSRGCVLLISLKQYLRELYSLTDA*FDFNYG***YXXXXXXXGFRKIQKYSPLDTGKAWERQLTRRNGIRFDPLVALNLTEETVAQENIYQK 7368
            ++LK +    D++Q L+ ALLDYL+ + + D +  ++R+FY  QW+ D      K +KSQ ++  +   +   +++                      I  +AE+R+   L  +  T P        ++ + L++ S+            ++DY+DACL+ RYLAS++  +QSFDIYLT+I R+L + ++A+RTKAM+CLS VV  DP+IL R D+++ VH R +D+STSVREAAVEL+G+++L RP+L +QYY M+ ERILD G SVRKRVI+I RDIC+E   F KI E+CVKMI+R+NDEE IKKLVNE FQ +WF+P    +   + +K++NITDVV++C+D GY+WF+QLL++LLK E+    + V+KAC Q+VD LV++I++ EE ++  DN+     RLV+C+ TL LF+KIRP+LMV++ MT+QPYL  +    ND  ++  VA+ILE+ VPL+EHP++  +  +E D++ LI K G  V++ CV+CL A VNK++ N+  V  CF+ Y+  +  LK + ++D   T    T +  L R LFTVG LC++FDF+    +    +NI  ++ E LM++ + +    +++T+AI G+GF  I++  L+    + + Y++IL  S +N+      NL   VL N+  +L EED R++  D  WK   K+E LKEMGD+SSG  S I QLYL  +LE        VR  A++++ + + QGLI+P+  V YLI+  TDP P+ R KAD +L EIDKK++GFI+MKAV G++ S ++Q+           +N C    L  P  VRG     +    AL  +LY+M+R ++Q RR+FL +LL +F +  K+ +++L+Y+++NLA FPYQ+QEEPL+++H+IDI +S  G +  Q  ++ +  +    E  S PS         +   ++   P    KR+  +                P+    + E    S+G +LL+ LKQ+L+ L   +D+                     KIQKYSP ++ K +++ + R+ G+ F P   L+     +A   I ++
Sbjct: 1636 RILKQVSGGEDEIQQLQKALLDYLDENTETDPSLVFSRKFYIAQWFRDTTLETEKAMKSQKDEESSEGTHHAKEIETTGQ------------------IMHRAENRKK-FLRSIIKTTP--------SQFSTLKMNSD------------TVDYDDACLIVRYLASMRPFAQSFDIYLTQILRVLGENAIAVRTKAMKCLSEVVAVDPSILARLDMQRGVHGRLMDNSTSVREAAVELLGRFVLCRPQLAEQYYDMLIERILDTGISVRKRVIKILRDICIEQPTFPKITEMCVKMIRRVNDEEGIKKLVNETFQKLWFTPTPHNDKEAMTRKILNITDVVAACRDTGYDWFEQLLQNLLKSEEDSSYKPVKKACTQLVDNLVEHILKYEESLADSDNKGVNSGRLVACITTLFLFSKIRPQLMVKHAMTMQPYLTTKCSTQNDFMVICNVAKILELVVPLMEHPSETFLATIEEDLMKLIIKYGMTVVQHCVSCLGAVVNKVTQNFKFVWACFNRYYGAISKLKSQHQEDPNNT-SLLTNKPALLRSLFTVGALCRHFDFDLEDFKGNSKVNIKDKVLELLMYFTKHSDE--EVQTKAIIGLGFAFIQHPSLMFEQEVKNLYNNIL--SDKNSSV----NLKIQVLKNLQTYLQEEDTRMQQADRDWKKVAKQEDLKEMGDVSSGMSSSIMQLYLKQVLEAFFHTQSSVRHFALNVIALTLNQGLIHPVQCVPYLIAMGTDPEPAMRNKADQQLVEIDKKYAGFIHMKAVAGMKMSYQVQQA----------INTC----LKDP--VRGFRQDESSS--ALCSHLYSMIRGNRQHRRAFLISLLNLFDDTAKTDVTMLLYIADNLACFPYQTQEEPLFIMHHIDITLSVSGSNLLQSFKESMVKD-KRKERKSSPS----KENESSDSEEEVSRPRKSRKRVDSDSDSDSEDDINSVMKCLPENSAPLIEFANVSQGILLLLMLKQHLKNLCGFSDS---------------------KIQKYSPSESAKVYDKAINRKTGVHFHPKQTLDFLRSDMANSKITEE 2609          

HSP 2 Score: 344.739 bits (883), Expect = 2.771e-94
Identity = 211/478 (44.14%), Postives = 305/478 (63.81%), Query Frame = 1
Query: 2698 LDPSLITESTTYQHFISLVDGCLEVVEDLDLIKTMKEQTEXXXXXXXXXXXXXXREQLQAMCIEIAKLKATGSTKEVPMEKLTKILTLLMLNISSGAKVCLPVTEDG---EDNRLFKELAFERIGRSLDASFITINIMTSPDISNGVFIEDVQEAVVTSVKYQLVNLIFPEYDPAYRTVNHAKDNQSSIKAKRAREKELHKSKNIVYFYNRLVDIISNLSELVVIQTLTDNVILQLSSLGVSVFFVENISELQLVSLRLITTIFSKYEKHRNLIMDDIIASLSRLPSSKKNMRNYRLNSEDS------IQMLTAXXXXXXXXXXXXXKIEMNSNESEETALSVAPDKIVKETPKADSEAVIETSYNNAFATAYSFLRIFLHKSTVK-GEDDYRAIFENFVSDLLVTVNKPEWPAAETMLTLLGSLLTNQFINKHSDQTTRLICIDYLGTVASTLRRDAVSSTINPSDIENLIIDLIKG 4101
            L P  + +S+T++ F + ++  L+ +ED+D        T       +P ++L+ + QL  +  E AK+KA G   ++  +K  K+L +L  NI  G+K+   +  +    E+ RL+++L  ER+ +S DA   TINIMTSP++   V+IEDV E V+   K+ L N ++P+YDP YR   H     SS KAKRA+    HK + IV  YN++ DI+S+LSEL+ IQ LTD  ILQ+SS+G++ FFVEN+SELQL +++L+T +FS+YEKHR LI+++I  SL+RLP+SK+++RN+RLNS D       IQM+TAL L L+Q VV++   E +SN  E++              K D + VI  SY  A  TA +FL IFL K   K GE+DYR +FENFV DLL TVNKPEWPAAE +L+LLG LL +QF NK ++   R+  +DYLGTVA+ LR+DAV+S ++   IE ++  +  G
Sbjct: 1188 LTPEEMMDSSTFKRFTASIENILDNLEDMDF-------TAFGDDDEIPQELLLGKHQLNELGSESAKIKAMGIMDKLSTDKTVKVLNILEKNIQDGSKLSTLLNHNNDTEEEERLWRDLIMERVTKSADACLTTINIMTSPNMPKAVYIEDVIERVIQYTKFHLQNTLYPQYDPVYRLDPHGGGLLSS-KAKRAK-CSTHKQRVIVMLYNKVCDIVSSLSELLEIQLLTDTTILQVSSMGITPFFVENVSELQLCAIKLVTAVFSRYEKHRQLILEEIFTSLARLPTSKRSLRNFRLNSSDMDGEPMYIQMVTALVLQLIQCVVHLPSSEKDSNAEEDS------------NKKIDQDVVITNSYETAMRTAQNFLSIFLKKCGSKQGEEDYRPLFENFVQDLLSTVNKPEWPAAELLLSLLGRLLVHQFSNKSTEMALRVASLDYLGTVAARLRKDAVTSKMDQGSIERILKQVSGG 1644          
BLAST of Nipped-B protein vs. Ensembl Human
Match: NIPBL (NIPBL cohesin loading factor [Source:HGNC Symbol;Acc:HGNC:28862])

HSP 1 Score: 646.351 bits (1666), Expect = 0.000e+0
Identity = 352/855 (41.17%), Postives = 536/855 (62.69%), Query Frame = 1
Query: 4285 KLLKNI----DKVQILRDALLDYLNAD-KFDTTAKYAREFYFGQWYTDCV----KELKSQNNQAIAISXXXXXXXXXXXXXXXXXXXXXXXXXXXXISIFQKAEDRRNHLLYKMFGTLPDESKKSKNNRINKLRIGSNPENNRYDIRLKGSLDYEDACLVCRYLASLKSSSQSFDIYLTKICRLLHDPSVALRTKAMRCLSAVVEADPTILRRDDIEKAVHLRFLDSSTSVREAAVELVGKYLLTRPELIDQYYPMIAERILDKGTSVRKRVIRIFRDICVEHTEFSKIPEICVKMIKRINDEEAIKKLVNEVFQNMWFSPVREKEGVKLLQKVMNITDVVSSCKDIGYEWFDQLLESLLKKEDSDKLRVVEKACKQIVDCLVQNIMRLEE-ISRDDNQ-----RLVSCMATLHLFTKIRPELMVQYTMTLQPYLNIRNVNDNDTYILHYVARILEVTVPLIEHPAQNHINQLEVDMVNLIDKQGKMVLESCVACLAASVNKISHNYSLVKDCFDNYFDTL--LKYRMEKDQTKTLPQATKRRILSRGLFTVGLLCKYFDFNC--LQLGKDINI--RIFETLMFYAEDNTLSCDIRTQAISGIGFLCIRYRELLICPRLLSFYHSILMNSLENTKTEDFPNLICCVLDNIYLFLVEEDDRLRHLDSSWKNNEKKESLKEMGDMSSGTGSHIAQLYLNAILENILQPWKPVRLKAVSLVVIIIRQGLINPISSVAYLISAQTDPNPSNRGKADNELAEIDKKFSGFINMKAVQGIRTSCKLQEVLEMYNIPENRLNWCSKHMLTTPVIVRGVYDHNADIPLALNHNLYTMLRSSKQFRRSFLYALLAIFGELKSRI 6786
            ++LK +    D++Q L+ ALLDYL+ + + D +  ++R+FY  QW+ D      K +KSQ ++  +   +   +++                      I  +AE+R+   L  +  T P        ++ + L++ S+            ++DY+DACL+ RYLAS++  +QSFDIYLT+I R+L + ++A+RTKAM+CLS VV  DP+IL R D+++ VH R +D+STSVREAAVEL+G+++L RP+L +QYY M+ ERILD G SVRKRVI+I RDIC+E   F KI E+CVKMI+R+NDEE IKKLVNE FQ +WF+P    +   + +K++NITDVV++C+D GY+WF+QLL++LLK E+    + V+KAC Q+VD LV++I++ EE ++  DN+     RLV+C+ TL LF+KIRP+LMV++ MT+QPYL  +    ND  ++  VA+ILE+ VPL+EHP++  +  +E D++ LI K G  V++ CV+CL A VNK++ N+  V  CF+ Y+  +  LK + ++D   T    T +  L R LFTVG LC++FDF+    +    +NI  ++ E LM++ + +    +++T+AI G+GF  I++  L+    + + Y++IL  S +N+      NL   VL N+  +L EED R++  D  WK   K+E LKEMGD+SSG  S I QLYL  +LE        VR  A++++ + + QGLI+P+  V YLI+  TDP P+ R KAD +L EIDKK++GFI+MKAV G++ S ++Q+           +N C    L  P  VRG     +    AL  +LY+M+R ++Q RR+FL +LL +F +  S +
Sbjct: 1636 RILKQVSGGEDEIQQLQKALLDYLDENTETDPSLVFSRKFYIAQWFRDTTLETEKAMKSQKDEESSEGTHHAKEIETTGQ------------------IMHRAENRKK-FLRSIIKTTP--------SQFSTLKMNSD------------TVDYDDACLIVRYLASMRPFAQSFDIYLTQILRVLGENAIAVRTKAMKCLSEVVAVDPSILARLDMQRGVHGRLMDNSTSVREAAVELLGRFVLCRPQLAEQYYDMLIERILDTGISVRKRVIKILRDICIEQPTFPKITEMCVKMIRRVNDEEGIKKLVNETFQKLWFTPTPHNDKEAMTRKILNITDVVAACRDTGYDWFEQLLQNLLKSEEDSSYKPVKKACTQLVDNLVEHILKYEESLADSDNKGVNSGRLVACITTLFLFSKIRPQLMVKHAMTMQPYLTTKCSTQNDFMVICNVAKILELVVPLMEHPSETFLATIEEDLMKLIIKYGMTVVQHCVSCLGAVVNKVTQNFKFVWACFNRYYGAISKLKSQHQEDPNNT-SLLTNKPALLRSLFTVGALCRHFDFDLEDFKGNSKVNIKDKVLELLMYFTKHSDE--EVQTKAIIGLGFAFIQHPSLMFEQEVKNLYNNIL--SDKNSSV----NLKIQVLKNLQTYLQEEDTRMQQADRDWKKVAKQEDLKEMGDVSSGMSSSIMQLYLKQVLEAFFHTQSSVRHFALNVIALTLNQGLIHPVQCVPYLIAMGTDPEPAMRNKADQQLVEIDKKYAGFIHMKAVAGMKMSYQVQQA----------INTC----LKDP--VRGFRQDESSS--ALCSHLYSMIRGNRQHRRAFLISLLNLFDDTASMV 2424          

HSP 2 Score: 345.125 bits (884), Expect = 1.972e-94
Identity = 211/478 (44.14%), Postives = 305/478 (63.81%), Query Frame = 1
Query: 2698 LDPSLITESTTYQHFISLVDGCLEVVEDLDLIKTMKEQTEXXXXXXXXXXXXXXREQLQAMCIEIAKLKATGSTKEVPMEKLTKILTLLMLNISSGAKVCLPVTEDG---EDNRLFKELAFERIGRSLDASFITINIMTSPDISNGVFIEDVQEAVVTSVKYQLVNLIFPEYDPAYRTVNHAKDNQSSIKAKRAREKELHKSKNIVYFYNRLVDIISNLSELVVIQTLTDNVILQLSSLGVSVFFVENISELQLVSLRLITTIFSKYEKHRNLIMDDIIASLSRLPSSKKNMRNYRLNSEDS------IQMLTAXXXXXXXXXXXXXKIEMNSNESEETALSVAPDKIVKETPKADSEAVIETSYNNAFATAYSFLRIFLHKSTVK-GEDDYRAIFENFVSDLLVTVNKPEWPAAETMLTLLGSLLTNQFINKHSDQTTRLICIDYLGTVASTLRRDAVSSTINPSDIENLIIDLIKG 4101
            L P  + +S+T++ F + ++  L+ +ED+D        T       +P ++L+ + QL  +  E AK+KA G   ++  +K  K+L +L  NI  G+K+   +  +    E+ RL+++L  ER+ +S DA   TINIMTSP++   V+IEDV E V+   K+ L N ++P+YDP YR   H     SS KAKRA+    HK + IV  YN++ DI+S+LSEL+ IQ LTD  ILQ+SS+G++ FFVEN+SELQL +++L+T +FS+YEKHR LI+++I  SL+RLP+SK+++RN+RLNS D       IQM+TAL L L+Q VV++   E +SN  E++              K D + VI  SY  A  TA +FL IFL K   K GE+DYR +FENFV DLL TVNKPEWPAAE +L+LLG LL +QF NK ++   R+  +DYLGTVA+ LR+DAV+S ++   IE ++  +  G
Sbjct: 1188 LTPEEMMDSSTFKRFTASIENILDNLEDMDF-------TAFGDDDEIPQELLLGKHQLNELGSESAKIKAMGIMDKLSTDKTVKVLNILEKNIQDGSKLSTLLNHNNDTEEEERLWRDLIMERVTKSADACLTTINIMTSPNMPKAVYIEDVIERVIQYTKFHLQNTLYPQYDPVYRLDPHGGGLLSS-KAKRAK-CSTHKQRVIVMLYNKVCDIVSSLSELLEIQLLTDTTILQVSSMGITPFFVENVSELQLCAIKLVTAVFSRYEKHRQLILEEIFTSLARLPTSKRSLRNFRLNSSDMDGEPMYIQMVTALVLQLIQCVVHLPSSEKDSNAEEDS------------NKKIDQDVVITNSYETAMRTAQNFLSIFLKKCGSKQGEEDYRPLFENFVQDLLSTVNKPEWPAAELLLSLLGRLLVHQFSNKSTEMALRVASLDYLGTVAARLRKDAVTSKMDQGSIERILKQVSGG 1644          
BLAST of Nipped-B protein vs. Ensembl Human
Match: DDX3Y (DEAD-box helicase 3 Y-linked [Source:HGNC Symbol;Acc:HGNC:2699])

HSP 1 Score: 286.96 bits (733), Expect = 3.277e-147
Identity = 136/237 (57.38%), Postives = 172/237 (72.57%), Query Frame = 3
Query:  510 SAINFDKYDAIPVSVTGPDYSAINVENFDELKLNPIIRNNILLASYQRPTPIQKNAIPAILEHRDIMACAQTGSGKTAAFLIPIINHLISQDLSPQ--------RYTKTA-YPKCLILAPTRELAIQILSESQKFSLNTQMRSCVVYGGADTHSQIREVQIGCHLLVATPGRLVDFIEKNKISLEMCKYIVLDEADRMLDMGFEPQIRKIIEESNMPSGINRQTLMFSATFPKEIQV 1193
            + INF+KYD IPV  TG +    ++ENF ++ +  II  NI L  Y RPTP+QK+AIP I   RD+MACAQTGSGKTAAFL+PI++ + +              RY +   YP  L+LAPTRELA+QI  E++KFS  +++R CVVYGGAD   QIR+++ GCHLLVATPGRLVD +E+ KI L+ CKY+VLDEADRMLDMGFEPQIR+I+E+  MP    R T+MFSATFPKEIQ+
Sbjct:  154 TGINFEKYDDIPVEATGSN-CPPHIENFSDIDMGEIIMGNIELTRYTRPTPVQKHAIPIIKGKRDLMACAQTGSGKTAAFLLPILSQIYTDGPGEALKAVKENGRYGRRKQYPISLVLAPTRELAVQIYEEARKFSYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQM 389          

HSP 2 Score: 258.84 bits (660), Expect = 3.277e-147
Identity = 130/217 (59.91%), Postives = 163/217 (75.12%), Query Frame = 2
Query: 1259 LAADFLYNYIFMTVGRVGSTSDSIKQEIIYMTDVEKLNYLKNIFNTTAPNTLILIFVETKKGADSLARFLLSKGYPVSSIHGDRNQGEREHALNMFRNGQCPILVATAVAARGLDIPNVKHVINYDLPSDIEEYVHRIGRTGRLGNHGRATSFYVDKNNNIAIDLVDLLKEANQIVPQWLSALADELKRNSVIGSNNKRHNQRRFKNGNFGGRDYRQ 1909
            LA DFL  YIF+ VGRVGSTS++I Q+++++ D++K ++L +I   T  ++L L+FVETKKGADSL  FL  +GY  +SIHGDR+Q +RE AL+ FR+G+ PILVATAVAARGLDI NV+HVIN+DLPSDIEEYVHRIGRTGR+GN G ATSF+ +KN NI  DL+DLL EA Q VP WL  +A E   +   G +  R    RF +G FG RDYRQ
Sbjct:  390 LARDFLDEYIFLAVGRVGSTSENITQKVVWVEDLDKRSFLLDILGATGSDSLTLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVRHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNEKNMNITKDLLDLLVEAKQEVPSWLENMAYE---HHYKGGSRGRSKSNRF-SGGFGARDYRQ 602          
BLAST of Nipped-B protein vs. Ensembl Human
Match: DDX3Y (DEAD-box helicase 3 Y-linked [Source:HGNC Symbol;Acc:HGNC:2699])

HSP 1 Score: 286.96 bits (733), Expect = 3.277e-147
Identity = 136/237 (57.38%), Postives = 172/237 (72.57%), Query Frame = 3
Query:  510 SAINFDKYDAIPVSVTGPDYSAINVENFDELKLNPIIRNNILLASYQRPTPIQKNAIPAILEHRDIMACAQTGSGKTAAFLIPIINHLISQDLSPQ--------RYTKTA-YPKCLILAPTRELAIQILSESQKFSLNTQMRSCVVYGGADTHSQIREVQIGCHLLVATPGRLVDFIEKNKISLEMCKYIVLDEADRMLDMGFEPQIRKIIEESNMPSGINRQTLMFSATFPKEIQV 1193
            + INF+KYD IPV  TG +    ++ENF ++ +  II  NI L  Y RPTP+QK+AIP I   RD+MACAQTGSGKTAAFL+PI++ + +              RY +   YP  L+LAPTRELA+QI  E++KFS  +++R CVVYGGAD   QIR+++ GCHLLVATPGRLVD +E+ KI L+ CKY+VLDEADRMLDMGFEPQIR+I+E+  MP    R T+MFSATFPKEIQ+
Sbjct:  154 TGINFEKYDDIPVEATGSN-CPPHIENFSDIDMGEIIMGNIELTRYTRPTPVQKHAIPIIKGKRDLMACAQTGSGKTAAFLLPILSQIYTDGPGEALKAVKENGRYGRRKQYPISLVLAPTRELAVQIYEEARKFSYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQM 389          

HSP 2 Score: 258.84 bits (660), Expect = 3.277e-147
Identity = 130/217 (59.91%), Postives = 163/217 (75.12%), Query Frame = 2
Query: 1259 LAADFLYNYIFMTVGRVGSTSDSIKQEIIYMTDVEKLNYLKNIFNTTAPNTLILIFVETKKGADSLARFLLSKGYPVSSIHGDRNQGEREHALNMFRNGQCPILVATAVAARGLDIPNVKHVINYDLPSDIEEYVHRIGRTGRLGNHGRATSFYVDKNNNIAIDLVDLLKEANQIVPQWLSALADELKRNSVIGSNNKRHNQRRFKNGNFGGRDYRQ 1909
            LA DFL  YIF+ VGRVGSTS++I Q+++++ D++K ++L +I   T  ++L L+FVETKKGADSL  FL  +GY  +SIHGDR+Q +RE AL+ FR+G+ PILVATAVAARGLDI NV+HVIN+DLPSDIEEYVHRIGRTGR+GN G ATSF+ +KN NI  DL+DLL EA Q VP WL  +A E   +   G +  R    RF +G FG RDYRQ
Sbjct:  390 LARDFLDEYIFLAVGRVGSTSENITQKVVWVEDLDKRSFLLDILGATGSDSLTLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVRHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNEKNMNITKDLLDLLVEAKQEVPSWLENMAYE---HHYKGGSRGRSKSNRF-SGGFGARDYRQ 602          
BLAST of Nipped-B protein vs. Ensembl Celegans
Match: laf-1 (ATP-dependent RNA helicase laf-1 [Source:UniProtKB/Swiss-Prot;Acc:D0PV95])

HSP 1 Score: 258.455 bits (659), Expect = 1.081e-131
Identity = 122/236 (51.69%), Postives = 168/236 (71.19%), Query Frame = 3
Query:  510 SAINFDKYDAIPVSVTGPDYSAINVENFDELKLNPIIRNNILLASYQRPTPIQKNAIPAILEHRDIMACAQTGSGKTAAFLIPIINHL-------ISQDLSPQRYTKTAYPKCLILAPTRELAIQILSESQKFSLNTQMRSCVVYGGADTHS-QIREVQIGCHLLVATPGRLVDFIEKNKISLEMCKYIVLDEADRMLDMGFEPQIRKIIEESNMPSGINRQTLMFSATFPKEIQV 1193
            S INFDKY+ IPV  TG D     +  F +L L+  I  NI  A Y RPTP+QK +IPA+   RD+M+CAQTGSGKTAAFL+P++N +       + + ++     K  YP  L+L+PTREL++QI +ES+KF+  T + S ++YGG + +  QI ++++GCH+L+ATPGRL+D +++  I +E C+Y+VLDEADRMLDMGFEPQIR+I+E + MPS   R T MFSATFPKEIQ+
Sbjct:  207 SGINFDKYEEIPVEATGDDVPQP-ISLFSDLSLHEWIEENIKTAGYDRPTPVQKYSIPALQGGRDLMSCAQTGSGKTAAFLVPLVNAILQDGPDAVHRSVTSSGGRKKQYPSALVLSPTRELSLQIFNESRKFAYRTPITSALLYGGRENYKDQIHKLRLGCHILIATPGRLIDVMDQGLIGMEGCRYLVLDEADRMLDMGFEPQIRQIVECNRMPSKEERITAMFSATFPKEIQL 441          

HSP 2 Score: 234.572 bits (597), Expect = 1.081e-131
Identity = 113/188 (60.11%), Postives = 147/188 (78.19%), Query Frame = 2
Query: 1259 LAADFLY-NYIFMTVGRVGSTSDSIKQEIIYMTDVEKLNYLKNIFNTTAPNTLILIFVETKKGADSLARFLLSKGYPVSSIHGDRNQGEREHALNMFRNGQCPILVATAVAARGLDIPNVKHVINYDLPSDIEEYVHRIGRTGRLGNHGRATSFYVDKNNNIAIDLVDLLKEANQIVPQWLSALADEL 1819
            LA DFL  NY+F+ VGRVGSTS++I Q+I+++ + EK +YL ++ + T  ++L L+FVETK+GA  LA +L  + Y V +IHGD  Q ERE  L++FR G  PILVATAVAARGLDIPNVKHVINYDLPSD++EYVHRIGRTGR+GN G ATSF+ DKN NIA +L+DL+ EANQ +P WL  ++ ++
Sbjct:  442 LAQDFLKENYVFLAVGRVGSTSENIMQKIVWVEEDEKRSYLMDLLDATGDSSLTLVFVETKRGASDLAYYLNRQNYEVVTIHGDLKQFEREKHLDLFRTGTAPILVATAVAARGLDIPNVKHVINYDLPSDVDEYVHRIGRTGRVGNVGLATSFFNDKNRNIARELMDLIVEANQELPDWLEGMSGDM 629          
BLAST of Nipped-B protein vs. Ensembl Celegans
Match: laf-1 (ATP-dependent RNA helicase laf-1 [Source:UniProtKB/Swiss-Prot;Acc:D0PV95])

HSP 1 Score: 258.07 bits (658), Expect = 1.288e-131
Identity = 122/236 (51.69%), Postives = 168/236 (71.19%), Query Frame = 3
Query:  510 SAINFDKYDAIPVSVTGPDYSAINVENFDELKLNPIIRNNILLASYQRPTPIQKNAIPAILEHRDIMACAQTGSGKTAAFLIPIINHL-------ISQDLSPQRYTKTAYPKCLILAPTRELAIQILSESQKFSLNTQMRSCVVYGGADTHS-QIREVQIGCHLLVATPGRLVDFIEKNKISLEMCKYIVLDEADRMLDMGFEPQIRKIIEESNMPSGINRQTLMFSATFPKEIQV 1193
            S INFDKY+ IPV  TG D     +  F +L L+  I  NI  A Y RPTP+QK +IPA+   RD+M+CAQTGSGKTAAFL+P++N +       + + ++     K  YP  L+L+PTREL++QI +ES+KF+  T + S ++YGG + +  QI ++++GCH+L+ATPGRL+D +++  I +E C+Y+VLDEADRMLDMGFEPQIR+I+E + MPS   R T MFSATFPKEIQ+
Sbjct:  142 SGINFDKYEEIPVEATGDDVPQ-PISLFSDLSLHEWIEENIKTAGYDRPTPVQKYSIPALQGGRDLMSCAQTGSGKTAAFLVPLVNAILQDGPDAVHRSVTSSGGRKKQYPSALVLSPTRELSLQIFNESRKFAYRTPITSALLYGGRENYKDQIHKLRLGCHILIATPGRLIDVMDQGLIGMEGCRYLVLDEADRMLDMGFEPQIRQIVECNRMPSKEERITAMFSATFPKEIQL 376          

HSP 2 Score: 234.572 bits (597), Expect = 1.288e-131
Identity = 113/188 (60.11%), Postives = 147/188 (78.19%), Query Frame = 2
Query: 1259 LAADFLY-NYIFMTVGRVGSTSDSIKQEIIYMTDVEKLNYLKNIFNTTAPNTLILIFVETKKGADSLARFLLSKGYPVSSIHGDRNQGEREHALNMFRNGQCPILVATAVAARGLDIPNVKHVINYDLPSDIEEYVHRIGRTGRLGNHGRATSFYVDKNNNIAIDLVDLLKEANQIVPQWLSALADEL 1819
            LA DFL  NY+F+ VGRVGSTS++I Q+I+++ + EK +YL ++ + T  ++L L+FVETK+GA  LA +L  + Y V +IHGD  Q ERE  L++FR G  PILVATAVAARGLDIPNVKHVINYDLPSD++EYVHRIGRTGR+GN G ATSF+ DKN NIA +L+DL+ EANQ +P WL  ++ ++
Sbjct:  377 LAQDFLKENYVFLAVGRVGSTSENIMQKIVWVEEDEKRSYLMDLLDATGDSSLTLVFVETKRGASDLAYYLNRQNYEVVTIHGDLKQFEREKHLDLFRTGTAPILVATAVAARGLDIPNVKHVINYDLPSDVDEYVHRIGRTGRVGNVGLATSFFNDKNRNIARELMDLIVEANQELPDWLEGMSGDM 564          
BLAST of Nipped-B protein vs. Ensembl Celegans
Match: vbh-1 (Vasa-and Belle-like Helicase [Source:UniProtKB/TrEMBL;Acc:Q65XX1])

HSP 1 Score: 257.299 bits (656), Expect = 4.183e-127
Identity = 123/235 (52.34%), Postives = 168/235 (71.49%), Query Frame = 3
Query:  510 SAINFDKYDAIPVSVTGPDYSAINVENFDELKLNPIIRNNILLASYQRPTPIQKNAIPAILEHRDIMACAQTGSGKTAAFLIPIINHLISQD---LSPQRYT---KTAYPKCLILAPTRELAIQILSESQKFSLNTQMRSCVVYGGADTH-SQIREVQIGCHLLVATPGRLVDFIEKNKISLEMCKYIVLDEADRMLDMGFEPQIRKIIEESNMPSGINRQTLMFSATFPKEIQV 1193
            S INFDKY+ IPV V+G    A  +E+F+E    P +  N+  + Y +PTP+QK++IP +L +RD+M+CAQTGSGKTAAFL+PII H+++     + P  +T   +T YP  L+L+PTRELAIQI  E+ KFS  + +++ ++YGG + +  Q+  ++ G H+L+ATPGRL+D IE+  I L  C+Y+VLDEADRMLDMGFEPQIRKI+ +  MP    R T MFSATFPKEIQV
Sbjct:   96 SGINFDKYENIPVEVSGDSVPAA-IEHFNEAGFGPAVMENVNRSGYSKPTPVQKHSIPTLLANRDLMSCAQTGSGKTAAFLLPIIQHILAGGPDMVKPPAFTNGRRTYYPCALVLSPTRELAIQIHKEATKFSYKSNIQTAILYGGRENYRDQVNRLRAGTHILIATPGRLIDIIEQGFIGLAGCRYLVLDEADRMLDMGFEPQIRKIVGQG-MPPKTARTTAMFSATFPKEIQV 328          

HSP 2 Score: 220.32 bits (560), Expect = 4.183e-127
Identity = 112/187 (59.89%), Postives = 138/187 (73.80%), Query Frame = 2
Query: 1259 LAADFLY-NYIFMTVGRVGSTSDSIKQEIIYMTDVEKLNYLKNIFNTTAPNTLILIFVETKKGADSLARFLLSKGYPVSSIHGDRNQGEREHALNMFRNGQCPILVATAVAARGLDIPNVKHVINYDLPSDIEEYVHRIGRTGRLGNHGRATSFYVDKNNNIAIDLVDLLKEANQIVPQWLSALADE 1816
            LA DFL  NYIF+ VGRVGSTS++I+Q ++++ ++EK + L  I        L+L+FVETK+GA+ LA FL  +     SIHGD  Q ERE  L +FR+GQCPILVATAVAARGLDIPNV+HVINYDLP D +EYVHRIGRTGR GN G ATSF+ DKN  I  DL +L+ E+NQ VP+WL  +A E
Sbjct:  329 LAKDFLKDNYIFLAVGRVGSTSENIEQRLLWVNEMEKRSNLMEILMNEHSENLVLVFVETKRGANELAYFLNRQQIRSVSIHGDLKQIERERNLELFRSGQCPILVATAVAARGLDIPNVRHVINYDLPGDSDEYVHRIGRTGRCGNLGIATSFFNDKNRGIGRDLKNLIVESNQEVPEWLHQVAAE 515          
BLAST of Nipped-B protein vs. Ensembl Celegans
Match: vbh-1 (Vasa-and Belle-like Helicase [Source:UniProtKB/TrEMBL;Acc:Q65XX1])

HSP 1 Score: 257.299 bits (656), Expect = 4.183e-127
Identity = 123/235 (52.34%), Postives = 168/235 (71.49%), Query Frame = 3
Query:  510 SAINFDKYDAIPVSVTGPDYSAINVENFDELKLNPIIRNNILLASYQRPTPIQKNAIPAILEHRDIMACAQTGSGKTAAFLIPIINHLISQD---LSPQRYT---KTAYPKCLILAPTRELAIQILSESQKFSLNTQMRSCVVYGGADTH-SQIREVQIGCHLLVATPGRLVDFIEKNKISLEMCKYIVLDEADRMLDMGFEPQIRKIIEESNMPSGINRQTLMFSATFPKEIQV 1193
            S INFDKY+ IPV V+G    A  +E+F+E    P +  N+  + Y +PTP+QK++IP +L +RD+M+CAQTGSGKTAAFL+PII H+++     + P  +T   +T YP  L+L+PTRELAIQI  E+ KFS  + +++ ++YGG + +  Q+  ++ G H+L+ATPGRL+D IE+  I L  C+Y+VLDEADRMLDMGFEPQIRKI+ +  MP    R T MFSATFPKEIQV
Sbjct:   96 SGINFDKYENIPVEVSGDSVPAA-IEHFNEAGFGPAVMENVNRSGYSKPTPVQKHSIPTLLANRDLMSCAQTGSGKTAAFLLPIIQHILAGGPDMVKPPAFTNGRRTYYPCALVLSPTRELAIQIHKEATKFSYKSNIQTAILYGGRENYRDQVNRLRAGTHILIATPGRLIDIIEQGFIGLAGCRYLVLDEADRMLDMGFEPQIRKIVGQG-MPPKTARTTAMFSATFPKEIQV 328          

HSP 2 Score: 220.32 bits (560), Expect = 4.183e-127
Identity = 112/187 (59.89%), Postives = 138/187 (73.80%), Query Frame = 2
Query: 1259 LAADFLY-NYIFMTVGRVGSTSDSIKQEIIYMTDVEKLNYLKNIFNTTAPNTLILIFVETKKGADSLARFLLSKGYPVSSIHGDRNQGEREHALNMFRNGQCPILVATAVAARGLDIPNVKHVINYDLPSDIEEYVHRIGRTGRLGNHGRATSFYVDKNNNIAIDLVDLLKEANQIVPQWLSALADE 1816
            LA DFL  NYIF+ VGRVGSTS++I+Q ++++ ++EK + L  I        L+L+FVETK+GA+ LA FL  +     SIHGD  Q ERE  L +FR+GQCPILVATAVAARGLDIPNV+HVINYDLP D +EYVHRIGRTGR GN G ATSF+ DKN  I  DL +L+ E+NQ VP+WL  +A E
Sbjct:  329 LAKDFLKDNYIFLAVGRVGSTSENIEQRLLWVNEMEKRSNLMEILMNEHSENLVLVFVETKRGANELAYFLNRQQIRSVSIHGDLKQIERERNLELFRSGQCPILVATAVAARGLDIPNVRHVINYDLPGDSDEYVHRIGRTGRCGNLGIATSFFNDKNRGIGRDLKNLIVESNQEVPEWLHQVAAE 515          
BLAST of Nipped-B protein vs. Ensembl Celegans
Match: vbh-1 (Vasa-and Belle-like Helicase [Source:UniProtKB/TrEMBL;Acc:Q65XX1])

HSP 1 Score: 257.299 bits (656), Expect = 4.471e-127
Identity = 123/235 (52.34%), Postives = 168/235 (71.49%), Query Frame = 3
Query:  510 SAINFDKYDAIPVSVTGPDYSAINVENFDELKLNPIIRNNILLASYQRPTPIQKNAIPAILEHRDIMACAQTGSGKTAAFLIPIINHLISQD---LSPQRYT---KTAYPKCLILAPTRELAIQILSESQKFSLNTQMRSCVVYGGADTH-SQIREVQIGCHLLVATPGRLVDFIEKNKISLEMCKYIVLDEADRMLDMGFEPQIRKIIEESNMPSGINRQTLMFSATFPKEIQV 1193
            S INFDKY+ IPV V+G    A  +E+F+E    P +  N+  + Y +PTP+QK++IP +L +RD+M+CAQTGSGKTAAFL+PII H+++     + P  +T   +T YP  L+L+PTRELAIQI  E+ KFS  + +++ ++YGG + +  Q+  ++ G H+L+ATPGRL+D IE+  I L  C+Y+VLDEADRMLDMGFEPQIRKI+ +  MP    R T MFSATFPKEIQV
Sbjct:   99 SGINFDKYENIPVEVSGDSVPAA-IEHFNEAGFGPAVMENVNRSGYSKPTPVQKHSIPTLLANRDLMSCAQTGSGKTAAFLLPIIQHILAGGPDMVKPPAFTNGRRTYYPCALVLSPTRELAIQIHKEATKFSYKSNIQTAILYGGRENYRDQVNRLRAGTHILIATPGRLIDIIEQGFIGLAGCRYLVLDEADRMLDMGFEPQIRKIVGQG-MPPKTARTTAMFSATFPKEIQV 331          

HSP 2 Score: 220.32 bits (560), Expect = 4.471e-127
Identity = 112/187 (59.89%), Postives = 138/187 (73.80%), Query Frame = 2
Query: 1259 LAADFLY-NYIFMTVGRVGSTSDSIKQEIIYMTDVEKLNYLKNIFNTTAPNTLILIFVETKKGADSLARFLLSKGYPVSSIHGDRNQGEREHALNMFRNGQCPILVATAVAARGLDIPNVKHVINYDLPSDIEEYVHRIGRTGRLGNHGRATSFYVDKNNNIAIDLVDLLKEANQIVPQWLSALADE 1816
            LA DFL  NYIF+ VGRVGSTS++I+Q ++++ ++EK + L  I        L+L+FVETK+GA+ LA FL  +     SIHGD  Q ERE  L +FR+GQCPILVATAVAARGLDIPNV+HVINYDLP D +EYVHRIGRTGR GN G ATSF+ DKN  I  DL +L+ E+NQ VP+WL  +A E
Sbjct:  332 LAKDFLKDNYIFLAVGRVGSTSENIEQRLLWVNEMEKRSNLMEILMNEHSENLVLVFVETKRGANELAYFLNRQQIRSVSIHGDLKQIERERNLELFRSGQCPILVATAVAARGLDIPNVRHVINYDLPGDSDEYVHRIGRTGRCGNLGIATSFFNDKNRGIGRDLKNLIVESNQEVPEWLHQVAAE 518          
BLAST of Nipped-B protein vs. Ensembl Fly
Match: Nipped-B (gene:FBgn0026401 transcript:FBtr0301455)

HSP 1 Score: 761.525 bits (1965), Expect = 0.000e+0
Identity = 544/1669 (32.59%), Postives = 874/1669 (52.37%), Query Frame = 1
Query: 2596 IKKSQEINHKRRERVNGLTKLSNTTKKVQLPLDMLDPSLITESTTYQHFISLVDGCLEVVEDLDLIKTMKEQTEXXXXXXXXXXXXXXREQLQAMCIEIAKLKATGSTKEVPMEKLTKILTLLMLNISSGAKVCLPVTEDGEDNRLFKELAFERIGRSLDASFITINIMTSPDISNGVFI-EDVQEAVVTSVKYQLVNLIFPEYDPAYRTVNHAKDNQSSIKAKRAREK-ELHKSKN--IVYFYNRLVDIISNLSELVVIQTLTDNVILQLSSLGVSVFFVENISELQLVSLRLITTIFSK--YEKHRNLIMDDIIASLSRLPSSKKNMRNYRL-NSEDSIQMLTAXXXXXXXXXXXX-XKIEMNSNESEETALSVAPDKIVKETPKADSEAVIETSYNNAFATAYSFLRIFLHKSTVKG-EDDYRAIFENFVSDLLVTVNKPEWPAAETMLTLLGSLLTNQFINKHSDQTTRLICIDYLGTVASTLRRDAVSSTINPSDIENLIIDLIKGSKSSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXARGTKKKNSDINHKSQYNKLLKNIDKVQILRDALLDYL--NADKFDTTAKYAREFYFGQWYTDCVKELKSQNNQAIAISXXXXXXXXXXXXXXXXXXXXXXXXXXXXISIFQKAEDRRNHLL----YKMFGTLPDESKKSKNNRINKLRIGS--NPENNRYDIRLKGSLDYEDACLVCRYLASLKSSSQSFDIYLTKICRLLHDPSVALRTKAMRCLSAVVEADPTILRRDDIEKAVHLRFLDSSTSVREAAVELVGKYLLTRPELIDQYYPMIAERILDKGTSVRKRVIRIFRDICVEHTEFSKIPEICVKMIKRINDEEAIKKLVNEVFQNMWFSPVREKEGVKLLQKVMNITDVVSSCKDIGYEWFDQLLESLLK----------------KEDSDKLRVVEKACKQIVDCLVQNIMRLEEISRDDNQRLVSCMATLHLFTKIRPELMVQYTMTLQPYLNIRNVNDNDTYILHYVARILEVTVPLIEHPAQNHINQLEVDMVNLIDKQGKMVLESCVACLAASVNKISHNYSLVKDCFDNYFDTLLKYRMEKDQTKTLPQATKRRILSRGLFTVGLLCKYFDFNC-LQLGK-------DINIRIFETLMFYAEDNTLSCDIRTQAISGIGFLCIRYRELLICPRLLSFYHSILMNSLENTKTEDFPNLICCVLDNIYLFLVEEDDRLRHLDSSWKNNEKKESLKEMGDMSSGTGSHIAQLYLNAILENILQPWKPVRLKAVSLVVIIIRQGLINPISSVAYLISAQTDPNPSNRGKADNELAEIDKKFSGFINMKAVQGIRTSCKLQEVLEMYNIPENRLNWCSKHMLTTPVIVRGVYDHNAD-IPLALNHNLYTMLRSSKQFRRSFLYALLAIFGELKSRISLLIYVSENLAQFPYQSQEEPLYLVHNIDIMVSSIGPHFTQQIRDQLYPELVAHEFNSDPSSNHPATKPDTIHIDDEENPEVLYKRLMDNPKALRNMRESIRNSRGCVLLISLKQYLRELYSLTDA*FDFNYG***YXXXXXXXGFRKIQKYSPLDTGKAWERQLTRRNGIRFDPLVALNLTEETVAQENIYQKFVTDVQQTDINLDADLYPNEGYILINKFLHLRQLVM 7476
            I   Q  +  +  RV  +T LSNT K V+          +T S TYQ FI  +D  +E+++D        E    D          IS + L +M  ++AKLKA  +   +P  KLT ++   M N+              +++    +   E++  ++DA  +  NI ++  +S+  F+ ED    ++   ++QL   IFP +DP Y           SIK    R+K + H+++N  +  FY + V+++     L       D ++L LS+L +  FFV+NI  LQ V L L+TTIF K  Y+K RN I+ DI+ S+ RLPSSKKN+R Y+L N+  +IQM+TAL L L+Q    +   +  N   S +       D+  K+  +   + ++   Y+ A +   +FL  FL+K   +  E D+R +FENF+ DLL TVNKPEWPA+E +L+LLG++L     +K  +Q+ RL+ +DYLG VA+ LR+D V S    + I+++I  +                                               +  ++K  D+   +    L     +   L+  LLD+L  NA + +    YAR FY  QWY D + + +  N+    ++                 + + + +     +   K   +R H +    +++   +    +  K   INK++  S    +N+  +  +K  +DY +A L+ +YLA+ +  SQSFD  L KI  ++++PS+A+RT+AM+CL+ +VE DP +L+R D++  V+ +FLD++ SVREAAV+LVGK++L+  +LIDQYY M++ RILD G SVRKRVI+I RDIC+E+ +FSKIPEICVKMI+R++DEE I+KLV EVF  MWF+P  + + + + +K+ +I DVV++  D G  W + LL S+ K                K++S+    +  AC+Q+ D LV  ++ LE+    DN R++ C+ TLHL  K+RP+L+V++ +T++PYLNI+  +      +  VA ILE  VPL+ + +++ +  LE  ++ L+  + +  + SCV+CL A VNKI+HN+ L++DCF  ++  L   R +  Q              R LFT+G+L +YFDF   + LG+        I   +F  LMF+      + +IR QA+  +G  C+     L    L + Y  IL +S+ N    D    I C + NI+++L E +  + + +  W+   K E LKEM D+SSG  S I QLYL  ILE  L     VRL AV ++ I++RQGL++P+  V YLI   TD    +  +AD  L +IDK +SGF+NMK   G++   KLQ++L++ N    +L            I+RG      D    ALN  LYT+LR++K  RR+ +  +   F + K+ +  ++Y+++NLA FPY  Q+EPLYL+H ID+++S  G H     ++ + P        SD   +      D          EVL+ RL   P+ L  + + I +++ C+LL+ LK +L+E+Y++TD+                     KI +YSP +  K +E+ +TR++   F+P   +++ ++ ++QE +          TDIN    L   E   L+ K+L  +QL++
Sbjct:  438 IPPEQIFSKPKMRRVERITPLSNT-KCVK--------EEVTRSQTYQQFIRNMDHIIEILDD-------SESPNFDSEDVDETIECISSKLLNSMSTDVAKLKAKQALDSIPKNKLTLLINYAMRNVYLARNY---FAGTEDEDEFVDDEVIEKLLNAMDACLLICNIYST--VSDLQFLQEDNVSHIIKFTQFQLRETIFPLHDPVY--------TAKSIKRTTHRKKIKSHQAQNRSMQLFYLKTVELLKVFVTLFDKCVFVDTIVLPLSTLAIEPFFVDNIETLQFVCLELVTTIFRKERYDKIRNSILGDILTSIDRLPSSKKNLRPYKLTNNGGNIQMVTALVLQLIQCATILPDSLCDNGKFSNKPQEGNTFDEEGKKLLQPSQDLLVLQKYDVAVSIGGNFLTTFLNKCKSRSNETDFRPLFENFIHDLLATVNKPEWPASELLLSLLGTMLVRYVSDKGIEQSIRLVSLDYLGIVAARLRKDTVESRCRVNIIDSMIQSI-----------------------------------------------KLEQEKEGDVTSNNDQFDLEPEEQRTDFLQKILLDFLAVNAQEENLIWDYARHFYLAQWYRDVIYQRRRINDGKKGLAFRKSKIRNNRRTNGDYLDTSDSGSCDESDTDTNK---KRIHCVDSNDFELNINIYKALEARKQYFINKIKPFSVFGEQNHSSNQHIKTYIDYNNAQLIAQYLATKRPFSQSFDGCLKKIILVVNEPSIAVRTRAMKCLANIVEVDPLVLKRKDMQMGVNQKFLDTAISVREAAVDLVGKFVLSNQDLIDQYYDMLSTRILDTGVSVRKRVIKILRDICLEYPDFSKIPEICVKMIRRVHDEEGIQKLVTEVFMKMWFTPCTKNDKIGIQRKINHIIDVVNTAHDTGTTWLEGLLMSIFKPRDNMLRSEGCVQEFIKKNSEPPMDIVIACQQLADGLVDRLIELEDT---DNSRMLGCITTLHLLAKVRPQLLVKHAITIEPYLNIKCHSATAAKFICAVADILEKVVPLVNNASESFLASLEEHLMLLVVSRNQAEVTSCVSCLGALVNKITHNFKLIRDCFQKFYRVLDVSRSQVIQGNNSVDNIYTPSFRRSLFTIGILMRYFDFKSPIALGETNDGLPVSICEDVFHCLMFFCR--CTNQEIRKQALISLGSFCVLNDGYLTRSELKNLYCEIL-SSIAN----DAGFKIIC-MRNIWIYLTESEMFMHNKEKEWEKQSKHEDLKEMNDVSSGMASRIIQLYLEEILECFLNRDDTVRLWAVKVIQIVLRQGLVHPVRMVPYLICLSTDHRIESAHRADALLKDIDKTYSGFVNMKVQFGLQLCFKLQKILQINN--RGKLE-----------IIRGYASRGPDNTTTALNDFLYTLLRTTKPQRRALVQTVTKQFDDQKTSLQQMLYIADNLAYFPYVVQDEPLYLIHQIDLLISMAGTHLLATFKEHIKP--------SDKEGDVLEDDDDVEDP------EVLFNRL---PEDLTEIIKCITSAQACMLLLILKDHLKEMYAITDS---------------------KISRYSPSEQ-KLYEKAVTRKSVNDFNPKTTIDVIKKQMSQEKL---------STDINF--TLTKEEKLDLVVKYLDFKQLML 1953          
BLAST of Nipped-B protein vs. Ensembl Fly
Match: Nipped-B (gene:FBgn0026401 transcript:FBtr0301456)

HSP 1 Score: 761.525 bits (1965), Expect = 0.000e+0
Identity = 544/1669 (32.59%), Postives = 874/1669 (52.37%), Query Frame = 1
Query: 2596 IKKSQEINHKRRERVNGLTKLSNTTKKVQLPLDMLDPSLITESTTYQHFISLVDGCLEVVEDLDLIKTMKEQTEXXXXXXXXXXXXXXREQLQAMCIEIAKLKATGSTKEVPMEKLTKILTLLMLNISSGAKVCLPVTEDGEDNRLFKELAFERIGRSLDASFITINIMTSPDISNGVFI-EDVQEAVVTSVKYQLVNLIFPEYDPAYRTVNHAKDNQSSIKAKRAREK-ELHKSKN--IVYFYNRLVDIISNLSELVVIQTLTDNVILQLSSLGVSVFFVENISELQLVSLRLITTIFSK--YEKHRNLIMDDIIASLSRLPSSKKNMRNYRL-NSEDSIQMLTAXXXXXXXXXXXX-XKIEMNSNESEETALSVAPDKIVKETPKADSEAVIETSYNNAFATAYSFLRIFLHKSTVKG-EDDYRAIFENFVSDLLVTVNKPEWPAAETMLTLLGSLLTNQFINKHSDQTTRLICIDYLGTVASTLRRDAVSSTINPSDIENLIIDLIKGSKSSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXARGTKKKNSDINHKSQYNKLLKNIDKVQILRDALLDYL--NADKFDTTAKYAREFYFGQWYTDCVKELKSQNNQAIAISXXXXXXXXXXXXXXXXXXXXXXXXXXXXISIFQKAEDRRNHLL----YKMFGTLPDESKKSKNNRINKLRIGS--NPENNRYDIRLKGSLDYEDACLVCRYLASLKSSSQSFDIYLTKICRLLHDPSVALRTKAMRCLSAVVEADPTILRRDDIEKAVHLRFLDSSTSVREAAVELVGKYLLTRPELIDQYYPMIAERILDKGTSVRKRVIRIFRDICVEHTEFSKIPEICVKMIKRINDEEAIKKLVNEVFQNMWFSPVREKEGVKLLQKVMNITDVVSSCKDIGYEWFDQLLESLLK----------------KEDSDKLRVVEKACKQIVDCLVQNIMRLEEISRDDNQRLVSCMATLHLFTKIRPELMVQYTMTLQPYLNIRNVNDNDTYILHYVARILEVTVPLIEHPAQNHINQLEVDMVNLIDKQGKMVLESCVACLAASVNKISHNYSLVKDCFDNYFDTLLKYRMEKDQTKTLPQATKRRILSRGLFTVGLLCKYFDFNC-LQLGK-------DINIRIFETLMFYAEDNTLSCDIRTQAISGIGFLCIRYRELLICPRLLSFYHSILMNSLENTKTEDFPNLICCVLDNIYLFLVEEDDRLRHLDSSWKNNEKKESLKEMGDMSSGTGSHIAQLYLNAILENILQPWKPVRLKAVSLVVIIIRQGLINPISSVAYLISAQTDPNPSNRGKADNELAEIDKKFSGFINMKAVQGIRTSCKLQEVLEMYNIPENRLNWCSKHMLTTPVIVRGVYDHNAD-IPLALNHNLYTMLRSSKQFRRSFLYALLAIFGELKSRISLLIYVSENLAQFPYQSQEEPLYLVHNIDIMVSSIGPHFTQQIRDQLYPELVAHEFNSDPSSNHPATKPDTIHIDDEENPEVLYKRLMDNPKALRNMRESIRNSRGCVLLISLKQYLRELYSLTDA*FDFNYG***YXXXXXXXGFRKIQKYSPLDTGKAWERQLTRRNGIRFDPLVALNLTEETVAQENIYQKFVTDVQQTDINLDADLYPNEGYILINKFLHLRQLVM 7476
            I   Q  +  +  RV  +T LSNT K V+          +T S TYQ FI  +D  +E+++D        E    D          IS + L +M  ++AKLKA  +   +P  KLT ++   M N+              +++    +   E++  ++DA  +  NI ++  +S+  F+ ED    ++   ++QL   IFP +DP Y           SIK    R+K + H+++N  +  FY + V+++     L       D ++L LS+L +  FFV+NI  LQ V L L+TTIF K  Y+K RN I+ DI+ S+ RLPSSKKN+R Y+L N+  +IQM+TAL L L+Q    +   +  N   S +       D+  K+  +   + ++   Y+ A +   +FL  FL+K   +  E D+R +FENF+ DLL TVNKPEWPA+E +L+LLG++L     +K  +Q+ RL+ +DYLG VA+ LR+D V S    + I+++I  +                                               +  ++K  D+   +    L     +   L+  LLD+L  NA + +    YAR FY  QWY D + + +  N+    ++                 + + + +     +   K   +R H +    +++   +    +  K   INK++  S    +N+  +  +K  +DY +A L+ +YLA+ +  SQSFD  L KI  ++++PS+A+RT+AM+CL+ +VE DP +L+R D++  V+ +FLD++ SVREAAV+LVGK++L+  +LIDQYY M++ RILD G SVRKRVI+I RDIC+E+ +FSKIPEICVKMI+R++DEE I+KLV EVF  MWF+P  + + + + +K+ +I DVV++  D G  W + LL S+ K                K++S+    +  AC+Q+ D LV  ++ LE+    DN R++ C+ TLHL  K+RP+L+V++ +T++PYLNI+  +      +  VA ILE  VPL+ + +++ +  LE  ++ L+  + +  + SCV+CL A VNKI+HN+ L++DCF  ++  L   R +  Q              R LFT+G+L +YFDF   + LG+        I   +F  LMF+      + +IR QA+  +G  C+     L    L + Y  IL +S+ N    D    I C + NI+++L E +  + + +  W+   K E LKEM D+SSG  S I QLYL  ILE  L     VRL AV ++ I++RQGL++P+  V YLI   TD    +  +AD  L +IDK +SGF+NMK   G++   KLQ++L++ N    +L            I+RG      D    ALN  LYT+LR++K  RR+ +  +   F + K+ +  ++Y+++NLA FPY  Q+EPLYL+H ID+++S  G H     ++ + P        SD   +      D          EVL+ RL   P+ L  + + I +++ C+LL+ LK +L+E+Y++TD+                     KI +YSP +  K +E+ +TR++   F+P   +++ ++ ++QE +          TDIN    L   E   L+ K+L  +QL++
Sbjct:  438 IPPEQIFSKPKMRRVERITPLSNT-KCVK--------EEVTRSQTYQQFIRNMDHIIEILDD-------SESPNFDSEDVDETIECISSKLLNSMSTDVAKLKAKQALDSIPKNKLTLLINYAMRNVYLARNY---FAGTEDEDEFVDDEVIEKLLNAMDACLLICNIYST--VSDLQFLQEDNVSHIIKFTQFQLRETIFPLHDPVY--------TAKSIKRTTHRKKIKSHQAQNRSMQLFYLKTVELLKVFVTLFDKCVFVDTIVLPLSTLAIEPFFVDNIETLQFVCLELVTTIFRKERYDKIRNSILGDILTSIDRLPSSKKNLRPYKLTNNGGNIQMVTALVLQLIQCATILPDSLCDNGKFSNKPQEGNTFDEEGKKLLQPSQDLLVLQKYDVAVSIGGNFLTTFLNKCKSRSNETDFRPLFENFIHDLLATVNKPEWPASELLLSLLGTMLVRYVSDKGIEQSIRLVSLDYLGIVAARLRKDTVESRCRVNIIDSMIQSI-----------------------------------------------KLEQEKEGDVTSNNDQFDLEPEEQRTDFLQKILLDFLAVNAQEENLIWDYARHFYLAQWYRDVIYQRRRINDGKKGLAFRKSKIRNNRRTNGDYLDTSDSGSCDESDTDTNK---KRIHCVDSNDFELNINIYKALEARKQYFINKIKPFSVFGEQNHSSNQHIKTYIDYNNAQLIAQYLATKRPFSQSFDGCLKKIILVVNEPSIAVRTRAMKCLANIVEVDPLVLKRKDMQMGVNQKFLDTAISVREAAVDLVGKFVLSNQDLIDQYYDMLSTRILDTGVSVRKRVIKILRDICLEYPDFSKIPEICVKMIRRVHDEEGIQKLVTEVFMKMWFTPCTKNDKIGIQRKINHIIDVVNTAHDTGTTWLEGLLMSIFKPRDNMLRSEGCVQEFIKKNSEPPMDIVIACQQLADGLVDRLIELEDT---DNSRMLGCITTLHLLAKVRPQLLVKHAITIEPYLNIKCHSATAAKFICAVADILEKVVPLVNNASESFLASLEEHLMLLVVSRNQAEVTSCVSCLGALVNKITHNFKLIRDCFQKFYRVLDVSRSQVIQGNNSVDNIYTPSFRRSLFTIGILMRYFDFKSPIALGETNDGLPVSICEDVFHCLMFFCR--CTNQEIRKQALISLGSFCVLNDGYLTRSELKNLYCEIL-SSIAN----DAGFKIIC-MRNIWIYLTESEMFMHNKEKEWEKQSKHEDLKEMNDVSSGMASRIIQLYLEEILECFLNRDDTVRLWAVKVIQIVLRQGLVHPVRMVPYLICLSTDHRIESAHRADALLKDIDKTYSGFVNMKVQFGLQLCFKLQKILQINN--RGKLE-----------IIRGYASRGPDNTTTALNDFLYTLLRTTKPQRRALVQTVTKQFDDQKTSLQQMLYIADNLAYFPYVVQDEPLYLIHQIDLLISMAGTHLLATFKEHIKP--------SDKEGDVLEDDDDVEDP------EVLFNRL---PEDLTEIIKCITSAQACMLLLILKDHLKEMYAITDS---------------------KISRYSPSEQ-KLYEKAVTRKSVNDFNPKTTIDVIKKQMSQEKL---------STDINF--TLTKEEKLDLVVKYLDFKQLML 1953          
BLAST of Nipped-B protein vs. Ensembl Fly
Match: Nipped-B (gene:FBgn0026401 transcript:FBtr0301454)

HSP 1 Score: 761.525 bits (1965), Expect = 0.000e+0
Identity = 544/1669 (32.59%), Postives = 874/1669 (52.37%), Query Frame = 1
Query: 2596 IKKSQEINHKRRERVNGLTKLSNTTKKVQLPLDMLDPSLITESTTYQHFISLVDGCLEVVEDLDLIKTMKEQTEXXXXXXXXXXXXXXREQLQAMCIEIAKLKATGSTKEVPMEKLTKILTLLMLNISSGAKVCLPVTEDGEDNRLFKELAFERIGRSLDASFITINIMTSPDISNGVFI-EDVQEAVVTSVKYQLVNLIFPEYDPAYRTVNHAKDNQSSIKAKRAREK-ELHKSKN--IVYFYNRLVDIISNLSELVVIQTLTDNVILQLSSLGVSVFFVENISELQLVSLRLITTIFSK--YEKHRNLIMDDIIASLSRLPSSKKNMRNYRL-NSEDSIQMLTAXXXXXXXXXXXX-XKIEMNSNESEETALSVAPDKIVKETPKADSEAVIETSYNNAFATAYSFLRIFLHKSTVKG-EDDYRAIFENFVSDLLVTVNKPEWPAAETMLTLLGSLLTNQFINKHSDQTTRLICIDYLGTVASTLRRDAVSSTINPSDIENLIIDLIKGSKSSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXARGTKKKNSDINHKSQYNKLLKNIDKVQILRDALLDYL--NADKFDTTAKYAREFYFGQWYTDCVKELKSQNNQAIAISXXXXXXXXXXXXXXXXXXXXXXXXXXXXISIFQKAEDRRNHLL----YKMFGTLPDESKKSKNNRINKLRIGS--NPENNRYDIRLKGSLDYEDACLVCRYLASLKSSSQSFDIYLTKICRLLHDPSVALRTKAMRCLSAVVEADPTILRRDDIEKAVHLRFLDSSTSVREAAVELVGKYLLTRPELIDQYYPMIAERILDKGTSVRKRVIRIFRDICVEHTEFSKIPEICVKMIKRINDEEAIKKLVNEVFQNMWFSPVREKEGVKLLQKVMNITDVVSSCKDIGYEWFDQLLESLLK----------------KEDSDKLRVVEKACKQIVDCLVQNIMRLEEISRDDNQRLVSCMATLHLFTKIRPELMVQYTMTLQPYLNIRNVNDNDTYILHYVARILEVTVPLIEHPAQNHINQLEVDMVNLIDKQGKMVLESCVACLAASVNKISHNYSLVKDCFDNYFDTLLKYRMEKDQTKTLPQATKRRILSRGLFTVGLLCKYFDFNC-LQLGK-------DINIRIFETLMFYAEDNTLSCDIRTQAISGIGFLCIRYRELLICPRLLSFYHSILMNSLENTKTEDFPNLICCVLDNIYLFLVEEDDRLRHLDSSWKNNEKKESLKEMGDMSSGTGSHIAQLYLNAILENILQPWKPVRLKAVSLVVIIIRQGLINPISSVAYLISAQTDPNPSNRGKADNELAEIDKKFSGFINMKAVQGIRTSCKLQEVLEMYNIPENRLNWCSKHMLTTPVIVRGVYDHNAD-IPLALNHNLYTMLRSSKQFRRSFLYALLAIFGELKSRISLLIYVSENLAQFPYQSQEEPLYLVHNIDIMVSSIGPHFTQQIRDQLYPELVAHEFNSDPSSNHPATKPDTIHIDDEENPEVLYKRLMDNPKALRNMRESIRNSRGCVLLISLKQYLRELYSLTDA*FDFNYG***YXXXXXXXGFRKIQKYSPLDTGKAWERQLTRRNGIRFDPLVALNLTEETVAQENIYQKFVTDVQQTDINLDADLYPNEGYILINKFLHLRQLVM 7476
            I   Q  +  +  RV  +T LSNT K V+          +T S TYQ FI  +D  +E+++D        E    D          IS + L +M  ++AKLKA  +   +P  KLT ++   M N+              +++    +   E++  ++DA  +  NI ++  +S+  F+ ED    ++   ++QL   IFP +DP Y           SIK    R+K + H+++N  +  FY + V+++     L       D ++L LS+L +  FFV+NI  LQ V L L+TTIF K  Y+K RN I+ DI+ S+ RLPSSKKN+R Y+L N+  +IQM+TAL L L+Q    +   +  N   S +       D+  K+  +   + ++   Y+ A +   +FL  FL+K   +  E D+R +FENF+ DLL TVNKPEWPA+E +L+LLG++L     +K  +Q+ RL+ +DYLG VA+ LR+D V S    + I+++I  +                                               +  ++K  D+   +    L     +   L+  LLD+L  NA + +    YAR FY  QWY D + + +  N+    ++                 + + + +     +   K   +R H +    +++   +    +  K   INK++  S    +N+  +  +K  +DY +A L+ +YLA+ +  SQSFD  L KI  ++++PS+A+RT+AM+CL+ +VE DP +L+R D++  V+ +FLD++ SVREAAV+LVGK++L+  +LIDQYY M++ RILD G SVRKRVI+I RDIC+E+ +FSKIPEICVKMI+R++DEE I+KLV EVF  MWF+P  + + + + +K+ +I DVV++  D G  W + LL S+ K                K++S+    +  AC+Q+ D LV  ++ LE+    DN R++ C+ TLHL  K+RP+L+V++ +T++PYLNI+  +      +  VA ILE  VPL+ + +++ +  LE  ++ L+  + +  + SCV+CL A VNKI+HN+ L++DCF  ++  L   R +  Q              R LFT+G+L +YFDF   + LG+        I   +F  LMF+      + +IR QA+  +G  C+     L    L + Y  IL +S+ N    D    I C + NI+++L E +  + + +  W+   K E LKEM D+SSG  S I QLYL  ILE  L     VRL AV ++ I++RQGL++P+  V YLI   TD    +  +AD  L +IDK +SGF+NMK   G++   KLQ++L++ N    +L            I+RG      D    ALN  LYT+LR++K  RR+ +  +   F + K+ +  ++Y+++NLA FPY  Q+EPLYL+H ID+++S  G H     ++ + P        SD   +      D          EVL+ RL   P+ L  + + I +++ C+LL+ LK +L+E+Y++TD+                     KI +YSP +  K +E+ +TR++   F+P   +++ ++ ++QE +          TDIN    L   E   L+ K+L  +QL++
Sbjct:  438 IPPEQIFSKPKMRRVERITPLSNT-KCVK--------EEVTRSQTYQQFIRNMDHIIEILDD-------SESPNFDSEDVDETIECISSKLLNSMSTDVAKLKAKQALDSIPKNKLTLLINYAMRNVYLARNY---FAGTEDEDEFVDDEVIEKLLNAMDACLLICNIYST--VSDLQFLQEDNVSHIIKFTQFQLRETIFPLHDPVY--------TAKSIKRTTHRKKIKSHQAQNRSMQLFYLKTVELLKVFVTLFDKCVFVDTIVLPLSTLAIEPFFVDNIETLQFVCLELVTTIFRKERYDKIRNSILGDILTSIDRLPSSKKNLRPYKLTNNGGNIQMVTALVLQLIQCATILPDSLCDNGKFSNKPQEGNTFDEEGKKLLQPSQDLLVLQKYDVAVSIGGNFLTTFLNKCKSRSNETDFRPLFENFIHDLLATVNKPEWPASELLLSLLGTMLVRYVSDKGIEQSIRLVSLDYLGIVAARLRKDTVESRCRVNIIDSMIQSI-----------------------------------------------KLEQEKEGDVTSNNDQFDLEPEEQRTDFLQKILLDFLAVNAQEENLIWDYARHFYLAQWYRDVIYQRRRINDGKKGLAFRKSKIRNNRRTNGDYLDTSDSGSCDESDTDTNK---KRIHCVDSNDFELNINIYKALEARKQYFINKIKPFSVFGEQNHSSNQHIKTYIDYNNAQLIAQYLATKRPFSQSFDGCLKKIILVVNEPSIAVRTRAMKCLANIVEVDPLVLKRKDMQMGVNQKFLDTAISVREAAVDLVGKFVLSNQDLIDQYYDMLSTRILDTGVSVRKRVIKILRDICLEYPDFSKIPEICVKMIRRVHDEEGIQKLVTEVFMKMWFTPCTKNDKIGIQRKINHIIDVVNTAHDTGTTWLEGLLMSIFKPRDNMLRSEGCVQEFIKKNSEPPMDIVIACQQLADGLVDRLIELEDT---DNSRMLGCITTLHLLAKVRPQLLVKHAITIEPYLNIKCHSATAAKFICAVADILEKVVPLVNNASESFLASLEEHLMLLVVSRNQAEVTSCVSCLGALVNKITHNFKLIRDCFQKFYRVLDVSRSQVIQGNNSVDNIYTPSFRRSLFTIGILMRYFDFKSPIALGETNDGLPVSICEDVFHCLMFFCR--CTNQEIRKQALISLGSFCVLNDGYLTRSELKNLYCEIL-SSIAN----DAGFKIIC-MRNIWIYLTESEMFMHNKEKEWEKQSKHEDLKEMNDVSSGMASRIIQLYLEEILECFLNRDDTVRLWAVKVIQIVLRQGLVHPVRMVPYLICLSTDHRIESAHRADALLKDIDKTYSGFVNMKVQFGLQLCFKLQKILQINN--RGKLE-----------IIRGYASRGPDNTTTALNDFLYTLLRTTKPQRRALVQTVTKQFDDQKTSLQQMLYIADNLAYFPYVVQDEPLYLIHQIDLLISMAGTHLLATFKEHIKP--------SDKEGDVLEDDDDVEDP------EVLFNRL---PEDLTEIIKCITSAQACMLLLILKDHLKEMYAITDS---------------------KISRYSPSEQ-KLYEKAVTRKSVNDFNPKTTIDVIKKQMSQEKL---------STDINF--TLTKEEKLDLVVKYLDFKQLML 1953          
BLAST of Nipped-B protein vs. Ensembl Fly
Match: Nipped-B (gene:FBgn0026401 transcript:FBtr0334994)

HSP 1 Score: 761.525 bits (1965), Expect = 0.000e+0
Identity = 544/1669 (32.59%), Postives = 874/1669 (52.37%), Query Frame = 1
Query: 2596 IKKSQEINHKRRERVNGLTKLSNTTKKVQLPLDMLDPSLITESTTYQHFISLVDGCLEVVEDLDLIKTMKEQTEXXXXXXXXXXXXXXREQLQAMCIEIAKLKATGSTKEVPMEKLTKILTLLMLNISSGAKVCLPVTEDGEDNRLFKELAFERIGRSLDASFITINIMTSPDISNGVFI-EDVQEAVVTSVKYQLVNLIFPEYDPAYRTVNHAKDNQSSIKAKRAREK-ELHKSKN--IVYFYNRLVDIISNLSELVVIQTLTDNVILQLSSLGVSVFFVENISELQLVSLRLITTIFSK--YEKHRNLIMDDIIASLSRLPSSKKNMRNYRL-NSEDSIQMLTAXXXXXXXXXXXX-XKIEMNSNESEETALSVAPDKIVKETPKADSEAVIETSYNNAFATAYSFLRIFLHKSTVKG-EDDYRAIFENFVSDLLVTVNKPEWPAAETMLTLLGSLLTNQFINKHSDQTTRLICIDYLGTVASTLRRDAVSSTINPSDIENLIIDLIKGSKSSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXARGTKKKNSDINHKSQYNKLLKNIDKVQILRDALLDYL--NADKFDTTAKYAREFYFGQWYTDCVKELKSQNNQAIAISXXXXXXXXXXXXXXXXXXXXXXXXXXXXISIFQKAEDRRNHLL----YKMFGTLPDESKKSKNNRINKLRIGS--NPENNRYDIRLKGSLDYEDACLVCRYLASLKSSSQSFDIYLTKICRLLHDPSVALRTKAMRCLSAVVEADPTILRRDDIEKAVHLRFLDSSTSVREAAVELVGKYLLTRPELIDQYYPMIAERILDKGTSVRKRVIRIFRDICVEHTEFSKIPEICVKMIKRINDEEAIKKLVNEVFQNMWFSPVREKEGVKLLQKVMNITDVVSSCKDIGYEWFDQLLESLLK----------------KEDSDKLRVVEKACKQIVDCLVQNIMRLEEISRDDNQRLVSCMATLHLFTKIRPELMVQYTMTLQPYLNIRNVNDNDTYILHYVARILEVTVPLIEHPAQNHINQLEVDMVNLIDKQGKMVLESCVACLAASVNKISHNYSLVKDCFDNYFDTLLKYRMEKDQTKTLPQATKRRILSRGLFTVGLLCKYFDFNC-LQLGK-------DINIRIFETLMFYAEDNTLSCDIRTQAISGIGFLCIRYRELLICPRLLSFYHSILMNSLENTKTEDFPNLICCVLDNIYLFLVEEDDRLRHLDSSWKNNEKKESLKEMGDMSSGTGSHIAQLYLNAILENILQPWKPVRLKAVSLVVIIIRQGLINPISSVAYLISAQTDPNPSNRGKADNELAEIDKKFSGFINMKAVQGIRTSCKLQEVLEMYNIPENRLNWCSKHMLTTPVIVRGVYDHNAD-IPLALNHNLYTMLRSSKQFRRSFLYALLAIFGELKSRISLLIYVSENLAQFPYQSQEEPLYLVHNIDIMVSSIGPHFTQQIRDQLYPELVAHEFNSDPSSNHPATKPDTIHIDDEENPEVLYKRLMDNPKALRNMRESIRNSRGCVLLISLKQYLRELYSLTDA*FDFNYG***YXXXXXXXGFRKIQKYSPLDTGKAWERQLTRRNGIRFDPLVALNLTEETVAQENIYQKFVTDVQQTDINLDADLYPNEGYILINKFLHLRQLVM 7476
            I   Q  +  +  RV  +T LSNT K V+          +T S TYQ FI  +D  +E+++D        E    D          IS + L +M  ++AKLKA  +   +P  KLT ++   M N+              +++    +   E++  ++DA  +  NI ++  +S+  F+ ED    ++   ++QL   IFP +DP Y           SIK    R+K + H+++N  +  FY + V+++     L       D ++L LS+L +  FFV+NI  LQ V L L+TTIF K  Y+K RN I+ DI+ S+ RLPSSKKN+R Y+L N+  +IQM+TAL L L+Q    +   +  N   S +       D+  K+  +   + ++   Y+ A +   +FL  FL+K   +  E D+R +FENF+ DLL TVNKPEWPA+E +L+LLG++L     +K  +Q+ RL+ +DYLG VA+ LR+D V S    + I+++I  +                                               +  ++K  D+   +    L     +   L+  LLD+L  NA + +    YAR FY  QWY D + + +  N+    ++                 + + + +     +   K   +R H +    +++   +    +  K   INK++  S    +N+  +  +K  +DY +A L+ +YLA+ +  SQSFD  L KI  ++++PS+A+RT+AM+CL+ +VE DP +L+R D++  V+ +FLD++ SVREAAV+LVGK++L+  +LIDQYY M++ RILD G SVRKRVI+I RDIC+E+ +FSKIPEICVKMI+R++DEE I+KLV EVF  MWF+P  + + + + +K+ +I DVV++  D G  W + LL S+ K                K++S+    +  AC+Q+ D LV  ++ LE+    DN R++ C+ TLHL  K+RP+L+V++ +T++PYLNI+  +      +  VA ILE  VPL+ + +++ +  LE  ++ L+  + +  + SCV+CL A VNKI+HN+ L++DCF  ++  L   R +  Q              R LFT+G+L +YFDF   + LG+        I   +F  LMF+      + +IR QA+  +G  C+     L    L + Y  IL +S+ N    D    I C + NI+++L E +  + + +  W+   K E LKEM D+SSG  S I QLYL  ILE  L     VRL AV ++ I++RQGL++P+  V YLI   TD    +  +AD  L +IDK +SGF+NMK   G++   KLQ++L++ N    +L            I+RG      D    ALN  LYT+LR++K  RR+ +  +   F + K+ +  ++Y+++NLA FPY  Q+EPLYL+H ID+++S  G H     ++ + P        SD   +      D          EVL+ RL   P+ L  + + I +++ C+LL+ LK +L+E+Y++TD+                     KI +YSP +  K +E+ +TR++   F+P   +++ ++ ++QE +          TDIN    L   E   L+ K+L  +QL++
Sbjct:  342 IPPEQIFSKPKMRRVERITPLSNT-KCVK--------EEVTRSQTYQQFIRNMDHIIEILDD-------SESPNFDSEDVDETIECISSKLLNSMSTDVAKLKAKQALDSIPKNKLTLLINYAMRNVYLARNY---FAGTEDEDEFVDDEVIEKLLNAMDACLLICNIYST--VSDLQFLQEDNVSHIIKFTQFQLRETIFPLHDPVY--------TAKSIKRTTHRKKIKSHQAQNRSMQLFYLKTVELLKVFVTLFDKCVFVDTIVLPLSTLAIEPFFVDNIETLQFVCLELVTTIFRKERYDKIRNSILGDILTSIDRLPSSKKNLRPYKLTNNGGNIQMVTALVLQLIQCATILPDSLCDNGKFSNKPQEGNTFDEEGKKLLQPSQDLLVLQKYDVAVSIGGNFLTTFLNKCKSRSNETDFRPLFENFIHDLLATVNKPEWPASELLLSLLGTMLVRYVSDKGIEQSIRLVSLDYLGIVAARLRKDTVESRCRVNIIDSMIQSI-----------------------------------------------KLEQEKEGDVTSNNDQFDLEPEEQRTDFLQKILLDFLAVNAQEENLIWDYARHFYLAQWYRDVIYQRRRINDGKKGLAFRKSKIRNNRRTNGDYLDTSDSGSCDESDTDTNK---KRIHCVDSNDFELNINIYKALEARKQYFINKIKPFSVFGEQNHSSNQHIKTYIDYNNAQLIAQYLATKRPFSQSFDGCLKKIILVVNEPSIAVRTRAMKCLANIVEVDPLVLKRKDMQMGVNQKFLDTAISVREAAVDLVGKFVLSNQDLIDQYYDMLSTRILDTGVSVRKRVIKILRDICLEYPDFSKIPEICVKMIRRVHDEEGIQKLVTEVFMKMWFTPCTKNDKIGIQRKINHIIDVVNTAHDTGTTWLEGLLMSIFKPRDNMLRSEGCVQEFIKKNSEPPMDIVIACQQLADGLVDRLIELEDT---DNSRMLGCITTLHLLAKVRPQLLVKHAITIEPYLNIKCHSATAAKFICAVADILEKVVPLVNNASESFLASLEEHLMLLVVSRNQAEVTSCVSCLGALVNKITHNFKLIRDCFQKFYRVLDVSRSQVIQGNNSVDNIYTPSFRRSLFTIGILMRYFDFKSPIALGETNDGLPVSICEDVFHCLMFFCR--CTNQEIRKQALISLGSFCVLNDGYLTRSELKNLYCEIL-SSIAN----DAGFKIIC-MRNIWIYLTESEMFMHNKEKEWEKQSKHEDLKEMNDVSSGMASRIIQLYLEEILECFLNRDDTVRLWAVKVIQIVLRQGLVHPVRMVPYLICLSTDHRIESAHRADALLKDIDKTYSGFVNMKVQFGLQLCFKLQKILQINN--RGKLE-----------IIRGYASRGPDNTTTALNDFLYTLLRTTKPQRRALVQTVTKQFDDQKTSLQQMLYIADNLAYFPYVVQDEPLYLIHQIDLLISMAGTHLLATFKEHIKP--------SDKEGDVLEDDDDVEDP------EVLFNRL---PEDLTEIIKCITSAQACMLLLILKDHLKEMYAITDS---------------------KISRYSPSEQ-KLYEKAVTRKSVNDFNPKTTIDVIKKQMSQEKL---------STDINF--TLTKEEKLDLVVKYLDFKQLML 1857          
BLAST of Nipped-B protein vs. Ensembl Fly
Match: Nipped-B (gene:FBgn0026401 transcript:FBtr0111119)

HSP 1 Score: 761.14 bits (1964), Expect = 0.000e+0
Identity = 544/1669 (32.59%), Postives = 874/1669 (52.37%), Query Frame = 1
Query: 2596 IKKSQEINHKRRERVNGLTKLSNTTKKVQLPLDMLDPSLITESTTYQHFISLVDGCLEVVEDLDLIKTMKEQTEXXXXXXXXXXXXXXREQLQAMCIEIAKLKATGSTKEVPMEKLTKILTLLMLNISSGAKVCLPVTEDGEDNRLFKELAFERIGRSLDASFITINIMTSPDISNGVFI-EDVQEAVVTSVKYQLVNLIFPEYDPAYRTVNHAKDNQSSIKAKRAREK-ELHKSKN--IVYFYNRLVDIISNLSELVVIQTLTDNVILQLSSLGVSVFFVENISELQLVSLRLITTIFSK--YEKHRNLIMDDIIASLSRLPSSKKNMRNYRL-NSEDSIQMLTAXXXXXXXXXXXX-XKIEMNSNESEETALSVAPDKIVKETPKADSEAVIETSYNNAFATAYSFLRIFLHKSTVKG-EDDYRAIFENFVSDLLVTVNKPEWPAAETMLTLLGSLLTNQFINKHSDQTTRLICIDYLGTVASTLRRDAVSSTINPSDIENLIIDLIKGSKSSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXARGTKKKNSDINHKSQYNKLLKNIDKVQILRDALLDYL--NADKFDTTAKYAREFYFGQWYTDCVKELKSQNNQAIAISXXXXXXXXXXXXXXXXXXXXXXXXXXXXISIFQKAEDRRNHLL----YKMFGTLPDESKKSKNNRINKLRIGS--NPENNRYDIRLKGSLDYEDACLVCRYLASLKSSSQSFDIYLTKICRLLHDPSVALRTKAMRCLSAVVEADPTILRRDDIEKAVHLRFLDSSTSVREAAVELVGKYLLTRPELIDQYYPMIAERILDKGTSVRKRVIRIFRDICVEHTEFSKIPEICVKMIKRINDEEAIKKLVNEVFQNMWFSPVREKEGVKLLQKVMNITDVVSSCKDIGYEWFDQLLESLLK----------------KEDSDKLRVVEKACKQIVDCLVQNIMRLEEISRDDNQRLVSCMATLHLFTKIRPELMVQYTMTLQPYLNIRNVNDNDTYILHYVARILEVTVPLIEHPAQNHINQLEVDMVNLIDKQGKMVLESCVACLAASVNKISHNYSLVKDCFDNYFDTLLKYRMEKDQTKTLPQATKRRILSRGLFTVGLLCKYFDFNC-LQLGK-------DINIRIFETLMFYAEDNTLSCDIRTQAISGIGFLCIRYRELLICPRLLSFYHSILMNSLENTKTEDFPNLICCVLDNIYLFLVEEDDRLRHLDSSWKNNEKKESLKEMGDMSSGTGSHIAQLYLNAILENILQPWKPVRLKAVSLVVIIIRQGLINPISSVAYLISAQTDPNPSNRGKADNELAEIDKKFSGFINMKAVQGIRTSCKLQEVLEMYNIPENRLNWCSKHMLTTPVIVRGVYDHNAD-IPLALNHNLYTMLRSSKQFRRSFLYALLAIFGELKSRISLLIYVSENLAQFPYQSQEEPLYLVHNIDIMVSSIGPHFTQQIRDQLYPELVAHEFNSDPSSNHPATKPDTIHIDDEENPEVLYKRLMDNPKALRNMRESIRNSRGCVLLISLKQYLRELYSLTDA*FDFNYG***YXXXXXXXGFRKIQKYSPLDTGKAWERQLTRRNGIRFDPLVALNLTEETVAQENIYQKFVTDVQQTDINLDADLYPNEGYILINKFLHLRQLVM 7476
            I   Q  +  +  RV  +T LSNT K V+          +T S TYQ FI  +D  +E+++D        E    D          IS + L +M  ++AKLKA  +   +P  KLT ++   M N+              +++    +   E++  ++DA  +  NI ++  +S+  F+ ED    ++   ++QL   IFP +DP Y           SIK    R+K + H+++N  +  FY + V+++     L       D ++L LS+L +  FFV+NI  LQ V L L+TTIF K  Y+K RN I+ DI+ S+ RLPSSKKN+R Y+L N+  +IQM+TAL L L+Q    +   +  N   S +       D+  K+  +   + ++   Y+ A +   +FL  FL+K   +  E D+R +FENF+ DLL TVNKPEWPA+E +L+LLG++L     +K  +Q+ RL+ +DYLG VA+ LR+D V S    + I+++I  +                                               +  ++K  D+   +    L     +   L+  LLD+L  NA + +    YAR FY  QWY D + + +  N+    ++                 + + + +     +   K   +R H +    +++   +    +  K   INK++  S    +N+  +  +K  +DY +A L+ +YLA+ +  SQSFD  L KI  ++++PS+A+RT+AM+CL+ +VE DP +L+R D++  V+ +FLD++ SVREAAV+LVGK++L+  +LIDQYY M++ RILD G SVRKRVI+I RDIC+E+ +FSKIPEICVKMI+R++DEE I+KLV EVF  MWF+P  + + + + +K+ +I DVV++  D G  W + LL S+ K                K++S+    +  AC+Q+ D LV  ++ LE+    DN R++ C+ TLHL  K+RP+L+V++ +T++PYLNI+  +      +  VA ILE  VPL+ + +++ +  LE  ++ L+  + +  + SCV+CL A VNKI+HN+ L++DCF  ++  L   R +  Q              R LFT+G+L +YFDF   + LG+        I   +F  LMF+      + +IR QA+  +G  C+     L    L + Y  IL +S+ N    D    I C + NI+++L E +  + + +  W+   K E LKEM D+SSG  S I QLYL  ILE  L     VRL AV ++ I++RQGL++P+  V YLI   TD    +  +AD  L +IDK +SGF+NMK   G++   KLQ++L++ N    +L            I+RG      D    ALN  LYT+LR++K  RR+ +  +   F + K+ +  ++Y+++NLA FPY  Q+EPLYL+H ID+++S  G H     ++ + P        SD   +      D          EVL+ RL   P+ L  + + I +++ C+LL+ LK +L+E+Y++TD+                     KI +YSP +  K +E+ +TR++   F+P   +++ ++ ++QE +          TDIN    L   E   L+ K+L  +QL++
Sbjct:  462 IPPEQIFSKPKMRRVERITPLSNT-KCVK--------EEVTRSQTYQQFIRNMDHIIEILDD-------SESPNFDSEDVDETIECISSKLLNSMSTDVAKLKAKQALDSIPKNKLTLLINYAMRNVYLARNY---FAGTEDEDEFVDDEVIEKLLNAMDACLLICNIYST--VSDLQFLQEDNVSHIIKFTQFQLRETIFPLHDPVY--------TAKSIKRTTHRKKIKSHQAQNRSMQLFYLKTVELLKVFVTLFDKCVFVDTIVLPLSTLAIEPFFVDNIETLQFVCLELVTTIFRKERYDKIRNSILGDILTSIDRLPSSKKNLRPYKLTNNGGNIQMVTALVLQLIQCATILPDSLCDNGKFSNKPQEGNTFDEEGKKLLQPSQDLLVLQKYDVAVSIGGNFLTTFLNKCKSRSNETDFRPLFENFIHDLLATVNKPEWPASELLLSLLGTMLVRYVSDKGIEQSIRLVSLDYLGIVAARLRKDTVESRCRVNIIDSMIQSI-----------------------------------------------KLEQEKEGDVTSNNDQFDLEPEEQRTDFLQKILLDFLAVNAQEENLIWDYARHFYLAQWYRDVIYQRRRINDGKKGLAFRKSKIRNNRRTNGDYLDTSDSGSCDESDTDTNK---KRIHCVDSNDFELNINIYKALEARKQYFINKIKPFSVFGEQNHSSNQHIKTYIDYNNAQLIAQYLATKRPFSQSFDGCLKKIILVVNEPSIAVRTRAMKCLANIVEVDPLVLKRKDMQMGVNQKFLDTAISVREAAVDLVGKFVLSNQDLIDQYYDMLSTRILDTGVSVRKRVIKILRDICLEYPDFSKIPEICVKMIRRVHDEEGIQKLVTEVFMKMWFTPCTKNDKIGIQRKINHIIDVVNTAHDTGTTWLEGLLMSIFKPRDNMLRSEGCVQEFIKKNSEPPMDIVIACQQLADGLVDRLIELEDT---DNSRMLGCITTLHLLAKVRPQLLVKHAITIEPYLNIKCHSATAAKFICAVADILEKVVPLVNNASESFLASLEEHLMLLVVSRNQAEVTSCVSCLGALVNKITHNFKLIRDCFQKFYRVLDVSRSQVIQGNNSVDNIYTPSFRRSLFTIGILMRYFDFKSPIALGETNDGLPVSICEDVFHCLMFFCR--CTNQEIRKQALISLGSFCVLNDGYLTRSELKNLYCEIL-SSIAN----DAGFKIIC-MRNIWIYLTESEMFMHNKEKEWEKQSKHEDLKEMNDVSSGMASRIIQLYLEEILECFLNRDDTVRLWAVKVIQIVLRQGLVHPVRMVPYLICLSTDHRIESAHRADALLKDIDKTYSGFVNMKVQFGLQLCFKLQKILQINN--RGKLE-----------IIRGYASRGPDNTTTALNDFLYTLLRTTKPQRRALVQTVTKQFDDQKTSLQQMLYIADNLAYFPYVVQDEPLYLIHQIDLLISMAGTHLLATFKEHIKP--------SDKEGDVLEDDDDVEDP------EVLFNRL---PEDLTEIIKCITSAQACMLLLILKDHLKEMYAITDS---------------------KISRYSPSEQ-KLYEKAVTRKSVNDFNPKTTIDVIKKQMSQEKL---------STDINF--TLTKEEKLDLVVKYLDFKQLML 1977          
BLAST of Nipped-B protein vs. Ensembl Zebrafish
Match: nipbla (NIPBL cohesin loading factor a [Source:NCBI gene;Acc:570900])

HSP 1 Score: 672.544 bits (1734), Expect = 0.000e+0
Identity = 362/892 (40.58%), Postives = 558/892 (62.56%), Query Frame = 1
Query: 4303 DKVQILRDALLDYLNAD-KFDTTAKYAREFYFGQWYTDCVKE----LKSQNNQAIAISXXXXXXXXXXXXXXXXXXXXXXXXXXXXISIFQKAEDRRNHLLYKMFGTLPDESKKSKNNRINKLRIGSNPENNRYDIRLKGSLDYEDACLVCRYLASLKSSSQSFDIYLTKICRLLHDPSVALRTKAMRCLSAVVEADPTILRRDDIEKAVHLRFLDSSTSVREAAVELVGKYLLTRPELIDQYYPMIAERILDKGTSVRKRVIRIFRDICVEHTEFSKIPEICVKMIKRINDEEAIKKLVNEVFQNMWFSPVREKEGVKLLQKVMNITDVVSSCKDIGYEWFDQLLESLLKKEDSDKLRVVEKACKQIVDCLVQNIMRLEEISRD----DNQRLVSCMATLHLFTKIRPELMVQYTMTLQPYLNIRNVNDNDTYILHYVARILEVTVPLIEHPAQNHINQLEVDMVNLIDKQGKMVLESCVACLAASVNKISHNYSLVKDCFDNYFDTLLKYRME-KDQTKTLPQATKRRILSRGLFTVGLLCKYFDFNCLQLGKDINI----RIFETLMFYA--EDNTLSCDIRTQAISGIGFLCIRYRELLICPRLLSFYHSILMNSLENTKTEDFPNLICCVLDNIYLFLVEEDDRLRHLDSSWKNNEKKESLKEMGDMSSGTGSHIAQLYLNAILENILQPWKPVRLKAVSLVVIIIRQGLINPISSVAYLISAQTDPNPSNRGKADNELAEIDKKFSGFINMKAVQGIRTSCKLQEVLEMYNIPENRLNWCSKHMLTTPVIVRGVYDHNADIPLALNHNLYTMLRSSKQFRRSFLYALLAIFGE-LKSRISLLIYVSENLAQFPYQSQEEPLYLVHNIDIMVSSIGPHFTQQIRDQL 6927
            D+ Q L+ ALLDY++ + + D    +AR+FY  QW+ DC  E    ++SQN +                 +  ++             I Q+AE R+   L+ +  + P        N+   LR+ S+            ++DY+DACL+ RYLAS +  SQSFDIYLT+I R+L + ++A+RTKAM+CLS VV  DP+IL R D+++ VH R +D+STSVREAAVEL+G+++L+RP+L +QYY M+ ERILD G SVRKRVI+I RDIC+E   FSKI E+CVKMI+R+NDEE IKKLVNE FQ +WF+P    +   + +K++NITDVVS+CKD GY+WF+QLL++LLK E+    +   KAC Q+VD LV++I++ EE   +    ++ RLV+C+ TL+LF+KIR +LMV++ MT+QPYL  +  + +D  ++  VA+ILE+ VPL++HP+++ +  +E D++ LI K G  V++ CV+CL A VNK++HNY  V  CF+ Y+  L K +++ ++ T ++  A  +  L R LFT G LC++FDF+  Q      +    ++ E L+++   ED  + C    +AI G+GFL I +   +  P + + Y+ +L +   +        L   VL N+ ++L EED R++  D  W+   K+E LKEMGD+SSG  S I QLYL  +LE+       VR  A++++ + + QGLI+P+  V YLI+  TD  P+ R KAD +L EIDKK++GFI+MKAV G++ S ++Q+ +                  +   ++RG     ++   A   +LY+M+R+++Q RR+FL +LL +F +  K  +++L+++++NLA FPYQSQEEPL+++H+IDI +S  G +  Q  ++ L
Sbjct: 1177 DETQRLQKALLDYMDENAETDPALAFARKFYIAQWFRDCTTETEKAMRSQNQK-----------------EDDSDGAQHAKELQATGDIMQRAETRKK-FLHSVVKSTP--------NQFTTLRMNSD------------TVDYDDACLIVRYLASTRPFSQSFDIYLTQILRVLGESAIAVRTKAMKCLSEVVAVDPSILARSDMQRGVHGRLMDNSTSVREAAVELLGRFVLSRPQLTEQYYDMLIERILDTGISVRKRVIKILRDICLEQPNFSKITEMCVKMIRRVNDEEGIKKLVNETFQKLWFTPTPNHDKETMNRKILNITDVVSACKDTGYDWFEQLLQNLLKSEEDSSYKPTRKACVQLVDNLVEHILKYEEALAEHKSVNSTRLVACITTLYLFSKIRAQLMVKHAMTMQPYLTTKCSSQSDFMVICNVAKILELVVPLMDHPSESFLTTIEEDLMKLILKYGMTVVQYCVSCLGAIVNKVTHNYKFVWACFNRYYGALTKLKVQHQEGTNSMALAATKAALLRSLFTAGALCRHFDFDLEQFKGTTKVVIKEKVLELLLYFTNHEDEEVKC----KAIIGLGFLFIMHPSQMFVPEVKTLYNGLLSDKRSSI------TLKIQVLKNLQMYLQEEDTRMQEADREWQKLSKQEDLKEMGDISSGMSSSIMQLYLKQVLESFFHAQSSVRHFALNVIALTLSQGLIHPVQCVPYLIAMGTDAEPTMRNKADQQLVEIDKKYTGFIHMKAVAGMKMSYQVQQAV----------------FGSAGSVIRGFRQDESNS--AQCSHLYSMVRANRQHRRAFLISLLNLFDDSSKMEVNMLLFIADNLAYFPYQSQEEPLFIMHHIDITLSVSGSNLLQTFKESL 2002          

HSP 2 Score: 308.145 bits (788), Expect = 2.080e-83
Identity = 218/566 (38.52%), Postives = 334/566 (59.01%), Query Frame = 1
Query: 2488 ENSDDISQSRAKKRKKDDDEPFEVKLKDPNEIKYPHIKKSQEINHKRRER---------------VNGLTKLSNTTKKVQLPLDMLDPSLITESTTYQHFISLVDGCLEVVEDLDLIKTMKEQTEXXXXXXXXXXXXXXREQLQAMCIEIAKLKATGSTKEVPMEKLTKILTLLMLNISSGAKVC--LPVTEDGED-NRLFKELAFERIGRSLDASFITINIMTSPDISNGVFIEDVQEAVVTSVKYQLVNLIFPEYDPAYRTVNHAKDNQSSIKAKRAREKELHKSKNIVYFYNRLVDIISNLSELVVIQTLTDNVILQLSSLGVSVFFVENISELQLVSLRLITTIFSKYEKHRNLIMDDIIASLSRLPSSKKNMRNYRLNSEDS------IQMLTAXXXXXXXXXXXXXKIEMNSNESEETALSVAPDKIVKETPKADSEAVIETSYNNAFATAYSFLRIFLHKSTVK-GEDDYRAIFENFVSDLLVTVNKPEWPAAETMLTLLGSLLTNQFINKHSDQTTRLICIDYLGTVASTLRRDAVSSTINPSDIENLIIDLIKGSKS 4110
            ++S+D   S  K+++KD D  +E + +D       H + + +       R               V    K+    +KV  P   L P  + +S+T++ F   +D  LE +ED+D   T ++  E      +P ++L+ ++QL  +  E AK+KA G T  +P +KL K+L +L  NI  GA +   + +  +GED  RL+++L  ER+ +S DA    +NIMTS  +   V+IEDV E V+   K+ L N ++P+YDP YR VN    +  S +AKRA+     K K I+  YN++ D++SN+SEL+ IQ +TD  ILQ+SS+G++ FFVEN+SELQL +++L+T +FS+YEKHR LI+++I  SL+RLP+SK+++RN+RLNS D       IQM++AL L L+Q V     + + ++   E                 D +  I  SY  A  TA +FL +FL K   K GE+DYR +FENFV DLL TVNKP+WPA+E +L+LLG LL +QF NK ++   R+  +DYLGTVA+ LR+D+V+S ++   IE +I +  +G ++
Sbjct:  643 DSSEDEEFSSRKRQRKDRDRTWEAEERD-RRSSGEHRRGNFDARRGSGSRYDDSDQDSPPPSLNEVARRLKMKQKKRKVYEP--KLTPEEMMDSSTFKRFTLSIDNILENLEDVDF--TAQDDDE------IPQELLLGKQQLNELGSESAKIKAMGITSRIPSDKLVKLLNILEKNILDGASLSTLMNLDNEGEDEERLWRDLIMERVTKSADACLTALNIMTSTHMPKAVYIEDVIERVLQYTKFHLQNTLYPQYDPVYR-VNPKGGSMLSSRAKRAK-CSTAKQKVIIMLYNKVCDVVSNISELLEIQLMTDTTILQVSSMGITPFFVENVSELQLCAIKLVTAVFSRYEKHRQLILEEIFTSLARLPTSKRSLRNFRLNSSDDEGEPIYIQMVSALVLQLIQCV-----VHLPADRDSEDDHKK-----------VDDDVFITNSYETARRTAQNFLSVFLKKCGSKQGEEDYRPLFENFVQDLLSTVNKPDWPASELLLSLLGRLLVHQFSNKQTEMALRVASLDYLGTVAARLRKDSVTSRMDQKAIERIIRENTEGDET 1179          
BLAST of Nipped-B protein vs. Ensembl Zebrafish
Match: nipblb (NIPBL cohesin loading factor b [Source:NCBI gene;Acc:794108])

HSP 1 Score: 669.463 bits (1726), Expect = 0.000e+0
Identity = 364/897 (40.58%), Postives = 566/897 (63.10%), Query Frame = 1
Query: 4303 DKVQILRDALLDYLNAD-KFDTTAKYAREFYFGQWY----TDCVKELKSQNNQAIAISXXXXXXXXXXXXXXXXXXXXXXXXXXXXISIFQKAEDRRNHLLYKMFGTLPDESKKSKNNRINKLRIGSNPENNRYDIRLKGSLDYEDACLVCRYLASLKSSSQSFDIYLTKICRLLHDPSVALRTKAMRCLSAVVEADPTILRRDDIEKAVHLRFLDSSTSVREAAVELVGKYLLTRPELIDQYYPMIAERILDKGTSVRKRVIRIFRDICVEHTEFSKIPEICVKMIKRINDEEAIKKLVNEVFQNMWFSPVREKEGVKLLQKVMNITDVVSSCKDIGYEWFDQLLESLLKKEDSDKLRVVEKACKQIVDCLVQNIMRLEEISRD------DNQRLVSCMATLHLFTKIRPELMVQYTMTLQPYLNIRNVNDNDTYILHYVARILEVTVPLIEHPAQNHINQLEVDMVNLIDKQGKMVLESCVACLAASVNKISHNYSLVKDCFDNYFDTLLKYRM--EKDQTKTLPQATKRRILSRGLFTVGLLCKYFDFNCLQLGKD----INIRIFETLMFYAEDNTLSCDIRTQAISGIGFLCIRYRELLICPRLLSFYHSILMNSLENTKTEDFPNLICCVLDNIYLFLVEEDDRLRHLDSSWKNNEKKESLKEMGDMSSGTGSHIAQLYLNAILENILQPWKPVRLKAVSLVVIIIRQGLINPISSVAYLISAQTDPNPSNRGKADNELAEIDKKFSGFINMKAVQGIRTSCKLQEVLEMYNIPENRLNWCSKHMLTTPVIVRGV-YDHNADIPLALNHNLYTMLRSSKQFRRSFLYALLAIFGE-LKSRISLLIYVSENLAQFPYQSQEEPLYLVHNIDIMVSSIGPHFTQQIRDQLYPE 6936
            D++Q L+ ALL+YL+ + + D    +AR+FY  QWY    T+  K +KSQ +   +   +    ++  +                   I QKAE R+  L   +         K+  ++ + LR+ S+            ++DYED+CL+ RYLAS++  +QSFDIYLT+I R+L + ++A+RTKAM+CLS VV  DP+IL R D+++ VH R +D+STSVREAAVEL+G+++L+RP+L +QYY M+ ERILD G SVRKRVI+I RDIC+E   F+K+ E+CVKMI+R+NDEE IKKLVNE FQ +WF+P    +   + +K++NITDVV++C+D GY+WF+QLL++LLK E+    +   KAC Q+VD LV++I++ EE   D       + RLV+C+ TL+LF+KIRP LMV++ MT+QPYL  +    +D  ++  VA+ILE+ VPL++HP+++ +  +E D++ LI K G  V++ CV+CL A VN+++HNY  V  CF+ Y+  L K +M  ++D   T+  + K  +L R LFTVG LC++FDF+  +        I  ++ E L+++ +++    +++T+AI G+GFL I+   L+    + + Y+++L +   +       NL   VL N+  +L EED R++  D  W    KKE LKEMGD+SSG  S I QLYL  +LE        VR  A++++ + + QGLI+P+  V YLI+  TD  P+ R KAD +L EIDKK++GFI+MKAV G++ S ++Q+ +                + +   ++RG   D ++    AL  +LYTM+R ++Q RR+FL +LL +F +  KS +++L+Y+++NLA FPYQ+QEEP++++H++DI +S  G +  Q  ++ L  E
Sbjct: 1682 DEIQQLQKALLNYLDENVETDPFLLFARKFYLAQWYRDTSTETEKAMKSQRDDDSSDGPHHAKDVETTS------------------EILQKAEARKKFLRSVI---------KTTASKFSSLRVNSD------------TVDYEDSCLIVRYLASMRPFAQSFDIYLTQILRVLGESAIAVRTKAMKCLSEVVAVDPSILARLDMQRGVHGRLMDNSTSVREAAVELLGRFVLSRPQLTEQYYDMLIERILDTGISVRKRVIKILRDICLEQPTFNKVTEMCVKMIRRVNDEEGIKKLVNETFQKLWFTPTPNHDKEAMTRKILNITDVVAACRDSGYDWFEQLLQNLLKSEEDASYKPARKACAQLVDSLVEHILKYEESLADCENKGLTSNRLVACITTLYLFSKIRPHLMVKHAMTMQPYLTTKCNTQSDFMVICNVAKILELVVPLMDHPSESFLTTIEEDLMKLIIKYGMTVVQHCVSCLGAVVNRVTHNYKFVWSCFNRYYGALSKLKMQHQEDPNSTVLVSNKPALL-RSLFTVGALCRHFDFDQEEFKGSNKVVIKDKVLELLLYFTKND--DEEVQTKAIIGLGFLFIQDPGLMFVTEVKNLYNTLLADRKTSV------NLKIQVLKNLQTYLQEEDSRMQEADREWNKLSKKEDLKEMGDISSGMSSSIMQLYLKQVLEAFFHTQSSVRHYALNVIALTLNQGLIHPVQCVPYLIAMGTDSEPTMRNKADQQLVEIDKKYTGFIHMKAVAGMKMSYQVQQAI----------------VGSKDTVIRGFRLDESS---TALCSHLYTMVRGNRQHRRAFLISLLNLFDDNTKSDVNMLLYIADNLASFPYQTQEEPMFIMHHVDITLSVSGSNLLQSFKESLLKE 2511          

HSP 2 Score: 338.576 bits (867), Expect = 1.456e-92
Identity = 209/476 (43.91%), Postives = 297/476 (62.39%), Query Frame = 1
Query: 2713 ITESTTYQHFISLVDGCLEVVEDLDLIKTMKEQTEXXXXXXXXXXXXXXREQLQAMCIEIAKLKATGSTKEVPMEKLTKILTLLMLNISSGAKVCLPVTEDGE---DNRLFKELAFERIGRSLDASFITINIMTSPDISNGVFIEDVQEAVVTSVKYQLVNLIFPEYDPAYRTVNHAKDNQSSIKAKRAREKELHKSKNIVYFYNRLVDIISNLSELVVIQTLTDNVILQLSSLGVSVFFVENISELQLVSLRLITTIFSKYEKHRNLIMDDIIASLSRLPSSKKNMRNYRLNSEDS------IQMLTAXXXXXXXXXXXXXKIEMNSNESEETALSVAPDKIVKET--PKADSEAVIETSYNNAFATAYSFLRIFLHKSTVK-GEDDYRAIFENFVSDLLVTVNKPEWPAAETMLTLLGSLLTNQFINKHSDQTTRLICIDYLGTVASTLRRDAVSSTINPSDIENLIIDLIKGS 4104
            + +S+T++ F + VD  L+ +ED+DL     ++         P ++L+ + QL  +  E AK+KA G   ++  +K+ K+ ++L  NI  GAK+   +  D +   + RL+++L  ER+ +S DA    +NIMTS  +   V+IEDV E VV   K+ L N ++P+YDP YR  +H     SS KAKRA+    HK +  V  YN++ DIISNLSEL+ IQ LTD  ILQ+SSLG++ FFVEN+SELQL +++L+T +FS+YEKHR LI+++I  SL+RLP+SK+N+RNYRLNS D       IQM+TAL L L+                 +  +++  DK   E    K D + +I  SY  A  TA +FL +FL K   K GEDDYR +FENFV DLL TVNKP+WPAAE +L+LLG LL +QF NK ++   R+  +DYLGTVA+ LR+DAV+S ++   I N I+    GS
Sbjct: 1234 MMDSSTFKRFTTSVDNILDNLEDVDLTSLDDDEI--------PQELLLGKHQLSELSSESAKIKAMGIMHKITHDKMVKVQSILEKNIQDGAKLSTLMNHDNDRDDEERLWRDLIMERVTKSADACLTALNIMTSARMPKAVYIEDVIERVVQYTKFHLQNTLYPQYDPVYRVDHHGGGTLSS-KAKRAK-CSTHKQRVTVMLYNKVCDIISNLSELLEIQLLTDTTILQISSLGITPFFVENVSELQLCAIKLVTAVFSRYEKHRQLILEEIFTSLARLPTSKRNLRNYRLNSSDVDGEPMYIQMVTALVLQLI-----------------QCVVNLPSDKDSDEENDRKVDHDVLITNSYETAMRTAQNFLSVFLKKCGSKQGEDDYRPLFENFVQDLLSTVNKPDWPAAELLLSLLGRLLVHQFSNKQTEMALRVASLDYLGTVAARLRKDAVTSKMDQRSI-NRILGENSGS 1681          
BLAST of Nipped-B protein vs. Ensembl Zebrafish
Match: nipblb (NIPBL cohesin loading factor b [Source:NCBI gene;Acc:794108])

HSP 1 Score: 669.078 bits (1725), Expect = 0.000e+0
Identity = 364/897 (40.58%), Postives = 566/897 (63.10%), Query Frame = 1
Query: 4303 DKVQILRDALLDYLNAD-KFDTTAKYAREFYFGQWY----TDCVKELKSQNNQAIAISXXXXXXXXXXXXXXXXXXXXXXXXXXXXISIFQKAEDRRNHLLYKMFGTLPDESKKSKNNRINKLRIGSNPENNRYDIRLKGSLDYEDACLVCRYLASLKSSSQSFDIYLTKICRLLHDPSVALRTKAMRCLSAVVEADPTILRRDDIEKAVHLRFLDSSTSVREAAVELVGKYLLTRPELIDQYYPMIAERILDKGTSVRKRVIRIFRDICVEHTEFSKIPEICVKMIKRINDEEAIKKLVNEVFQNMWFSPVREKEGVKLLQKVMNITDVVSSCKDIGYEWFDQLLESLLKKEDSDKLRVVEKACKQIVDCLVQNIMRLEEISRD------DNQRLVSCMATLHLFTKIRPELMVQYTMTLQPYLNIRNVNDNDTYILHYVARILEVTVPLIEHPAQNHINQLEVDMVNLIDKQGKMVLESCVACLAASVNKISHNYSLVKDCFDNYFDTLLKYRM--EKDQTKTLPQATKRRILSRGLFTVGLLCKYFDFNCLQLGKD----INIRIFETLMFYAEDNTLSCDIRTQAISGIGFLCIRYRELLICPRLLSFYHSILMNSLENTKTEDFPNLICCVLDNIYLFLVEEDDRLRHLDSSWKNNEKKESLKEMGDMSSGTGSHIAQLYLNAILENILQPWKPVRLKAVSLVVIIIRQGLINPISSVAYLISAQTDPNPSNRGKADNELAEIDKKFSGFINMKAVQGIRTSCKLQEVLEMYNIPENRLNWCSKHMLTTPVIVRGV-YDHNADIPLALNHNLYTMLRSSKQFRRSFLYALLAIFGE-LKSRISLLIYVSENLAQFPYQSQEEPLYLVHNIDIMVSSIGPHFTQQIRDQLYPE 6936
            D++Q L+ ALL+YL+ + + D    +AR+FY  QWY    T+  K +KSQ +   +   +    ++  +                   I QKAE R+  L   +         K+  ++ + LR+ S+            ++DYED+CL+ RYLAS++  +QSFDIYLT+I R+L + ++A+RTKAM+CLS VV  DP+IL R D+++ VH R +D+STSVREAAVEL+G+++L+RP+L +QYY M+ ERILD G SVRKRVI+I RDIC+E   F+K+ E+CVKMI+R+NDEE IKKLVNE FQ +WF+P    +   + +K++NITDVV++C+D GY+WF+QLL++LLK E+    +   KAC Q+VD LV++I++ EE   D       + RLV+C+ TL+LF+KIRP LMV++ MT+QPYL  +    +D  ++  VA+ILE+ VPL++HP+++ +  +E D++ LI K G  V++ CV+CL A VN+++HNY  V  CF+ Y+  L K +M  ++D   T+  + K  +L R LFTVG LC++FDF+  +        I  ++ E L+++ +++    +++T+AI G+GFL I+   L+    + + Y+++L +   +       NL   VL N+  +L EED R++  D  W    KKE LKEMGD+SSG  S I QLYL  +LE        VR  A++++ + + QGLI+P+  V YLI+  TD  P+ R KAD +L EIDKK++GFI+MKAV G++ S ++Q+ +                + +   ++RG   D ++    AL  +LYTM+R ++Q RR+FL +LL +F +  KS +++L+Y+++NLA FPYQ+QEEP++++H++DI +S  G +  Q  ++ L  E
Sbjct: 1688 DEIQQLQKALLNYLDENVETDPFLLFARKFYLAQWYRDTSTETEKAMKSQRDDDSSDGPHHAKDVETTS------------------EILQKAEARKKFLRSVI---------KTTASKFSSLRVNSD------------TVDYEDSCLIVRYLASMRPFAQSFDIYLTQILRVLGESAIAVRTKAMKCLSEVVAVDPSILARLDMQRGVHGRLMDNSTSVREAAVELLGRFVLSRPQLTEQYYDMLIERILDTGISVRKRVIKILRDICLEQPTFNKVTEMCVKMIRRVNDEEGIKKLVNETFQKLWFTPTPNHDKEAMTRKILNITDVVAACRDSGYDWFEQLLQNLLKSEEDASYKPARKACAQLVDSLVEHILKYEESLADCENKGLTSNRLVACITTLYLFSKIRPHLMVKHAMTMQPYLTTKCNTQSDFMVICNVAKILELVVPLMDHPSESFLTTIEEDLMKLIIKYGMTVVQHCVSCLGAVVNRVTHNYKFVWSCFNRYYGALSKLKMQHQEDPNSTVLVSNKPALL-RSLFTVGALCRHFDFDQEEFKGSNKVVIKDKVLELLLYFTKND--DEEVQTKAIIGLGFLFIQDPGLMFVTEVKNLYNTLLADRKTSV------NLKIQVLKNLQTYLQEEDSRMQEADREWNKLSKKEDLKEMGDISSGMSSSIMQLYLKQVLEAFFHTQSSVRHYALNVIALTLNQGLIHPVQCVPYLIAMGTDSEPTMRNKADQQLVEIDKKYTGFIHMKAVAGMKMSYQVQQAI----------------VGSKDTVIRGFRLDESS---TALCSHLYTMVRGNRQHRRAFLISLLNLFDDNTKSDVNMLLYIADNLASFPYQTQEEPMFIMHHVDITLSVSGSNLLQSFKESLLKE 2517          

HSP 2 Score: 338.576 bits (867), Expect = 1.629e-92
Identity = 204/467 (43.68%), Postives = 295/467 (63.17%), Query Frame = 1
Query: 2713 ITESTTYQHFISLVDGCLEVVEDLDLIKTMKEQTEXXXXXXXXXXXXXXREQLQAMCIEIAKLKATGSTKEVPMEKLTKILTLLMLNISSGAKVCLPVTEDGE---DNRLFKELAFERIGRSLDASFITINIMTSPDISNGVFIEDVQEAVVTSVKYQLVNLIFPEYDPAYRTVNHAKDNQSSIKAKRAREKELHKSKNIVYFYNRLVDIISNLSELVVIQTLTDNVILQLSSLGVSVFFVENISELQLVSLRLITTIFSKYEKHRNLIMDDIIASLSRLPSSKKNMRNYRLNSEDS------IQMLTAXXXXXXXXXXXXXKIEMNSNESEETALSVAPDKIVKETPKADSEAVIETSYNNAFATAYSFLRIFLHKSTVK-GEDDYRAIFENFVSDLLVTVNKPEWPAAETMLTLLGSLLTNQFINKHSDQTTRLICIDYLGTVASTLRRDAVSSTINPSDIENLI 4083
            + +S+T++ F + VD  L+ +ED+DL     ++         P ++L+ + QL  +  E AK+KA G   ++  +K+ K+ ++L  NI  GAK+   +  D +   + RL+++L  ER+ +S DA    +NIMTS  +   V+IEDV E VV   K+ L N ++P+YDP YR  +H     SS KAKRA+    HK +  V  YN++ DIISNLSEL+ IQ LTD  ILQ+SSLG++ FFVEN+SELQL +++L+T +FS+YEKHR LI+++I  SL+RLP+SK+N+RNYRLNS D       IQM+TA   L++Q +  V  +  + +  EE    V          + D + +I  SY  A  TA +FL +FL K   K GEDDYR +FENFV DLL TVNKP+WPAAE +L+LLG LL +QF NK ++   R+  +DYLGTVA+ LR+DAV+S ++   I  ++
Sbjct: 1234 MMDSSTFKRFTTSVDNILDNLEDVDLTSLDDDEI--------PQELLLGKHQLSELSSESAKIKAMGIMHKITHDKMVKVQSILEKNIQDGAKLSTLMNHDNDRDDEERLWRDLIMERVTKSADACLTALNIMTSARMPKAVYIEDVIERVVQYTKFHLQNTLYPQYDPVYRVDHHGGGTLSS-KAKRAK-CSTHKQRVTVMLYNKVCDIISNLSELLEIQLLTDTTILQISSLGITPFFVENVSELQLCAIKLVTAVFSRYEKHRQLILEEIFTSLARLPTSKRNLRNYRLNSSDVDGEPMYIQMVTA---LVLQLIQCVVNLPSDKDSDEENDRKV----------RVDHDVLITNSYETAMRTAQNFLSVFLKKCGSKQGEDDYRPLFENFVQDLLSTVNKPDWPAAELLLSLLGRLLVHQFSNKQTEMALRVASLDYLGTVAARLRKDAVTSKMDQRSINRIL 1677          
BLAST of Nipped-B protein vs. Ensembl Zebrafish
Match: ddx3xa (DEAD-box helicase 3 X-linked a [Source:ZFIN;Acc:ZDB-GENE-030131-1565])

HSP 1 Score: 287.73 bits (735), Expect = 2.897e-149
Identity = 135/242 (55.79%), Postives = 176/242 (72.73%), Query Frame = 3
Query:  510 SAINFDKYDAIPVSVTGPDYSAINVENFDELKLNPIIRNNILLASYQRPTPIQKNAIPAILEHRDIMACAQTGSGKTAAFLIPIINHLIS--------------QDLSPQRYTKTAYPKCLILAPTRELAIQILSESQKFSLNTQMRSCVVYGGADTHSQIREVQIGCHLLVATPGRLVDFIEKNKISLEMCKYIVLDEADRMLDMGFEPQIRKIIEESNMPSGINRQTLMFSATFPKEIQV 1193
            + INF+KYD IPV  TG + S  ++E+F ++ +  II  NI L+ Y RPTP+QK AIP I   RD+MACAQTGSGKTAAFL+P+++ + S              Q  + +   +  YP  L+LAPTRELA+QI  E++KF+  +++R CVVYGGAD   QIR+++ GCHLLVATPGRLVD +E+ KI L+ CKY+VLDEADRMLDMGFEPQIR+I+E+  MP   +RQT+MFSATFPKEIQ+
Sbjct:  199 TGINFEKYDDIPVEATGTN-SPGHIESFHDVDMGEIIMGNITLSRYTRPTPVQKYAIPIIKTKRDLMACAQTGSGKTAAFLLPVLSQIYSEGPGEALQATKASTQQENGKYVRRKQYPISLVLAPTRELALQIYDEARKFAYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDYCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGSRQTMMFSATFPKEIQI 439          

HSP 2 Score: 264.618 bits (675), Expect = 2.897e-149
Identity = 131/217 (60.37%), Postives = 165/217 (76.04%), Query Frame = 2
Query: 1259 LAADFLYNYIFMTVGRVGSTSDSIKQEIIYMTDVEKLNYLKNIFNTTAPNTLILIFVETKKGADSLARFLLSKGYPVSSIHGDRNQGEREHALNMFRNGQCPILVATAVAARGLDIPNVKHVINYDLPSDIEEYVHRIGRTGRLGNHGRATSFYVDKNNNIAIDLVDLLKEANQIVPQWLSALADELKRNSVIGSNNKRHNQRRFKNGNFGGRDYRQ 1909
            LA DFL  YIF+ VGRVGSTS++I Q+++++ + +K ++L ++ N T  ++L L+FVETKKGAD+L  FL  +GY  +SIHGDR+Q +RE AL+ FR+G+CPI+VATAVAARGLDI NVKHVIN+DLPSDIEEYVHRIGRTGR+GN G ATSFY DKN+NI  DL+D+L EA Q VP WL  LA E +  S       R   +RF +G FG RDYRQ
Sbjct:  440 LARDFLEEYIFLAVGRVGSTSENITQKVVWVEENDKRSFLLDLLNATGKDSLTLVFVETKKGADALEDFLYREGYACTSIHGDRSQRDREEALHQFRSGRCPIMVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFYNDKNSNITKDLLDILVEAKQEVPSWLENLAYEHQHKST-----NRGRPKRF-SGGFGARDYRQ 650          
BLAST of Nipped-B protein vs. Ensembl Zebrafish
Match: ddx3xb (DEAD-box helicase 3 X-linked b [Source:ZFIN;Acc:ZDB-GENE-980526-150])

HSP 1 Score: 279.256 bits (713), Expect = 5.211e-147
Identity = 134/243 (55.14%), Postives = 171/243 (70.37%), Query Frame = 3
Query:  510 SAINFDKYDAIPVSVTGPDYSAINVENFDELKLNPIIRNNILLASYQRPTPIQKNAIPAILEHRDIMACAQTGSGKTAAFLIPIINHLISQDLSPQRYTKTA---------------YPKCLILAPTRELAIQILSESQKFSLNTQMRSCVVYGGADTHSQIREVQIGCHLLVATPGRLVDFIEKNKISLEMCKYIVLDEADRMLDMGFEPQIRKIIEESNMPSGINRQTLMFSATFPKEIQV 1193
            + INF+KYD IPV  TG +     ++ F +L++  II  NI L+ Y RPTP+QK+AIP I   RD+MACAQTGSGKTAAFL+P+++ + +    P    + A               YP  L+LAPTRELA+QI  E++KFS  + +R CVVYGGAD   QIR+++ GCHLLVATPGRLVD +E+ KI L+ C Y+VLDEADRMLDMGFEPQIR+I+E+  MP    RQT+MFSATFPKEIQ+
Sbjct:  184 TGINFEKYDDIPVEATGHN-GPQPIDRFHDLEMGEIIMGNINLSRYTRPTPVQKHAIPIIKSKRDLMACAQTGSGKTAAFLLPVLSQIYTD--GPGEALQAAKNSAQENGKYGRRKQYPISLVLAPTRELALQIYDEARKFSYRSHVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDYCNYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGLRQTMMFSATFPKEIQI 423          

HSP 2 Score: 265.774 bits (678), Expect = 5.211e-147
Identity = 131/217 (60.37%), Postives = 167/217 (76.96%), Query Frame = 2
Query: 1259 LAADFLYNYIFMTVGRVGSTSDSIKQEIIYMTDVEKLNYLKNIFNTTAPNTLILIFVETKKGADSLARFLLSKGYPVSSIHGDRNQGEREHALNMFRNGQCPILVATAVAARGLDIPNVKHVINYDLPSDIEEYVHRIGRTGRLGNHGRATSFYVDKNNNIAIDLVDLLKEANQIVPQWLSALADELKRNSVIGSNNKRHNQRRFKNGNFGGRDYRQ 1909
            LA DFL +YIF+ VGRVGSTS++I Q+++++ + +K ++L ++ N T  ++L L+FVETKKGAD+L  FL  +GY  +SIHGDR+Q +RE AL+ FR+G+CPILVATAVAARGLDI NVKHVIN+DLPSDIEEYVHRIGRTGR+GN G ATSF+ DKN NI  DL+D+L EA Q VP WL +LA E +  S     + R   +RF +G FG RDYRQ
Sbjct:  424 LARDFLEDYIFLAVGRVGSTSENITQKVVWVEENDKRSFLLDLLNATGKDSLTLVFVETKKGADALEDFLYREGYACTSIHGDRSQRDREEALHQFRSGRCPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNDKNGNITKDLLDILVEAKQEVPSWLESLAYEHQHKS-----SSRGRSKRF-SGGFGARDYRQ 634          
BLAST of Nipped-B protein vs. Ensembl Xenopus
Match: NIPBL (NIPBL, cohesin loading factor [Source:NCBI gene;Acc:100038237])

HSP 1 Score: 691.034 bits (1782), Expect = 0.000e+0
Identity = 407/1048 (38.84%), Postives = 620/1048 (59.16%), Query Frame = 1
Query: 4282 NKLLKNI----DKVQILRDALLDYLNAD-KFDTTAKYAREFYFGQWYTDCV----KELKSQNNQAIAISXXXXXXXXXXXXXXXXXXXXXXXXXXXXISIFQKAEDRRNHLLYKMFGTLPDESKKSKNNRINKLRIGSNPENNRYDIRLKGSLDYEDACLVCRYLASLKSSSQSFDIYLTKICRLLHDPSVALRTKAMRCLSAVVEADPTILRRDDIEKAVHLRFLDSSTSVREAAVELVGKYLLTRPELIDQYYPMIAERILDKGTSVRKRVIRIFRDICVEHTEFSKIPEICVKMIKRINDEEAIKKLVNEVFQNMWFSPVREKEGVKLLQKVMNITDVVSSCKDIGYEWFDQLLESLLKKEDSDKLRVVEKACKQIVDCLVQNIMRLEEISRDDNQ------RLVSCMATLHLFTKIRPELMVQYTMTLQPYLNIRNVNDNDTYILHYVARILEVTVPLIEHPAQNHINQLEVDMVNLIDKQGKMVLESCVACLAASVNKISHNYSLVKDCFDNYFDTLLKYR--MEKDQTKTLPQATKRRILSRGLFTVGLLCKYFDFNCLQL--GKDINI--RIFETLMFYAEDNTLSCDIRTQAISGIGFLCIRYRELLICPRLLSFYHSILMNSLENTKTEDFPNLICCVLDNIYLFLVEEDDRLRHLDSSWKNNEKKESLKEMGDMSSGTGSHIAQLYLNAILENILQPWKPVRLKAVSLVVIIIRQGLINPISSVAYLISAQTDPNPSNRGKADNELAEIDKKFSGFINMKAVQGIRTSCKLQEVLEMYNIPENRLNWCSKHMLTTPVIVRGVYDHNADIPLALNHNLYTMLRSSKQFRRSFLYALLAIFGE-LKSRISLLIYVSENLAQFPYQSQEEPLYLVHNIDIMVSSIGPHFTQQIRDQL--------YPELVAHEFNSDPSSNHPATKPDTIH----IDDEENPEVLYKRLMDNPKALRNMRESIRNSRGCVLLISLKQYLRELYSLTDA*FDFNYG***YXXXXXXXGFRKIQKYSPLDTGKAWERQLTRRNGIRFDPLVAL 7323
            N++LK      D +Q L+ ALLDYL  + + D +  ++R+FY  QW+ D      K +KSQ +                     ++         +   I ++AE +R   L  +   +P +    K+N                      ++DY+DACL+ RYLAS++  +QSFDIYLT+I R+L + ++A+RTKAM+CLS VV  DP+IL R D+++ VH R +D+STSVREAAVEL+G+++L RP+L +QYY M+ ERILD G SVRKRVI+I RDIC+E   F KI E+CVKMI+R+NDEE IKKLVNE FQ +WF+P  + +   + +K++NITDVV++C+D GY+WF+QLL++LLK E+    + V+KAC Q+VD LV++I++ EE   D +       RLV+C+ TL LF+KIRP+LMV++ MT+QPYL  +    ND  ++  VA+ILE+ VPL+EHP++  +  +E D++ LI K G  V++ CV+CL A VNK++ NY  V  CF+ Y+  LLK +   ++D   T+   T +  L R LFTVG LC++FDF+  +      +NI  ++ E LM++ +      +++T+AI G+GF  I++  L+    + + Y++IL  S +N+      NL   VL N+  +L EED R++  D  WK   K+E LKEMGD+SSG  S I QLYL  +LE+       VR  A++++ + + QGLI+P+  V YLI+  TDP P+ R K+D +L EIDKK++GFI+MKAV GI+ S ++Q+ +   N   NR              VRG     ++   AL  +LY+M+R ++Q RR+FL +LL +F +  K+ +++L+Y+++NLA FPYQ+QEEPL+++H+IDI +S  G +  Q  ++ +        +  +      S+     P       H     D E+N E + + L +N   L    E    S+G +LL+ LKQ+++ L   +D+                     KIQKYSP ++ K +++ + R+ GI F P   L
Sbjct: 1581 NRILKQAPEGEDDIQQLQKALLDYLEENTETDPSLVFSRKFYIAQWFRDTTMETEKAMKSQKDD-------------------DSDGAQHAKEVESTGDIMRRAE-KRKKFLRSIIKAVPSQFSTLKSN--------------------SDTVDYDDACLIVRYLASMRPFAQSFDIYLTQILRVLGENAIAVRTKAMKCLSEVVAVDPSILARLDMQRGVHGRLMDNSTSVREAAVELLGRFVLCRPQLAEQYYDMLVERILDTGISVRKRVIKILRDICLEQPTFPKITEMCVKMIRRVNDEEGIKKLVNETFQKLWFTPTPQNDKEAMTRKIINITDVVAACRDTGYDWFEQLLQNLLKSEEDASYKPVKKACTQLVDNLVEHILKYEESLADSDSKGVNSGRLVACITTLFLFSKIRPQLMVKHAMTMQPYLTTKCSTQNDFMVICNVAKILELVVPLMEHPSETFLATMEEDLMKLIIKYGMTVVQHCVSCLGAVVNKVTQNYKFVWACFNRYYGALLKLKSQHQEDPNSTV-LTTNKPALLRSLFTVGALCRHFDFDQEEFKGSSKVNIKDKVLELLMYFTKH--ADEEVQTKAIIGLGFSFIQHPGLMFEVEVKNLYNNIL--SDKNSSV----NLKIQVLKNLQTYLQEEDTRMQQADRDWKKMSKQEDLKEMGDISSGMSSSIMQLYLKQVLESFFSTQSSVRHFALNVIALTLNQGLIHPVQCVPYLIAVGTDPEPAMRNKSDQQLIEIDKKYTGFIHMKAVAGIKMSYQVQQAI---NSNANR-------------TVRGFRQDESNS--ALCSHLYSMIRGNRQHRRAFLISLLNLFDDAAKTEVNMLLYIADNLACFPYQTQEEPLFIMHHIDITLSVSGSNLLQSFKESMVKGKQKEKHVPIEDSNSESEEEVCRPRKTRRRRHSGSDSDGEDNVEYVLRCLPNNASPL---IEFANASQGILLLLMLKQHIKNLCGFSDS---------------------KIQKYSPSESAKVYDKTINRKQGIHFHPKQTL 2537          

HSP 2 Score: 336.65 bits (862), Expect = 7.419e-92
Identity = 211/478 (44.14%), Postives = 301/478 (62.97%), Query Frame = 1
Query: 2698 LDPSLITESTTYQHFISLVDGCLEVVEDLDLIKTMKEQTEXXXXXXXXXXXXXXREQLQAMCIEIAKLKATGSTKEVPMEKLTKILTLLMLNISSGAKVC--LPVTEDGEDN-RLFKELAFERIGRSLDASFITINIMTSPDISNGVFIEDVQEAVVTSVKYQLVNLIFPEYDPAYRTVNHAKDNQSSIKAKRAREKELHKSKNIVYFYNRLVDIISNLSELVVIQTLTDNVILQLSSLGVSVFFVENISELQLVSLRLITTIFSKYEKHRNLIMDDIIASLSRLPSSKKNMRNYRLNSEDS------IQMLTAXXXXXXXXXXXXXKIEMNSNESEETALSVAPDKIVKETPKADSEAVIETSYNNAFATAYSFLRIFLHKSTVK-GEDDYRAIFENFVSDLLVTVNKPEWPAAETMLTLLGSLLTNQFINKHSDQTTRLICIDYLGTVASTLRRDAVSSTINPSDIENLIIDLIKG 4101
            L P  + +S+T++ F S V+  LE +ED+D        +       +P +IL+ + QL  +  E AK+KA G   ++  EK+ K+L +L  NI  GAK+   L    D ED  +L+++L  ER+ +S DA    INIMTSP +   V+IEDV E V+   K+ L N ++P+YDP YR   H     SS KAKRA+    HK + IV  YN++ DI+++LSEL+ IQ LTD  ILQ+SS+G++ FFVEN+SELQL +++L+T +FS+YEKHR LI++++  SL+RLP+SK+++RN+RLNS D       IQM+TAL L L+Q VV+   +  + + +EE +             K D +  I  SY  A  TA +FL IFL K   K GE+DYR +FENFV DLL TVNKPEWPAAE +L+LLG LL +QF NK ++   R+  +DYLGTVA+ LR+DAV+S ++   I  ++    +G
Sbjct: 1136 LTPEEMMDSSTFKRFSSAVENILENLEDMDF-------SAFGDDEEIPQEILLGKHQLSELGSESAKIKAMGIMNKISSEKMVKLLGILEKNIQDGAKLTTMLNHNNDTEDEEKLWRDLIMERVTKSADACLTAINIMTSPSMPKAVYIEDVIEHVIQYTKFHLQNTLYPQYDPVYRLDPHGGGLMSS-KAKRAK-CSTHKQRVIVMLYNKICDIVASLSELLEIQLLTDTTILQVSSMGITPFFVENVSELQLCAIKLVTAVFSRYEKHRQLILEELFTSLARLPTSKRSLRNFRLNSSDDDGEAMYIQMVTALVLQLIQCVVH---LPSDRDHAEEES-----------NKKIDQDVFITNSYETAMRTAQNFLSIFLKKCGSKQGEEDYRPLFENFVQDLLSTVNKPEWPAAELLLSLLGRLLVHQFSNKSTEMALRVASLDYLGTVAARLRKDAVTSKMDQGSINRILKQAPEG 1590          
BLAST of Nipped-B protein vs. Ensembl Xenopus
Match: NIPBL (NIPBL, cohesin loading factor [Source:NCBI gene;Acc:100038237])

HSP 1 Score: 690.649 bits (1781), Expect = 0.000e+0
Identity = 407/1048 (38.84%), Postives = 620/1048 (59.16%), Query Frame = 1
Query: 4282 NKLLKNI----DKVQILRDALLDYLNAD-KFDTTAKYAREFYFGQWYTDCV----KELKSQNNQAIAISXXXXXXXXXXXXXXXXXXXXXXXXXXXXISIFQKAEDRRNHLLYKMFGTLPDESKKSKNNRINKLRIGSNPENNRYDIRLKGSLDYEDACLVCRYLASLKSSSQSFDIYLTKICRLLHDPSVALRTKAMRCLSAVVEADPTILRRDDIEKAVHLRFLDSSTSVREAAVELVGKYLLTRPELIDQYYPMIAERILDKGTSVRKRVIRIFRDICVEHTEFSKIPEICVKMIKRINDEEAIKKLVNEVFQNMWFSPVREKEGVKLLQKVMNITDVVSSCKDIGYEWFDQLLESLLKKEDSDKLRVVEKACKQIVDCLVQNIMRLEEISRDDNQ------RLVSCMATLHLFTKIRPELMVQYTMTLQPYLNIRNVNDNDTYILHYVARILEVTVPLIEHPAQNHINQLEVDMVNLIDKQGKMVLESCVACLAASVNKISHNYSLVKDCFDNYFDTLLKYR--MEKDQTKTLPQATKRRILSRGLFTVGLLCKYFDFNCLQL--GKDINI--RIFETLMFYAEDNTLSCDIRTQAISGIGFLCIRYRELLICPRLLSFYHSILMNSLENTKTEDFPNLICCVLDNIYLFLVEEDDRLRHLDSSWKNNEKKESLKEMGDMSSGTGSHIAQLYLNAILENILQPWKPVRLKAVSLVVIIIRQGLINPISSVAYLISAQTDPNPSNRGKADNELAEIDKKFSGFINMKAVQGIRTSCKLQEVLEMYNIPENRLNWCSKHMLTTPVIVRGVYDHNADIPLALNHNLYTMLRSSKQFRRSFLYALLAIFGE-LKSRISLLIYVSENLAQFPYQSQEEPLYLVHNIDIMVSSIGPHFTQQIRDQL--------YPELVAHEFNSDPSSNHPATKPDTIH----IDDEENPEVLYKRLMDNPKALRNMRESIRNSRGCVLLISLKQYLRELYSLTDA*FDFNYG***YXXXXXXXGFRKIQKYSPLDTGKAWERQLTRRNGIRFDPLVAL 7323
            N++LK      D +Q L+ ALLDYL  + + D +  ++R+FY  QW+ D      K +KSQ +                     ++         +   I ++AE +R   L  +   +P +    K+N                      ++DY+DACL+ RYLAS++  +QSFDIYLT+I R+L + ++A+RTKAM+CLS VV  DP+IL R D+++ VH R +D+STSVREAAVEL+G+++L RP+L +QYY M+ ERILD G SVRKRVI+I RDIC+E   F KI E+CVKMI+R+NDEE IKKLVNE FQ +WF+P  + +   + +K++NITDVV++C+D GY+WF+QLL++LLK E+    + V+KAC Q+VD LV++I++ EE   D +       RLV+C+ TL LF+KIRP+LMV++ MT+QPYL  +    ND  ++  VA+ILE+ VPL+EHP++  +  +E D++ LI K G  V++ CV+CL A VNK++ NY  V  CF+ Y+  LLK +   ++D   T+   T +  L R LFTVG LC++FDF+  +      +NI  ++ E LM++ +      +++T+AI G+GF  I++  L+    + + Y++IL  S +N+      NL   VL N+  +L EED R++  D  WK   K+E LKEMGD+SSG  S I QLYL  +LE+       VR  A++++ + + QGLI+P+  V YLI+  TDP P+ R K+D +L EIDKK++GFI+MKAV GI+ S ++Q+ +   N   NR              VRG     ++   AL  +LY+M+R ++Q RR+FL +LL +F +  K+ +++L+Y+++NLA FPYQ+QEEPL+++H+IDI +S  G +  Q  ++ +        +  +      S+     P       H     D E+N E + + L +N   L    E    S+G +LL+ LKQ+++ L   +D+                     KIQKYSP ++ K +++ + R+ GI F P   L
Sbjct: 1557 NRILKQAPEGEDDIQQLQKALLDYLEENTETDPSLVFSRKFYIAQWFRDTTMETEKAMKSQKDD-------------------DSDGAQHAKEVESTGDIMRRAE-KRKKFLRSIIKAVPSQFSTLKSN--------------------SDTVDYDDACLIVRYLASMRPFAQSFDIYLTQILRVLGENAIAVRTKAMKCLSEVVAVDPSILARLDMQRGVHGRLMDNSTSVREAAVELLGRFVLCRPQLAEQYYDMLVERILDTGISVRKRVIKILRDICLEQPTFPKITEMCVKMIRRVNDEEGIKKLVNETFQKLWFTPTPQNDKEAMTRKIINITDVVAACRDTGYDWFEQLLQNLLKSEEDASYKPVKKACTQLVDNLVEHILKYEESLADSDSKGVNSGRLVACITTLFLFSKIRPQLMVKHAMTMQPYLTTKCSTQNDFMVICNVAKILELVVPLMEHPSETFLATMEEDLMKLIIKYGMTVVQHCVSCLGAVVNKVTQNYKFVWACFNRYYGALLKLKSQHQEDPNSTV-LTTNKPALLRSLFTVGALCRHFDFDQEEFKGSSKVNIKDKVLELLMYFTKH--ADEEVQTKAIIGLGFSFIQHPGLMFEVEVKNLYNNIL--SDKNSSV----NLKIQVLKNLQTYLQEEDTRMQQADRDWKKMSKQEDLKEMGDISSGMSSSIMQLYLKQVLESFFSTQSSVRHFALNVIALTLNQGLIHPVQCVPYLIAVGTDPEPAMRNKSDQQLIEIDKKYTGFIHMKAVAGIKMSYQVQQAI---NSNANR-------------TVRGFRQDESNS--ALCSHLYSMIRGNRQHRRAFLISLLNLFDDAAKTEVNMLLYIADNLACFPYQTQEEPLFIMHHIDITLSVSGSNLLQSFKESMVKGKQKEKHVPIEDSNSESEEEVCRPRKTRRRRHSGSDSDGEDNVEYVLRCLPNNASPL---IEFANASQGILLLLMLKQHIKNLCGFSDS---------------------KIQKYSPSESAKVYDKTINRKQGIHFHPKQTL 2513          

HSP 2 Score: 336.65 bits (862), Expect = 8.608e-92
Identity = 211/478 (44.14%), Postives = 301/478 (62.97%), Query Frame = 1
Query: 2698 LDPSLITESTTYQHFISLVDGCLEVVEDLDLIKTMKEQTEXXXXXXXXXXXXXXREQLQAMCIEIAKLKATGSTKEVPMEKLTKILTLLMLNISSGAKVC--LPVTEDGEDN-RLFKELAFERIGRSLDASFITINIMTSPDISNGVFIEDVQEAVVTSVKYQLVNLIFPEYDPAYRTVNHAKDNQSSIKAKRAREKELHKSKNIVYFYNRLVDIISNLSELVVIQTLTDNVILQLSSLGVSVFFVENISELQLVSLRLITTIFSKYEKHRNLIMDDIIASLSRLPSSKKNMRNYRLNSEDS------IQMLTAXXXXXXXXXXXXXKIEMNSNESEETALSVAPDKIVKETPKADSEAVIETSYNNAFATAYSFLRIFLHKSTVK-GEDDYRAIFENFVSDLLVTVNKPEWPAAETMLTLLGSLLTNQFINKHSDQTTRLICIDYLGTVASTLRRDAVSSTINPSDIENLIIDLIKG 4101
            L P  + +S+T++ F S V+  LE +ED+D        +       +P +IL+ + QL  +  E AK+KA G   ++  EK+ K+L +L  NI  GAK+   L    D ED  +L+++L  ER+ +S DA    INIMTSP +   V+IEDV E V+   K+ L N ++P+YDP YR   H     SS KAKRA+    HK + IV  YN++ DI+++LSEL+ IQ LTD  ILQ+SS+G++ FFVEN+SELQL +++L+T +FS+YEKHR LI++++  SL+RLP+SK+++RN+RLNS D       IQM+TAL L L+Q VV+   +  + + +EE +             K D +  I  SY  A  TA +FL IFL K   K GE+DYR +FENFV DLL TVNKPEWPAAE +L+LLG LL +QF NK ++   R+  +DYLGTVA+ LR+DAV+S ++   I  ++    +G
Sbjct: 1112 LTPEEMMDSSTFKRFSSAVENILENLEDMDF-------SAFGDDEEIPQEILLGKHQLSELGSESAKIKAMGIMNKISSEKMVKLLGILEKNIQDGAKLTTMLNHNNDTEDEEKLWRDLIMERVTKSADACLTAINIMTSPSMPKAVYIEDVIEHVIQYTKFHLQNTLYPQYDPVYRLDPHGGGLMSS-KAKRAK-CSTHKQRVIVMLYNKICDIVASLSELLEIQLLTDTTILQVSSMGITPFFVENVSELQLCAIKLVTAVFSRYEKHRQLILEELFTSLARLPTSKRSLRNFRLNSSDDDGEAMYIQMVTALVLQLIQCVVH---LPSDRDHAEEES-----------NKKIDQDVFITNSYETAMRTAQNFLSIFLKKCGSKQGEEDYRPLFENFVQDLLSTVNKPEWPAAELLLSLLGRLLVHQFSNKSTEMALRVASLDYLGTVAARLRKDAVTSKMDQGSINRILKQAPEG 1566          
BLAST of Nipped-B protein vs. Ensembl Xenopus
Match: NIPBL (NIPBL, cohesin loading factor [Source:NCBI gene;Acc:100038237])

HSP 1 Score: 690.649 bits (1781), Expect = 0.000e+0
Identity = 407/1048 (38.84%), Postives = 620/1048 (59.16%), Query Frame = 1
Query: 4282 NKLLKNI----DKVQILRDALLDYLNAD-KFDTTAKYAREFYFGQWYTDCV----KELKSQNNQAIAISXXXXXXXXXXXXXXXXXXXXXXXXXXXXISIFQKAEDRRNHLLYKMFGTLPDESKKSKNNRINKLRIGSNPENNRYDIRLKGSLDYEDACLVCRYLASLKSSSQSFDIYLTKICRLLHDPSVALRTKAMRCLSAVVEADPTILRRDDIEKAVHLRFLDSSTSVREAAVELVGKYLLTRPELIDQYYPMIAERILDKGTSVRKRVIRIFRDICVEHTEFSKIPEICVKMIKRINDEEAIKKLVNEVFQNMWFSPVREKEGVKLLQKVMNITDVVSSCKDIGYEWFDQLLESLLKKEDSDKLRVVEKACKQIVDCLVQNIMRLEEISRDDNQ------RLVSCMATLHLFTKIRPELMVQYTMTLQPYLNIRNVNDNDTYILHYVARILEVTVPLIEHPAQNHINQLEVDMVNLIDKQGKMVLESCVACLAASVNKISHNYSLVKDCFDNYFDTLLKYR--MEKDQTKTLPQATKRRILSRGLFTVGLLCKYFDFNCLQL--GKDINI--RIFETLMFYAEDNTLSCDIRTQAISGIGFLCIRYRELLICPRLLSFYHSILMNSLENTKTEDFPNLICCVLDNIYLFLVEEDDRLRHLDSSWKNNEKKESLKEMGDMSSGTGSHIAQLYLNAILENILQPWKPVRLKAVSLVVIIIRQGLINPISSVAYLISAQTDPNPSNRGKADNELAEIDKKFSGFINMKAVQGIRTSCKLQEVLEMYNIPENRLNWCSKHMLTTPVIVRGVYDHNADIPLALNHNLYTMLRSSKQFRRSFLYALLAIFGE-LKSRISLLIYVSENLAQFPYQSQEEPLYLVHNIDIMVSSIGPHFTQQIRDQL--------YPELVAHEFNSDPSSNHPATKPDTIH----IDDEENPEVLYKRLMDNPKALRNMRESIRNSRGCVLLISLKQYLRELYSLTDA*FDFNYG***YXXXXXXXGFRKIQKYSPLDTGKAWERQLTRRNGIRFDPLVAL 7323
            N++LK      D +Q L+ ALLDYL  + + D +  ++R+FY  QW+ D      K +KSQ +                     ++         +   I ++AE +R   L  +   +P +    K+N                      ++DY+DACL+ RYLAS++  +QSFDIYLT+I R+L + ++A+RTKAM+CLS VV  DP+IL R D+++ VH R +D+STSVREAAVEL+G+++L RP+L +QYY M+ ERILD G SVRKRVI+I RDIC+E   F KI E+CVKMI+R+NDEE IKKLVNE FQ +WF+P  + +   + +K++NITDVV++C+D GY+WF+QLL++LLK E+    + V+KAC Q+VD LV++I++ EE   D +       RLV+C+ TL LF+KIRP+LMV++ MT+QPYL  +    ND  ++  VA+ILE+ VPL+EHP++  +  +E D++ LI K G  V++ CV+CL A VNK++ NY  V  CF+ Y+  LLK +   ++D   T+   T +  L R LFTVG LC++FDF+  +      +NI  ++ E LM++ +      +++T+AI G+GF  I++  L+    + + Y++IL  S +N+      NL   VL N+  +L EED R++  D  WK   K+E LKEMGD+SSG  S I QLYL  +LE+       VR  A++++ + + QGLI+P+  V YLI+  TDP P+ R K+D +L EIDKK++GFI+MKAV GI+ S ++Q+ +   N   NR              VRG     ++   AL  +LY+M+R ++Q RR+FL +LL +F +  K+ +++L+Y+++NLA FPYQ+QEEPL+++H+IDI +S  G +  Q  ++ +        +  +      S+     P       H     D E+N E + + L +N   L    E    S+G +LL+ LKQ+++ L   +D+                     KIQKYSP ++ K +++ + R+ GI F P   L
Sbjct: 1671 NRILKQAPEGEDDIQQLQKALLDYLEENTETDPSLVFSRKFYIAQWFRDTTMETEKAMKSQKDD-------------------DSDGAQHAKEVESTGDIMRRAE-KRKKFLRSIIKAVPSQFSTLKSN--------------------SDTVDYDDACLIVRYLASMRPFAQSFDIYLTQILRVLGENAIAVRTKAMKCLSEVVAVDPSILARLDMQRGVHGRLMDNSTSVREAAVELLGRFVLCRPQLAEQYYDMLVERILDTGISVRKRVIKILRDICLEQPTFPKITEMCVKMIRRVNDEEGIKKLVNETFQKLWFTPTPQNDKEAMTRKIINITDVVAACRDTGYDWFEQLLQNLLKSEEDASYKPVKKACTQLVDNLVEHILKYEESLADSDSKGVNSGRLVACITTLFLFSKIRPQLMVKHAMTMQPYLTTKCSTQNDFMVICNVAKILELVVPLMEHPSETFLATMEEDLMKLIIKYGMTVVQHCVSCLGAVVNKVTQNYKFVWACFNRYYGALLKLKSQHQEDPNSTV-LTTNKPALLRSLFTVGALCRHFDFDQEEFKGSSKVNIKDKVLELLMYFTKH--ADEEVQTKAIIGLGFSFIQHPGLMFEVEVKNLYNNIL--SDKNSSV----NLKIQVLKNLQTYLQEEDTRMQQADRDWKKMSKQEDLKEMGDISSGMSSSIMQLYLKQVLESFFSTQSSVRHFALNVIALTLNQGLIHPVQCVPYLIAVGTDPEPAMRNKSDQQLIEIDKKYTGFIHMKAVAGIKMSYQVQQAI---NSNANR-------------TVRGFRQDESNS--ALCSHLYSMIRGNRQHRRAFLISLLNLFDDAAKTEVNMLLYIADNLACFPYQTQEEPLFIMHHIDITLSVSGSNLLQSFKESMVKGKQKEKHVPIEDSNSESEEEVCRPRKTRRRRHSGSDSDGEDNVEYVLRCLPNNASPL---IEFANASQGILLLLMLKQHIKNLCGFSDS---------------------KIQKYSPSESAKVYDKTINRKQGIHFHPKQTL 2627          

HSP 2 Score: 336.65 bits (862), Expect = 9.621e-92
Identity = 211/478 (44.14%), Postives = 301/478 (62.97%), Query Frame = 1
Query: 2698 LDPSLITESTTYQHFISLVDGCLEVVEDLDLIKTMKEQTEXXXXXXXXXXXXXXREQLQAMCIEIAKLKATGSTKEVPMEKLTKILTLLMLNISSGAKVC--LPVTEDGEDN-RLFKELAFERIGRSLDASFITINIMTSPDISNGVFIEDVQEAVVTSVKYQLVNLIFPEYDPAYRTVNHAKDNQSSIKAKRAREKELHKSKNIVYFYNRLVDIISNLSELVVIQTLTDNVILQLSSLGVSVFFVENISELQLVSLRLITTIFSKYEKHRNLIMDDIIASLSRLPSSKKNMRNYRLNSEDS------IQMLTAXXXXXXXXXXXXXKIEMNSNESEETALSVAPDKIVKETPKADSEAVIETSYNNAFATAYSFLRIFLHKSTVK-GEDDYRAIFENFVSDLLVTVNKPEWPAAETMLTLLGSLLTNQFINKHSDQTTRLICIDYLGTVASTLRRDAVSSTINPSDIENLIIDLIKG 4101
            L P  + +S+T++ F S V+  LE +ED+D        +       +P +IL+ + QL  +  E AK+KA G   ++  EK+ K+L +L  NI  GAK+   L    D ED  +L+++L  ER+ +S DA    INIMTSP +   V+IEDV E V+   K+ L N ++P+YDP YR   H     SS KAKRA+    HK + IV  YN++ DI+++LSEL+ IQ LTD  ILQ+SS+G++ FFVEN+SELQL +++L+T +FS+YEKHR LI++++  SL+RLP+SK+++RN+RLNS D       IQM+TAL L L+Q VV+   +  + + +EE +             K D +  I  SY  A  TA +FL IFL K   K GE+DYR +FENFV DLL TVNKPEWPAAE +L+LLG LL +QF NK ++   R+  +DYLGTVA+ LR+DAV+S ++   I  ++    +G
Sbjct: 1226 LTPEEMMDSSTFKRFSSAVENILENLEDMDF-------SAFGDDEEIPQEILLGKHQLSELGSESAKIKAMGIMNKISSEKMVKLLGILEKNIQDGAKLTTMLNHNNDTEDEEKLWRDLIMERVTKSADACLTAINIMTSPSMPKAVYIEDVIEHVIQYTKFHLQNTLYPQYDPVYRLDPHGGGLMSS-KAKRAK-CSTHKQRVIVMLYNKICDIVASLSELLEIQLLTDTTILQVSSMGITPFFVENVSELQLCAIKLVTAVFSRYEKHRQLILEELFTSLARLPTSKRSLRNFRLNSSDDDGEAMYIQMVTALVLQLIQCVVH---LPSDRDHAEEES-----------NKKIDQDVFITNSYETAMRTAQNFLSIFLKKCGSKQGEEDYRPLFENFVQDLLSTVNKPEWPAAELLLSLLGRLLVHQFSNKSTEMALRVASLDYLGTVAARLRKDAVTSKMDQGSINRILKQAPEG 1680          
BLAST of Nipped-B protein vs. Ensembl Xenopus
Match: NIPBL (NIPBL, cohesin loading factor [Source:NCBI gene;Acc:100038237])

HSP 1 Score: 689.878 bits (1779), Expect = 0.000e+0
Identity = 407/1048 (38.84%), Postives = 620/1048 (59.16%), Query Frame = 1
Query: 4282 NKLLKNI----DKVQILRDALLDYLNAD-KFDTTAKYAREFYFGQWYTDCV----KELKSQNNQAIAISXXXXXXXXXXXXXXXXXXXXXXXXXXXXISIFQKAEDRRNHLLYKMFGTLPDESKKSKNNRINKLRIGSNPENNRYDIRLKGSLDYEDACLVCRYLASLKSSSQSFDIYLTKICRLLHDPSVALRTKAMRCLSAVVEADPTILRRDDIEKAVHLRFLDSSTSVREAAVELVGKYLLTRPELIDQYYPMIAERILDKGTSVRKRVIRIFRDICVEHTEFSKIPEICVKMIKRINDEEAIKKLVNEVFQNMWFSPVREKEGVKLLQKVMNITDVVSSCKDIGYEWFDQLLESLLKKEDSDKLRVVEKACKQIVDCLVQNIMRLEEISRDDNQ------RLVSCMATLHLFTKIRPELMVQYTMTLQPYLNIRNVNDNDTYILHYVARILEVTVPLIEHPAQNHINQLEVDMVNLIDKQGKMVLESCVACLAASVNKISHNYSLVKDCFDNYFDTLLKYR--MEKDQTKTLPQATKRRILSRGLFTVGLLCKYFDFNCLQL--GKDINI--RIFETLMFYAEDNTLSCDIRTQAISGIGFLCIRYRELLICPRLLSFYHSILMNSLENTKTEDFPNLICCVLDNIYLFLVEEDDRLRHLDSSWKNNEKKESLKEMGDMSSGTGSHIAQLYLNAILENILQPWKPVRLKAVSLVVIIIRQGLINPISSVAYLISAQTDPNPSNRGKADNELAEIDKKFSGFINMKAVQGIRTSCKLQEVLEMYNIPENRLNWCSKHMLTTPVIVRGVYDHNADIPLALNHNLYTMLRSSKQFRRSFLYALLAIFGE-LKSRISLLIYVSENLAQFPYQSQEEPLYLVHNIDIMVSSIGPHFTQQIRDQL--------YPELVAHEFNSDPSSNHPATKPDTIH----IDDEENPEVLYKRLMDNPKALRNMRESIRNSRGCVLLISLKQYLRELYSLTDA*FDFNYG***YXXXXXXXGFRKIQKYSPLDTGKAWERQLTRRNGIRFDPLVAL 7323
            N++LK      D +Q L+ ALLDYL  + + D +  ++R+FY  QW+ D      K +KSQ +                     ++         +   I ++AE +R   L  +   +P +    K+N                      ++DY+DACL+ RYLAS++  +QSFDIYLT+I R+L + ++A+RTKAM+CLS VV  DP+IL R D+++ VH R +D+STSVREAAVEL+G+++L RP+L +QYY M+ ERILD G SVRKRVI+I RDIC+E   F KI E+CVKMI+R+NDEE IKKLVNE FQ +WF+P  + +   + +K++NITDVV++C+D GY+WF+QLL++LLK E+    + V+KAC Q+VD LV++I++ EE   D +       RLV+C+ TL LF+KIRP+LMV++ MT+QPYL  +    ND  ++  VA+ILE+ VPL+EHP++  +  +E D++ LI K G  V++ CV+CL A VNK++ NY  V  CF+ Y+  LLK +   ++D   T+   T +  L R LFTVG LC++FDF+  +      +NI  ++ E LM++ +      +++T+AI G+GF  I++  L+    + + Y++IL  S +N+      NL   VL N+  +L EED R++  D  WK   K+E LKEMGD+SSG  S I QLYL  +LE+       VR  A++++ + + QGLI+P+  V YLI+  TDP P+ R K+D +L EIDKK++GFI+MKAV GI+ S ++Q+ +   N   NR              VRG     ++   AL  +LY+M+R ++Q RR+FL +LL +F +  K+ +++L+Y+++NLA FPYQ+QEEPL+++H+IDI +S  G +  Q  ++ +        +  +      S+     P       H     D E+N E + + L +N   L    E    S+G +LL+ LKQ+++ L   +D+                     KIQKYSP ++ K +++ + R+ GI F P   L
Sbjct: 1608 NRILKQAPEGEDDIQQLQKALLDYLEENTETDPSLVFSRKFYIAQWFRDTTMETEKAMKSQKDD-------------------DSDGAQHAKEVESTGDIMRRAE-KRKKFLRSIIKAVPSQFSTLKSN--------------------SDTVDYDDACLIVRYLASMRPFAQSFDIYLTQILRVLGENAIAVRTKAMKCLSEVVAVDPSILARLDMQRGVHGRLMDNSTSVREAAVELLGRFVLCRPQLAEQYYDMLVERILDTGISVRKRVIKILRDICLEQPTFPKITEMCVKMIRRVNDEEGIKKLVNETFQKLWFTPTPQNDKEAMTRKIINITDVVAACRDTGYDWFEQLLQNLLKSEEDASYKPVKKACTQLVDNLVEHILKYEESLADSDSKGVNSGRLVACITTLFLFSKIRPQLMVKHAMTMQPYLTTKCSTQNDFMVICNVAKILELVVPLMEHPSETFLATMEEDLMKLIIKYGMTVVQHCVSCLGAVVNKVTQNYKFVWACFNRYYGALLKLKSQHQEDPNSTV-LTTNKPALLRSLFTVGALCRHFDFDQEEFKGSSKVNIKDKVLELLMYFTKH--ADEEVQTKAIIGLGFSFIQHPGLMFEVEVKNLYNNIL--SDKNSSV----NLKIQVLKNLQTYLQEEDTRMQQADRDWKKMSKQEDLKEMGDISSGMSSSIMQLYLKQVLESFFSTQSSVRHFALNVIALTLNQGLIHPVQCVPYLIAVGTDPEPAMRNKSDQQLIEIDKKYTGFIHMKAVAGIKMSYQVQQAI---NSNANR-------------TVRGFRQDESNS--ALCSHLYSMIRGNRQHRRAFLISLLNLFDDAAKTEVNMLLYIADNLACFPYQTQEEPLFIMHHIDITLSVSGSNLLQSFKESMVKGKQKEKHVPIEDSNSESEEEVCRPRKTRRRRHSGSDSDGEDNVEYVLRCLPNNASPL---IEFANASQGILLLLMLKQHIKNLCGFSDS---------------------KIQKYSPSESAKVYDKTINRKQGIHFHPKQTL 2564          

HSP 2 Score: 336.265 bits (861), Expect = 9.935e-92
Identity = 211/478 (44.14%), Postives = 301/478 (62.97%), Query Frame = 1
Query: 2698 LDPSLITESTTYQHFISLVDGCLEVVEDLDLIKTMKEQTEXXXXXXXXXXXXXXREQLQAMCIEIAKLKATGSTKEVPMEKLTKILTLLMLNISSGAKVC--LPVTEDGEDN-RLFKELAFERIGRSLDASFITINIMTSPDISNGVFIEDVQEAVVTSVKYQLVNLIFPEYDPAYRTVNHAKDNQSSIKAKRAREKELHKSKNIVYFYNRLVDIISNLSELVVIQTLTDNVILQLSSLGVSVFFVENISELQLVSLRLITTIFSKYEKHRNLIMDDIIASLSRLPSSKKNMRNYRLNSEDS------IQMLTAXXXXXXXXXXXXXKIEMNSNESEETALSVAPDKIVKETPKADSEAVIETSYNNAFATAYSFLRIFLHKSTVK-GEDDYRAIFENFVSDLLVTVNKPEWPAAETMLTLLGSLLTNQFINKHSDQTTRLICIDYLGTVASTLRRDAVSSTINPSDIENLIIDLIKG 4101
            L P  + +S+T++ F S V+  LE +ED+D        +       +P +IL+ + QL  +  E AK+KA G   ++  EK+ K+L +L  NI  GAK+   L    D ED  +L+++L  ER+ +S DA    INIMTSP +   V+IEDV E V+   K+ L N ++P+YDP YR   H     SS KAKRA+    HK + IV  YN++ DI+++LSEL+ IQ LTD  ILQ+SS+G++ FFVEN+SELQL +++L+T +FS+YEKHR LI++++  SL+RLP+SK+++RN+RLNS D       IQM+TAL L L+Q VV+   +  + + +EE +             K D +  I  SY  A  TA +FL IFL K   K GE+DYR +FENFV DLL TVNKPEWPAAE +L+LLG LL +QF NK ++   R+  +DYLGTVA+ LR+DAV+S ++   I  ++    +G
Sbjct: 1163 LTPEEMMDSSTFKRFSSAVENILENLEDMDF-------SAFGDDEEIPQEILLGKHQLSELGSESAKIKAMGIMNKISSEKMVKLLGILEKNIQDGAKLTTMLNHNNDTEDEEKLWRDLIMERVTKSADACLTAINIMTSPSMPKAVYIEDVIEHVIQYTKFHLQNTLYPQYDPVYRLDPHGGGLMSS-KAKRAK-CSTHKQRVIVMLYNKICDIVASLSELLEIQLLTDTTILQVSSMGITPFFVENVSELQLCAIKLVTAVFSRYEKHRQLILEELFTSLARLPTSKRSLRNFRLNSSDDDGEAMYIQMVTALVLQLIQCVVH---LPSDRDHAEEES-----------NKKIDQDVFITNSYETAMRTAQNFLSIFLKKCGSKQGEEDYRPLFENFVQDLLSTVNKPEWPAAELLLSLLGRLLVHQFSNKSTEMALRVASLDYLGTVAARLRKDAVTSKMDQGSINRILKQAPEG 1617          
BLAST of Nipped-B protein vs. Ensembl Xenopus
Match: NIPBL (NIPBL, cohesin loading factor [Source:NCBI gene;Acc:100038237])

HSP 1 Score: 689.878 bits (1779), Expect = 0.000e+0
Identity = 407/1048 (38.84%), Postives = 620/1048 (59.16%), Query Frame = 1
Query: 4282 NKLLKNI----DKVQILRDALLDYLNAD-KFDTTAKYAREFYFGQWYTDCV----KELKSQNNQAIAISXXXXXXXXXXXXXXXXXXXXXXXXXXXXISIFQKAEDRRNHLLYKMFGTLPDESKKSKNNRINKLRIGSNPENNRYDIRLKGSLDYEDACLVCRYLASLKSSSQSFDIYLTKICRLLHDPSVALRTKAMRCLSAVVEADPTILRRDDIEKAVHLRFLDSSTSVREAAVELVGKYLLTRPELIDQYYPMIAERILDKGTSVRKRVIRIFRDICVEHTEFSKIPEICVKMIKRINDEEAIKKLVNEVFQNMWFSPVREKEGVKLLQKVMNITDVVSSCKDIGYEWFDQLLESLLKKEDSDKLRVVEKACKQIVDCLVQNIMRLEEISRDDNQ------RLVSCMATLHLFTKIRPELMVQYTMTLQPYLNIRNVNDNDTYILHYVARILEVTVPLIEHPAQNHINQLEVDMVNLIDKQGKMVLESCVACLAASVNKISHNYSLVKDCFDNYFDTLLKYR--MEKDQTKTLPQATKRRILSRGLFTVGLLCKYFDFNCLQL--GKDINI--RIFETLMFYAEDNTLSCDIRTQAISGIGFLCIRYRELLICPRLLSFYHSILMNSLENTKTEDFPNLICCVLDNIYLFLVEEDDRLRHLDSSWKNNEKKESLKEMGDMSSGTGSHIAQLYLNAILENILQPWKPVRLKAVSLVVIIIRQGLINPISSVAYLISAQTDPNPSNRGKADNELAEIDKKFSGFINMKAVQGIRTSCKLQEVLEMYNIPENRLNWCSKHMLTTPVIVRGVYDHNADIPLALNHNLYTMLRSSKQFRRSFLYALLAIFGE-LKSRISLLIYVSENLAQFPYQSQEEPLYLVHNIDIMVSSIGPHFTQQIRDQL--------YPELVAHEFNSDPSSNHPATKPDTIH----IDDEENPEVLYKRLMDNPKALRNMRESIRNSRGCVLLISLKQYLRELYSLTDA*FDFNYG***YXXXXXXXGFRKIQKYSPLDTGKAWERQLTRRNGIRFDPLVAL 7323
            N++LK      D +Q L+ ALLDYL  + + D +  ++R+FY  QW+ D      K +KSQ +                     ++         +   I ++AE +R   L  +   +P +    K+N                      ++DY+DACL+ RYLAS++  +QSFDIYLT+I R+L + ++A+RTKAM+CLS VV  DP+IL R D+++ VH R +D+STSVREAAVEL+G+++L RP+L +QYY M+ ERILD G SVRKRVI+I RDIC+E   F KI E+CVKMI+R+NDEE IKKLVNE FQ +WF+P  + +   + +K++NITDVV++C+D GY+WF+QLL++LLK E+    + V+KAC Q+VD LV++I++ EE   D +       RLV+C+ TL LF+KIRP+LMV++ MT+QPYL  +    ND  ++  VA+ILE+ VPL+EHP++  +  +E D++ LI K G  V++ CV+CL A VNK++ NY  V  CF+ Y+  LLK +   ++D   T+   T +  L R LFTVG LC++FDF+  +      +NI  ++ E LM++ +      +++T+AI G+GF  I++  L+    + + Y++IL  S +N+      NL   VL N+  +L EED R++  D  WK   K+E LKEMGD+SSG  S I QLYL  +LE+       VR  A++++ + + QGLI+P+  V YLI+  TDP P+ R K+D +L EIDKK++GFI+MKAV GI+ S ++Q+ +   N   NR              VRG     ++   AL  +LY+M+R ++Q RR+FL +LL +F +  K+ +++L+Y+++NLA FPYQ+QEEPL+++H+IDI +S  G +  Q  ++ +        +  +      S+     P       H     D E+N E + + L +N   L    E    S+G +LL+ LKQ+++ L   +D+                     KIQKYSP ++ K +++ + R+ GI F P   L
Sbjct: 1601 NRILKQAPEGEDDIQQLQKALLDYLEENTETDPSLVFSRKFYIAQWFRDTTMETEKAMKSQKDD-------------------DSDGAQHAKEVESTGDIMRRAE-KRKKFLRSIIKAVPSQFSTLKSN--------------------SDTVDYDDACLIVRYLASMRPFAQSFDIYLTQILRVLGENAIAVRTKAMKCLSEVVAVDPSILARLDMQRGVHGRLMDNSTSVREAAVELLGRFVLCRPQLAEQYYDMLVERILDTGISVRKRVIKILRDICLEQPTFPKITEMCVKMIRRVNDEEGIKKLVNETFQKLWFTPTPQNDKEAMTRKIINITDVVAACRDTGYDWFEQLLQNLLKSEEDASYKPVKKACTQLVDNLVEHILKYEESLADSDSKGVNSGRLVACITTLFLFSKIRPQLMVKHAMTMQPYLTTKCSTQNDFMVICNVAKILELVVPLMEHPSETFLATMEEDLMKLIIKYGMTVVQHCVSCLGAVVNKVTQNYKFVWACFNRYYGALLKLKSQHQEDPNSTV-LTTNKPALLRSLFTVGALCRHFDFDQEEFKGSSKVNIKDKVLELLMYFTKH--ADEEVQTKAIIGLGFSFIQHPGLMFEVEVKNLYNNIL--SDKNSSV----NLKIQVLKNLQTYLQEEDTRMQQADRDWKKMSKQEDLKEMGDISSGMSSSIMQLYLKQVLESFFSTQSSVRHFALNVIALTLNQGLIHPVQCVPYLIAVGTDPEPAMRNKSDQQLIEIDKKYTGFIHMKAVAGIKMSYQVQQAI---NSNANR-------------TVRGFRQDESNS--ALCSHLYSMIRGNRQHRRAFLISLLNLFDDAAKTEVNMLLYIADNLACFPYQTQEEPLFIMHHIDITLSVSGSNLLQSFKESMVKGKQKEKHVPIEDSNSESEEEVCRPRKTRRRRHSGSDSDGEDNVEYVLRCLPNNASPL---IEFANASQGILLLLMLKQHIKNLCGFSDS---------------------KIQKYSPSESAKVYDKTINRKQGIHFHPKQTL 2557          

HSP 2 Score: 335.88 bits (860), Expect = 1.254e-91
Identity = 211/478 (44.14%), Postives = 301/478 (62.97%), Query Frame = 1
Query: 2698 LDPSLITESTTYQHFISLVDGCLEVVEDLDLIKTMKEQTEXXXXXXXXXXXXXXREQLQAMCIEIAKLKATGSTKEVPMEKLTKILTLLMLNISSGAKVC--LPVTEDGEDN-RLFKELAFERIGRSLDASFITINIMTSPDISNGVFIEDVQEAVVTSVKYQLVNLIFPEYDPAYRTVNHAKDNQSSIKAKRAREKELHKSKNIVYFYNRLVDIISNLSELVVIQTLTDNVILQLSSLGVSVFFVENISELQLVSLRLITTIFSKYEKHRNLIMDDIIASLSRLPSSKKNMRNYRLNSEDS------IQMLTAXXXXXXXXXXXXXKIEMNSNESEETALSVAPDKIVKETPKADSEAVIETSYNNAFATAYSFLRIFLHKSTVK-GEDDYRAIFENFVSDLLVTVNKPEWPAAETMLTLLGSLLTNQFINKHSDQTTRLICIDYLGTVASTLRRDAVSSTINPSDIENLIIDLIKG 4101
            L P  + +S+T++ F S V+  LE +ED+D        +       +P +IL+ + QL  +  E AK+KA G   ++  EK+ K+L +L  NI  GAK+   L    D ED  +L+++L  ER+ +S DA    INIMTSP +   V+IEDV E V+   K+ L N ++P+YDP YR   H     SS KAKRA+    HK + IV  YN++ DI+++LSEL+ IQ LTD  ILQ+SS+G++ FFVEN+SELQL +++L+T +FS+YEKHR LI++++  SL+RLP+SK+++RN+RLNS D       IQM+TAL L L+Q VV+   +  + + +EE +             K D +  I  SY  A  TA +FL IFL K   K GE+DYR +FENFV DLL TVNKPEWPAAE +L+LLG LL +QF NK ++   R+  +DYLGTVA+ LR+DAV+S ++   I  ++    +G
Sbjct: 1156 LTPEEMMDSSTFKRFSSAVENILENLEDMDF-------SAFGDDEEIPQEILLGKHQLSELGSESAKIKAMGIMNKISSEKMVKLLGILEKNIQDGAKLTTMLNHNNDTEDEEKLWRDLIMERVTKSADACLTAINIMTSPSMPKAVYIEDVIEHVIQYTKFHLQNTLYPQYDPVYRLDPHGGGLMSS-KAKRAK-CSTHKQRVIVMLYNKICDIVASLSELLEIQLLTDTTILQVSSMGITPFFVENVSELQLCAIKLVTAVFSRYEKHRQLILEELFTSLARLPTSKRSLRNFRLNSSDDDGEAMYIQMVTALVLQLIQCVVH---LPSDRDHAEEES-----------NKKIDQDVFITNSYETAMRTAQNFLSIFLKKCGSKQGEEDYRPLFENFVQDLLSTVNKPEWPAAELLLSLLGRLLVHQFSNKSTEMALRVASLDYLGTVAARLRKDAVTSKMDQGSINRILKQAPEG 1610          
BLAST of Nipped-B protein vs. Ensembl Mouse
Match: Nipbl (NIPBL cohesin loading factor [Source:MGI Symbol;Acc:MGI:1913976])

HSP 1 Score: 704.516 bits (1817), Expect = 0.000e+0
Identity = 408/1074 (37.99%), Postives = 640/1074 (59.59%), Query Frame = 1
Query: 4285 KLLKNI----DKVQILRDALLDYLNAD-KFDTTAKYAREFYFGQWYTDCV----KELKSQNNQAIAISXXXXXXXXXXXXXXXXXXXXXXXXXXXXISIFQKAEDRRNHLLYKMFGTLPDESKKSKNNRINKLRIGSNPENNRYDIRLKGSLDYEDACLVCRYLASLKSSSQSFDIYLTKICRLLHDPSVALRTKAMRCLSAVVEADPTILRRDDIEKAVHLRFLDSSTSVREAAVELVGKYLLTRPELIDQYYPMIAERILDKGTSVRKRVIRIFRDICVEHTEFSKIPEICVKMIKRINDEEAIKKLVNEVFQNMWFSPVREKEGVKLLQKVMNITDVVSSCKDIGYEWFDQLLESLLKKEDSDKLRVVEKACKQIVDCLVQNIMRLEE-ISRDDNQ-----RLVSCMATLHLFTKIRPELMVQYTMTLQPYLNIRNVNDNDTYILHYVARILEVTVPLIEHPAQNHINQLEVDMVNLIDKQGKMVLESCVACLAASVNKISHNYSLVKDCFDNYFDTL--LKYRMEKDQTKTLPQATKRRILSRGLFTVGLLCKYFDFNC--LQLGKDINI--RIFETLMFYAEDNTLSCDIRTQAISGIGFLCIRYRELLICPRLLSFYHSILMNSLENTKTEDFPNLICCVLDNIYLFLVEEDDRLRHLDSSWKNNEKKESLKEMGDMSSGTGSHIAQLYLNAILENILQPWKPVRLKAVSLVVIIIRQGLINPISSVAYLISAQTDPNPSNRGKADNELAEIDKKFSGFINMKAVQGIRTSCKLQEVLEMYNIPENRLNWCSKHMLTTPVIVRGVYDHNADIPLALNHNLYTMLRSSKQFRRSFLYALLAIFGE-LKSRISLLIYVSENLAQFPYQSQEEPLYLVHNIDIMVSSIGPHFTQQIRDQLYPELVAHEFNSDPSSNHPATKPDTIHIDDEENPEVLYKRLMDN----------------PKALRNMRESIRNSRGCVLLISLKQYLRELYSLTDA*FDFNYG***YXXXXXXXGFRKIQKYSPLDTGKAWERQLTRRNGIRFDPLVALNLTEETVAQENIYQKFVTDVQQT 7392
            ++LK +    D++Q L+ ALLDYL+ + + D +  ++R+FY  QW+ D      K +KSQ ++  + + +   +++                      I  +AE+R+   L  +  T P        ++ + L++ S+            ++DY+DACL+ RYLAS++  +QSFDIYLT+I R+L + ++A+RTKAM+CLS VV  DP+IL R D+++ VH R +D+STSVREAAVEL+G+++L RP+L +QYY M+ ERILD G SVRKRVI+I RDIC+E   F KI E+CVKMI+R+NDEE IKKLVNE FQ +WF+P    +   + +K++NITDVV++C+D GY+WF+QLL++LLK E+    + V+KAC Q+VD LV++I++ EE ++  DN+     RLV+C+ TL LF+KIRP+LMV++ MT+QPYL  +    ND  ++  VA+ILE+ VPL+EHP++  +  +E D++ LI K G  V++ CV+CL A VNK++ N+  V  CF+ Y+  +  LK + ++D   T    T +  L R LFTVG LC++FDF+    +    +NI  ++ E LM++ + +    +++T+AI G+GF  I++  L+    + + Y+SIL  S +N+      NL   VL N+  +L EED R++  D  WK   K+E LKEMGD+SSG  S I QLYL  +LE        VR  A++++ + + QGLI+P+  V YLI+  TDP P+ R KAD +L EIDKK++GFI+MKAV G++ S ++Q+           +N C    L  P  VRG     +    AL  +LY+M+R ++Q RR+FL +LL +F +  K+ +++L+Y+++NLA FPYQ+QEEPL+++H+IDI +S  G +  Q  ++ +  +    E  + P+  + +    +   ++   P    KR+                   P+    + E    S+G +LL+ LKQ+L+ L   +D+                     KIQKYSP ++ K +++ + R+ G+ F P   L+     +A      K   DV+++
Sbjct: 1630 RILKQVSGGEDEIQQLQKALLDYLDENTETDPSLVFSRKFYIAQWFRDTTLETEKAMKSQKDEESSDATHHAKELETTGQ------------------IMHRAENRKK-FLRSIIKTTP--------SQFSTLKMNSD------------TVDYDDACLIVRYLASMRPFAQSFDIYLTQILRVLGENAIAVRTKAMKCLSEVVAVDPSILARLDMQRGVHGRLMDNSTSVREAAVELLGRFVLCRPQLAEQYYDMLIERILDTGISVRKRVIKILRDICIEQPTFPKITEMCVKMIRRVNDEEGIKKLVNETFQKLWFTPTPHNDKEAMTRKILNITDVVAACRDTGYDWFEQLLQNLLKSEEDSSYKPVKKACTQLVDNLVEHILKYEESLADSDNKGVNSGRLVACITTLFLFSKIRPQLMVKHAMTMQPYLTTKCSTQNDFMVICNVAKILELVVPLMEHPSETFLATIEEDLMKLIIKYGMTVVQHCVSCLGAVVNKVTQNFKFVWACFNRYYGAISKLKSQHQEDPNNT-SLLTNKPALLRSLFTVGALCRHFDFDLEDFKGNSKVNIKDKVLELLMYFTKHSDE--EVQTKAIIGLGFAFIQHPSLMFEQEVKNLYNSIL--SDKNSSV----NLKIQVLKNLQTYLQEEDTRMQQADRDWKKVAKQEDLKEMGDVSSGMSSSIMQLYLKQVLEAFFHTQSSVRHFALNVIALTLNQGLIHPVQCVPYLIAMGTDPEPAMRNKADQQLVEIDKKYAGFIHMKAVAGMKMSYQVQQA----------INTC----LKDP--VRGFRQDESSS--ALCSHLYSMIRGNRQHRRAFLISLLNLFDDTAKTEVTMLLYIADNLACFPYQTQEEPLFIMHHIDITLSVSGSNLLQSFKESMVKD-KRKERKTSPAKENES----SESEEEVSRPRKSRKRVDSESDSDSEDDINSVMKCLPENSAPLIEFANVSQGILLLLMLKQHLKNLCGFSDS---------------------KIQKYSPSESAKVYDKAINRKTGVHFHPKQTLDFLRSDMAN----SKLTEDVKRS 2607          

HSP 2 Score: 344.739 bits (883), Expect = 2.074e-94
Identity = 210/478 (43.93%), Postives = 304/478 (63.60%), Query Frame = 1
Query: 2698 LDPSLITESTTYQHFISLVDGCLEVVEDLDLIKTMKEQTEXXXXXXXXXXXXXXREQLQAMCIEIAKLKATGSTKEVPMEKLTKILTLLMLNISSGAKVCLPVTEDG---EDNRLFKELAFERIGRSLDASFITINIMTSPDISNGVFIEDVQEAVVTSVKYQLVNLIFPEYDPAYRTVNHAKDNQSSIKAKRAREKELHKSKNIVYFYNRLVDIISNLSELVVIQTLTDNVILQLSSLGVSVFFVENISELQLVSLRLITTIFSKYEKHRNLIMDDIIASLSRLPSSKKNMRNYRLNSEDS------IQMLTAXXXXXXXXXXXXXKIEMNSNESEETALSVAPDKIVKETPKADSEAVIETSYNNAFATAYSFLRIFLHKSTVK-GEDDYRAIFENFVSDLLVTVNKPEWPAAETMLTLLGSLLTNQFINKHSDQTTRLICIDYLGTVASTLRRDAVSSTINPSDIENLIIDLIKG 4101
            L P  + +S+T++ F + ++  L+ +ED+D        T       +P ++L+ + QL  +  E AK+KA G   ++  +K  K+L +L  NI  G+K+   +  +    E+ RL+++L  ER+ +S DA   TINIMTSP++   V+IEDV E V+   K+ L N ++P+YDP YR   H     SS KAKRA+    HK + IV  YN++ DI+S+LSEL+ IQ LTD  ILQ+SS+G++ FFVEN+SELQL +++L+T +FS+YEKHR LI+++I  SL+RLP+SK+++RN+RLNS D       IQM+TAL L L+Q VV++   E + N  E++              K D + VI  SY  A  TA +FL IFL K   K GE+DYR +FENFV DLL TVNKPEWPAAE +L+LLG LL +QF NK ++   R+  +DYLGTVA+ LR+DAV+S ++   IE ++  +  G
Sbjct: 1182 LTPEEMMDSSTFKRFTASIENILDNLEDMDF-------TAFGDDDEIPQELLLGKHQLNELGSESAKIKAMGIMDKLSTDKTVKVLNILEKNIQDGSKLSTLLNHNNDTEEEERLWRDLIMERVTKSADACLTTINIMTSPNMPKAVYIEDVIERVIQYTKFHLQNTLYPQYDPVYRVDPHGGGLLSS-KAKRAK-CSTHKQRVIVMLYNKVCDIVSSLSELLEIQLLTDTTILQVSSMGITPFFVENVSELQLCAIKLVTAVFSRYEKHRQLILEEIFTSLARLPTSKRSLRNFRLNSSDVDGEPMYIQMVTALVLQLIQCVVHLPSSEKDPNSEEDS------------NKKVDQDVVITNSYETAMRTAQNFLSIFLKKCGSKQGEEDYRPLFENFVQDLLSTVNKPEWPAAELLLSLLGRLLVHQFSNKSTEMALRVASLDYLGTVAARLRKDAVTSKMDQGSIERILKQVSGG 1638          
BLAST of Nipped-B protein vs. Ensembl Mouse
Match: D1Pas1 (DNA segment, Chr 1, Pasteur Institute 1 [Source:MGI Symbol;Acc:MGI:91842])

HSP 1 Score: 286.574 bits (732), Expect = 1.226e-146
Identity = 135/237 (56.96%), Postives = 174/237 (73.42%), Query Frame = 3
Query:  510 SAINFDKYDAIPVSVTGPDYSAINVENFDELKLNPIIRNNILLASYQRPTPIQKNAIPAILEHRDIMACAQTGSGKTAAFLIPIINHLISQDLSPQ--------RYTKTA-YPKCLILAPTRELAIQILSESQKFSLNTQMRSCVVYGGADTHSQIREVQIGCHLLVATPGRLVDFIEKNKISLEMCKYIVLDEADRMLDMGFEPQIRKIIEESNMPSGINRQTLMFSATFPKEIQV 1193
            + INF+KYD IPV  TG +    ++E+F ++++  II  NI L  Y RPTP+QK+AIP I E RD+MACAQTGSGKTAAFL+PI++ + +              +Y +   YP  L+LAPTRELA+QI  E++KFS  +++R CVVYGGAD   QIR+++ GCHLLVATPGRLVD +E+ KI L+ CKY+VLDEADRMLDMGFEPQIR+I+E+  MP    R T+MFSATFPKEIQ+
Sbjct:  155 TGINFEKYDDIPVEATGNN-CPPHIESFSDVEMGEIIMGNIELTRYTRPTPVQKHAIPIIKEKRDLMACAQTGSGKTAAFLLPILSQIYTDGPGEALRAMKENGKYGRRKQYPISLVLAPTRELAVQIYEEARKFSYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQM 390          

HSP 2 Score: 256.914 bits (655), Expect = 1.226e-146
Identity = 130/217 (59.91%), Postives = 166/217 (76.50%), Query Frame = 2
Query: 1259 LAADFLYNYIFMTVGRVGSTSDSIKQEIIYMTDVEKLNYLKNIFNTTAPNTLILIFVETKKGADSLARFLLSKGYPVSSIHGDRNQGEREHALNMFRNGQCPILVATAVAARGLDIPNVKHVINYDLPSDIEEYVHRIGRTGRLGNHGRATSFYVDKNNNIAIDLVDLLKEANQIVPQWLSALADELKRNSVIGSNNKRHNQRRFKNGNFGGRDYRQ 1909
            LA DFL  YIF+ VGRVGSTS++I Q+++++ + +K ++L ++ N T  ++LIL+FVETKKGADSL  FL  +GY  +SIHGDR+Q +RE AL+ FR+G+ PILVATAVAARGLDI NVKHVIN+DLPSDIEEYVHRIGRTGR+GN G ATSF+ ++N NI  DL+DLL EA Q VP WL  +A E   +   G +  R ++ RF +G FG RDYRQ
Sbjct:  391 LARDFLDEYIFLAVGRVGSTSENITQKVVWVEEADKRSFLLDLLNATGKDSLILVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNERNINITKDLLDLLVEAKQEVPSWLENMAFE---HHYKGGSRGR-SKSRF-SGGFGARDYRQ 602          
BLAST of Nipped-B protein vs. Ensembl Mouse
Match: Ddx3x (DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 3, X-linked [Source:MGI Symbol;Acc:MGI:103064])

HSP 1 Score: 285.804 bits (730), Expect = 1.913e-144
Identity = 135/237 (56.96%), Postives = 174/237 (73.42%), Query Frame = 3
Query:  510 SAINFDKYDAIPVSVTGPDYSAINVENFDELKLNPIIRNNILLASYQRPTPIQKNAIPAILEHRDIMACAQTGSGKTAAFLIPIINHLISQDLSPQ--------RYTKTA-YPKCLILAPTRELAIQILSESQKFSLNTQMRSCVVYGGADTHSQIREVQIGCHLLVATPGRLVDFIEKNKISLEMCKYIVLDEADRMLDMGFEPQIRKIIEESNMPSGINRQTLMFSATFPKEIQV 1193
            + INF+KYD IPV  TG +    ++E+F ++++  II  NI L  Y RPTP+QK+AIP I E RD+MACAQTGSGKTAAFL+PI++ + +              RY +   YP  L+LAPTRELA+QI  E++KFS  +++R CVVYGGA+   QIR+++ GCHLLVATPGRLVD +E+ KI L+ CKY+VLDEADRMLDMGFEPQIR+I+E+  MP    R T+MFSATFPKEIQ+
Sbjct:  156 TGINFEKYDDIPVEATGNN-CPPHIESFSDVEMGEIIMGNIELTRYTRPTPVQKHAIPIIKEKRDLMACAQTGSGKTAAFLLPILSQIYADGPGEALRAMKENGRYGRRKQYPISLVLAPTRELAVQIYEEARKFSYRSRVRPCVVYGGAEIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQM 391          

HSP 2 Score: 250.366 bits (638), Expect = 1.913e-144
Identity = 130/217 (59.91%), Postives = 165/217 (76.04%), Query Frame = 2
Query: 1259 LAADFLYNYIFMTVGRVGSTSDSIKQEIIYMTDVEKLNYLKNIFNTTAPNTLILIFVETKKGADSLARFLLSKGYPVSSIHGDRNQGEREHALNMFRNGQCPILVATAVAARGLDIPNVKHVINYDLPSDIEEYVHRIGRTGRLGNHGRATSFYVDKNNNIAIDLVDLLKEANQIVPQWLSALADELKRNSVIGSNNKRHNQRRFKNGNFGGRDYRQ 1909
            LA DFL  YIF+ VGRVGSTS++I Q+++++ +++K ++L ++ N T  ++L L+FVETKKGADSL  FL  +GY  +SIHGDR+Q +RE AL+ FR+G+ PILVATAVAARGLDI NVKHVIN+DLPSDIEEYVHRIGRTGR+GN G ATSF+ ++N NI  DL+DLL EA Q VP WL  +A E   +   GS+  R    RF +G FG RDYRQ
Sbjct:  392 LARDFLDEYIFLAVGRVGSTSENITQKVVWVEEIDKRSFLLDLLNATGKDSLTLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNERNINITKDLLDLLVEAKQEVPSWLENMAFE---HHYKGSSRGRSKSSRF-SGGFGARDYRQ 604          
BLAST of Nipped-B protein vs. Ensembl Mouse
Match: Ddx4 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 4 [Source:MGI Symbol;Acc:MGI:102670])

HSP 1 Score: 250.751 bits (639), Expect = 5.116e-117
Identity = 119/227 (52.42%), Postives = 160/227 (70.48%), Query Frame = 3
Query:  510 SAINFDKYDAIPVSVTGPDYSAINVENFDELKLNPIIRNNILLASYQRPTPIQKNAIPAILEHRDIMACAQTGSGKTAAFLIPIINHLISQDLSPQRYTKTAYPKCLILAPTRELAIQILSESQKFSLNTQMRSCVVYGGADTHSQIREVQIGCHLLVATPGRLVDFIEKNKISLEMCKYIVLDEADRMLDMGFEPQIRKIIEESNMPSGINRQTLMFSATFPKEIQ 1190
            + INFDKYD I V V+G D +   +  F+E  L   + NNI  A Y + TP+QK +IP +L  RD+MACAQTGSGKTAAFL+PI+ H++   ++  R+ +   P+C+I+APTREL  QI  E++KFS  T +R+ V+YGG      +R++  GC++L ATPGRL+D I K KI L+  KY+VLDEADRMLDMGF P+++K+I    MPS   RQTL+FSATFP+EIQ
Sbjct:  263 TGINFDKYDTILVEVSGHD-APPAILTFEEANLCQTLNNNIAKAGYTKLTPVQKYSIPIVLAGRDLMACAQTGSGKTAAFLLPILAHMMRDGITASRFKELQEPECIIVAPTRELINQIYLEARKFSFGTCVRAVVIYGGTQFGHSVRQIVQGCNILCATPGRLMDIIGKEKIGLKQVKYLVLDEADRMLDMGFGPEMKKLISCPGMPSKEQRQTLLFSATFPEEIQ 488          

HSP 2 Score: 194.126 bits (492), Expect = 5.116e-117
Identity = 98/187 (52.41%), Postives = 126/187 (67.38%), Query Frame = 2
Query: 1256 KLAADFL-YNYIFMTVGRVGSTSDSIKQEIIYMTDVEKLNYLKNIFNTTAPNTLILIFVETKKGADSLARFLLSKGYPVSSIHGDRNQGEREHALNMFRNGQCPILVATAVAARGLDIPNVKHVINYDLPSDIEEYVHRIGRTGRLGNHGRATSFY-VDKNNNIAIDLVDLLKEANQIVPQWLSALA 1810
            +LA DFL  +Y+F+ VG+VG     ++Q I+ +    K   L  I      +   ++FVETKK AD +A FL  +    +SIHGDR Q ERE AL  FR G+CP+LVAT+VAARGLDI NV+HVIN+DLPS I+EYVHRIGRTGR GN GRA SF+  D +N++A  LV +L +A Q VP WL  +A
Sbjct:  489 RLAGDFLKSSYLFVAVGQVGGACRDVQQTILQVGQYSKREKLVEILRNIG-DERTMVFVETKKKADFIATFLCQEKISTTSIHGDREQREREQALGDFRCGKCPVLVATSVAARGLDIENVQHVINFDLPSTIDEYVHRIGRTGRCGNTGRAISFFDTDSDNHLAQPLVKVLSDAQQDVPAWLEEIA 674          
BLAST of Nipped-B protein vs. Ensembl Mouse
Match: Ddx4 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 4 [Source:MGI Symbol;Acc:MGI:102670])

HSP 1 Score: 250.751 bits (639), Expect = 5.246e-117
Identity = 119/227 (52.42%), Postives = 160/227 (70.48%), Query Frame = 3
Query:  510 SAINFDKYDAIPVSVTGPDYSAINVENFDELKLNPIIRNNILLASYQRPTPIQKNAIPAILEHRDIMACAQTGSGKTAAFLIPIINHLISQDLSPQRYTKTAYPKCLILAPTRELAIQILSESQKFSLNTQMRSCVVYGGADTHSQIREVQIGCHLLVATPGRLVDFIEKNKISLEMCKYIVLDEADRMLDMGFEPQIRKIIEESNMPSGINRQTLMFSATFPKEIQ 1190
            + INFDKYD I V V+G D +   +  F+E  L   + NNI  A Y + TP+QK +IP +L  RD+MACAQTGSGKTAAFL+PI+ H++   ++  R+ +   P+C+I+APTREL  QI  E++KFS  T +R+ V+YGG      +R++  GC++L ATPGRL+D I K KI L+  KY+VLDEADRMLDMGF P+++K+I    MPS   RQTL+FSATFP+EIQ
Sbjct:  237 TGINFDKYDTILVEVSGHD-APPAILTFEEANLCQTLNNNIAKAGYTKLTPVQKYSIPIVLAGRDLMACAQTGSGKTAAFLLPILAHMMRDGITASRFKELQEPECIIVAPTRELINQIYLEARKFSFGTCVRAVVIYGGTQFGHSVRQIVQGCNILCATPGRLMDIIGKEKIGLKQVKYLVLDEADRMLDMGFGPEMKKLISCPGMPSKEQRQTLLFSATFPEEIQ 462          

HSP 2 Score: 194.126 bits (492), Expect = 5.246e-117
Identity = 98/187 (52.41%), Postives = 126/187 (67.38%), Query Frame = 2
Query: 1256 KLAADFL-YNYIFMTVGRVGSTSDSIKQEIIYMTDVEKLNYLKNIFNTTAPNTLILIFVETKKGADSLARFLLSKGYPVSSIHGDRNQGEREHALNMFRNGQCPILVATAVAARGLDIPNVKHVINYDLPSDIEEYVHRIGRTGRLGNHGRATSFY-VDKNNNIAIDLVDLLKEANQIVPQWLSALA 1810
            +LA DFL  +Y+F+ VG+VG     ++Q I+ +    K   L  I      +   ++FVETKK AD +A FL  +    +SIHGDR Q ERE AL  FR G+CP+LVAT+VAARGLDI NV+HVIN+DLPS I+EYVHRIGRTGR GN GRA SF+  D +N++A  LV +L +A Q VP WL  +A
Sbjct:  463 RLAGDFLKSSYLFVAVGQVGGACRDVQQTILQVGQYSKREKLVEILRNIG-DERTMVFVETKKKADFIATFLCQEKISTTSIHGDREQREREQALGDFRCGKCPVLVATSVAARGLDIENVQHVINFDLPSTIDEYVHRIGRTGRCGNTGRAISFFDTDSDNHLAQPLVKVLSDAQQDVPAWLEEIA 648          
BLAST of Nipped-B protein vs. UniProt/SwissProt
Match: sp|Q7PLI2|NIPB_DROME (Nipped-B protein OS=Drosophila melanogaster OX=7227 GN=Nipped-B PE=1 SV=3)

HSP 1 Score: 761.14 bits (1964), Expect = 0.000e+0
Identity = 544/1669 (32.59%), Postives = 874/1669 (52.37%), Query Frame = 1
Query: 2596 IKKSQEINHKRRERVNGLTKLSNTTKKVQLPLDMLDPSLITESTTYQHFISLVDGCLEVVEDLDLIKTMKEQTEXXXXXXXXXXXXXXREQLQAMCIEIAKLKATGSTKEVPMEKLTKILTLLMLNISSGAKVCLPVTEDGEDNRLFKELAFERIGRSLDASFITINIMTSPDISNGVFI-EDVQEAVVTSVKYQLVNLIFPEYDPAYRTVNHAKDNQSSIKAKRAREK-ELHKSKN--IVYFYNRLVDIISNLSELVVIQTLTDNVILQLSSLGVSVFFVENISELQLVSLRLITTIFSK--YEKHRNLIMDDIIASLSRLPSSKKNMRNYRL-NSEDSIQMLTAXXXXXXXXXXXX-XKIEMNSNESEETALSVAPDKIVKETPKADSEAVIETSYNNAFATAYSFLRIFLHKSTVKG-EDDYRAIFENFVSDLLVTVNKPEWPAAETMLTLLGSLLTNQFINKHSDQTTRLICIDYLGTVASTLRRDAVSSTINPSDIENLIIDLIKGSKSSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXARGTKKKNSDINHKSQYNKLLKNIDKVQILRDALLDYL--NADKFDTTAKYAREFYFGQWYTDCVKELKSQNNQAIAISXXXXXXXXXXXXXXXXXXXXXXXXXXXXISIFQKAEDRRNHLL----YKMFGTLPDESKKSKNNRINKLRIGS--NPENNRYDIRLKGSLDYEDACLVCRYLASLKSSSQSFDIYLTKICRLLHDPSVALRTKAMRCLSAVVEADPTILRRDDIEKAVHLRFLDSSTSVREAAVELVGKYLLTRPELIDQYYPMIAERILDKGTSVRKRVIRIFRDICVEHTEFSKIPEICVKMIKRINDEEAIKKLVNEVFQNMWFSPVREKEGVKLLQKVMNITDVVSSCKDIGYEWFDQLLESLLK----------------KEDSDKLRVVEKACKQIVDCLVQNIMRLEEISRDDNQRLVSCMATLHLFTKIRPELMVQYTMTLQPYLNIRNVNDNDTYILHYVARILEVTVPLIEHPAQNHINQLEVDMVNLIDKQGKMVLESCVACLAASVNKISHNYSLVKDCFDNYFDTLLKYRMEKDQTKTLPQATKRRILSRGLFTVGLLCKYFDFNC-LQLGK-------DINIRIFETLMFYAEDNTLSCDIRTQAISGIGFLCIRYRELLICPRLLSFYHSILMNSLENTKTEDFPNLICCVLDNIYLFLVEEDDRLRHLDSSWKNNEKKESLKEMGDMSSGTGSHIAQLYLNAILENILQPWKPVRLKAVSLVVIIIRQGLINPISSVAYLISAQTDPNPSNRGKADNELAEIDKKFSGFINMKAVQGIRTSCKLQEVLEMYNIPENRLNWCSKHMLTTPVIVRGVYDHNAD-IPLALNHNLYTMLRSSKQFRRSFLYALLAIFGELKSRISLLIYVSENLAQFPYQSQEEPLYLVHNIDIMVSSIGPHFTQQIRDQLYPELVAHEFNSDPSSNHPATKPDTIHIDDEENPEVLYKRLMDNPKALRNMRESIRNSRGCVLLISLKQYLRELYSLTDA*FDFNYG***YXXXXXXXGFRKIQKYSPLDTGKAWERQLTRRNGIRFDPLVALNLTEETVAQENIYQKFVTDVQQTDINLDADLYPNEGYILINKFLHLRQLVM 7476
            I   Q  +  +  RV  +T LSNT K V+          +T S TYQ FI  +D  +E+++D        E    D          IS + L +M  ++AKLKA  +   +P  KLT ++   M N+              +++    +   E++  ++DA  +  NI ++  +S+  F+ ED    ++   ++QL   IFP +DP Y           SIK    R+K + H+++N  +  FY + V+++     L       D ++L LS+L +  FFV+NI  LQ V L L+TTIF K  Y+K RN I+ DI+ S+ RLPSSKKN+R Y+L N+  +IQM+TAL L L+Q    +   +  N   S +       D+  K+  +   + ++   Y+ A +   +FL  FL+K   +  E D+R +FENF+ DLL TVNKPEWPA+E +L+LLG++L     +K  +Q+ RL+ +DYLG VA+ LR+D V S    + I+++I  +                                               +  ++K  D+   +    L     +   L+  LLD+L  NA + +    YAR FY  QWY D + + +  N+    ++                 + + + +     +   K   +R H +    +++   +    +  K   INK++  S    +N+  +  +K  +DY +A L+ +YLA+ +  SQSFD  L KI  ++++PS+A+RT+AM+CL+ +VE DP +L+R D++  V+ +FLD++ SVREAAV+LVGK++L+  +LIDQYY M++ RILD G SVRKRVI+I RDIC+E+ +FSKIPEICVKMI+R++DEE I+KLV EVF  MWF+P  + + + + +K+ +I DVV++  D G  W + LL S+ K                K++S+    +  AC+Q+ D LV  ++ LE+    DN R++ C+ TLHL  K+RP+L+V++ +T++PYLNI+  +      +  VA ILE  VPL+ + +++ +  LE  ++ L+  + +  + SCV+CL A VNKI+HN+ L++DCF  ++  L   R +  Q              R LFT+G+L +YFDF   + LG+        I   +F  LMF+      + +IR QA+  +G  C+     L    L + Y  IL +S+ N    D    I C + NI+++L E +  + + +  W+   K E LKEM D+SSG  S I QLYL  ILE  L     VRL AV ++ I++RQGL++P+  V YLI   TD    +  +AD  L +IDK +SGF+NMK   G++   KLQ++L++ N    +L            I+RG      D    ALN  LYT+LR++K  RR+ +  +   F + K+ +  ++Y+++NLA FPY  Q+EPLYL+H ID+++S  G H     ++ + P        SD   +      D          EVL+ RL   P+ L  + + I +++ C+LL+ LK +L+E+Y++TD+                     KI +YSP +  K +E+ +TR++   F+P   +++ ++ ++QE +          TDIN    L   E   L+ K+L  +QL++
Sbjct:  462 IPPEQIFSKPKMRRVERITPLSNT-KCVK--------EEVTRSQTYQQFIRNMDHIIEILDD-------SESPNFDSEDVDETIECISSKLLNSMSTDVAKLKAKQALDSIPKNKLTLLINYAMRNVYLARNY---FAGTEDEDEFVDDEVIEKLLNAMDACLLICNIYST--VSDLQFLQEDNVSHIIKFTQFQLRETIFPLHDPVY--------TAKSIKRTTHRKKIKSHQAQNRSMQLFYLKTVELLKVFVTLFDKCVFVDTIVLPLSTLAIEPFFVDNIETLQFVCLELVTTIFRKERYDKIRNSILGDILTSIDRLPSSKKNLRPYKLTNNGGNIQMVTALVLQLIQCATILPDSLCDNGKFSNKPQEGNTFDEEGKKLLQPSQDLLVLQKYDVAVSIGGNFLTTFLNKCKSRSNETDFRPLFENFIHDLLATVNKPEWPASELLLSLLGTMLVRYVSDKGIEQSIRLVSLDYLGIVAARLRKDTVESRCRVNIIDSMIQSI-----------------------------------------------KLEQEKEGDVTSNNDQFDLEPEEQRTDFLQKILLDFLAVNAQEENLIWDYARHFYLAQWYRDVIYQRRRINDGKKGLAFRKSKIRNNRRTNGDYLDTSDSGSCDESDTDTNK---KRIHCVDSNDFELNINIYKALEARKQYFINKIKPFSVFGEQNHSSNQHIKTYIDYNNAQLIAQYLATKRPFSQSFDGCLKKIILVVNEPSIAVRTRAMKCLANIVEVDPLVLKRKDMQMGVNQKFLDTAISVREAAVDLVGKFVLSNQDLIDQYYDMLSTRILDTGVSVRKRVIKILRDICLEYPDFSKIPEICVKMIRRVHDEEGIQKLVTEVFMKMWFTPCTKNDKIGIQRKINHIIDVVNTAHDTGTTWLEGLLMSIFKPRDNMLRSEGCVQEFIKKNSEPPMDIVIACQQLADGLVDRLIELEDT---DNSRMLGCITTLHLLAKVRPQLLVKHAITIEPYLNIKCHSATAAKFICAVADILEKVVPLVNNASESFLASLEEHLMLLVVSRNQAEVTSCVSCLGALVNKITHNFKLIRDCFQKFYRVLDVSRSQVIQGNNSVDNIYTPSFRRSLFTIGILMRYFDFKSPIALGETNDGLPVSICEDVFHCLMFFCR--CTNQEIRKQALISLGSFCVLNDGYLTRSELKNLYCEIL-SSIAN----DAGFKIIC-MRNIWIYLTESEMFMHNKEKEWEKQSKHEDLKEMNDVSSGMASRIIQLYLEEILECFLNRDDTVRLWAVKVIQIVLRQGLVHPVRMVPYLICLSTDHRIESAHRADALLKDIDKTYSGFVNMKVQFGLQLCFKLQKILQINN--RGKLE-----------IIRGYASRGPDNTTTALNDFLYTLLRTTKPQRRALVQTVTKQFDDQKTSLQQMLYIADNLAYFPYVVQDEPLYLIHQIDLLISMAGTHLLATFKEHIKP--------SDKEGDVLEDDDDVEDP------EVLFNRL---PEDLTEIIKCITSAQACMLLLILKDHLKEMYAITDS---------------------KISRYSPSEQ-KLYEKAVTRKSVNDFNPKTTIDVIKKQMSQEKL---------STDINF--TLTKEEKLDLVVKYLDFKQLML 1977          
BLAST of Nipped-B protein vs. UniProt/SwissProt
Match: sp|Q6KCD5|NIPBL_MOUSE (Nipped-B-like protein OS=Mus musculus OX=10090 GN=Nipbl PE=1 SV=1)

HSP 1 Score: 704.516 bits (1817), Expect = 0.000e+0
Identity = 408/1074 (37.99%), Postives = 640/1074 (59.59%), Query Frame = 1
Query: 4285 KLLKNI----DKVQILRDALLDYLNAD-KFDTTAKYAREFYFGQWYTDCV----KELKSQNNQAIAISXXXXXXXXXXXXXXXXXXXXXXXXXXXXISIFQKAEDRRNHLLYKMFGTLPDESKKSKNNRINKLRIGSNPENNRYDIRLKGSLDYEDACLVCRYLASLKSSSQSFDIYLTKICRLLHDPSVALRTKAMRCLSAVVEADPTILRRDDIEKAVHLRFLDSSTSVREAAVELVGKYLLTRPELIDQYYPMIAERILDKGTSVRKRVIRIFRDICVEHTEFSKIPEICVKMIKRINDEEAIKKLVNEVFQNMWFSPVREKEGVKLLQKVMNITDVVSSCKDIGYEWFDQLLESLLKKEDSDKLRVVEKACKQIVDCLVQNIMRLEE-ISRDDNQ-----RLVSCMATLHLFTKIRPELMVQYTMTLQPYLNIRNVNDNDTYILHYVARILEVTVPLIEHPAQNHINQLEVDMVNLIDKQGKMVLESCVACLAASVNKISHNYSLVKDCFDNYFDTL--LKYRMEKDQTKTLPQATKRRILSRGLFTVGLLCKYFDFNC--LQLGKDINI--RIFETLMFYAEDNTLSCDIRTQAISGIGFLCIRYRELLICPRLLSFYHSILMNSLENTKTEDFPNLICCVLDNIYLFLVEEDDRLRHLDSSWKNNEKKESLKEMGDMSSGTGSHIAQLYLNAILENILQPWKPVRLKAVSLVVIIIRQGLINPISSVAYLISAQTDPNPSNRGKADNELAEIDKKFSGFINMKAVQGIRTSCKLQEVLEMYNIPENRLNWCSKHMLTTPVIVRGVYDHNADIPLALNHNLYTMLRSSKQFRRSFLYALLAIFGE-LKSRISLLIYVSENLAQFPYQSQEEPLYLVHNIDIMVSSIGPHFTQQIRDQLYPELVAHEFNSDPSSNHPATKPDTIHIDDEENPEVLYKRLMDN----------------PKALRNMRESIRNSRGCVLLISLKQYLRELYSLTDA*FDFNYG***YXXXXXXXGFRKIQKYSPLDTGKAWERQLTRRNGIRFDPLVALNLTEETVAQENIYQKFVTDVQQT 7392
            ++LK +    D++Q L+ ALLDYL+ + + D +  ++R+FY  QW+ D      K +KSQ ++  + + +   +++                      I  +AE+R+   L  +  T P        ++ + L++ S+            ++DY+DACL+ RYLAS++  +QSFDIYLT+I R+L + ++A+RTKAM+CLS VV  DP+IL R D+++ VH R +D+STSVREAAVEL+G+++L RP+L +QYY M+ ERILD G SVRKRVI+I RDIC+E   F KI E+CVKMI+R+NDEE IKKLVNE FQ +WF+P    +   + +K++NITDVV++C+D GY+WF+QLL++LLK E+    + V+KAC Q+VD LV++I++ EE ++  DN+     RLV+C+ TL LF+KIRP+LMV++ MT+QPYL  +    ND  ++  VA+ILE+ VPL+EHP++  +  +E D++ LI K G  V++ CV+CL A VNK++ N+  V  CF+ Y+  +  LK + ++D   T    T +  L R LFTVG LC++FDF+    +    +NI  ++ E LM++ + +    +++T+AI G+GF  I++  L+    + + Y+SIL  S +N+      NL   VL N+  +L EED R++  D  WK   K+E LKEMGD+SSG  S I QLYL  +LE        VR  A++++ + + QGLI+P+  V YLI+  TDP P+ R KAD +L EIDKK++GFI+MKAV G++ S ++Q+           +N C    L  P  VRG     +    AL  +LY+M+R ++Q RR+FL +LL +F +  K+ +++L+Y+++NLA FPYQ+QEEPL+++H+IDI +S  G +  Q  ++ +  +    E  + P+  + +    +   ++   P    KR+                   P+    + E    S+G +LL+ LKQ+L+ L   +D+                     KIQKYSP ++ K +++ + R+ G+ F P   L+     +A      K   DV+++
Sbjct: 1630 RILKQVSGGEDEIQQLQKALLDYLDENTETDPSLVFSRKFYIAQWFRDTTLETEKAMKSQKDEESSDATHHAKELETTGQ------------------IMHRAENRKK-FLRSIIKTTP--------SQFSTLKMNSD------------TVDYDDACLIVRYLASMRPFAQSFDIYLTQILRVLGENAIAVRTKAMKCLSEVVAVDPSILARLDMQRGVHGRLMDNSTSVREAAVELLGRFVLCRPQLAEQYYDMLIERILDTGISVRKRVIKILRDICIEQPTFPKITEMCVKMIRRVNDEEGIKKLVNETFQKLWFTPTPHNDKEAMTRKILNITDVVAACRDTGYDWFEQLLQNLLKSEEDSSYKPVKKACTQLVDNLVEHILKYEESLADSDNKGVNSGRLVACITTLFLFSKIRPQLMVKHAMTMQPYLTTKCSTQNDFMVICNVAKILELVVPLMEHPSETFLATIEEDLMKLIIKYGMTVVQHCVSCLGAVVNKVTQNFKFVWACFNRYYGAISKLKSQHQEDPNNT-SLLTNKPALLRSLFTVGALCRHFDFDLEDFKGNSKVNIKDKVLELLMYFTKHSDE--EVQTKAIIGLGFAFIQHPSLMFEQEVKNLYNSIL--SDKNSSV----NLKIQVLKNLQTYLQEEDTRMQQADRDWKKVAKQEDLKEMGDVSSGMSSSIMQLYLKQVLEAFFHTQSSVRHFALNVIALTLNQGLIHPVQCVPYLIAMGTDPEPAMRNKADQQLVEIDKKYAGFIHMKAVAGMKMSYQVQQA----------INTC----LKDP--VRGFRQDESSS--ALCSHLYSMIRGNRQHRRAFLISLLNLFDDTAKTEVTMLLYIADNLACFPYQTQEEPLFIMHHIDITLSVSGSNLLQSFKESMVKD-KRKERKTSPAKENES----SESEEEVSRPRKSRKRVDSESDSDSEDDINSVMKCLPENSAPLIEFANVSQGILLLLMLKQHLKNLCGFSDS---------------------KIQKYSPSESAKVYDKAINRKTGVHFHPKQTLDFLRSDMAN----SKLTEDVKRS 2607          

HSP 2 Score: 344.739 bits (883), Expect = 1.451e-93
Identity = 210/478 (43.93%), Postives = 304/478 (63.60%), Query Frame = 1
Query: 2698 LDPSLITESTTYQHFISLVDGCLEVVEDLDLIKTMKEQTEXXXXXXXXXXXXXXREQLQAMCIEIAKLKATGSTKEVPMEKLTKILTLLMLNISSGAKVCLPVTEDG---EDNRLFKELAFERIGRSLDASFITINIMTSPDISNGVFIEDVQEAVVTSVKYQLVNLIFPEYDPAYRTVNHAKDNQSSIKAKRAREKELHKSKNIVYFYNRLVDIISNLSELVVIQTLTDNVILQLSSLGVSVFFVENISELQLVSLRLITTIFSKYEKHRNLIMDDIIASLSRLPSSKKNMRNYRLNSEDS------IQMLTAXXXXXXXXXXXXXKIEMNSNESEETALSVAPDKIVKETPKADSEAVIETSYNNAFATAYSFLRIFLHKSTVK-GEDDYRAIFENFVSDLLVTVNKPEWPAAETMLTLLGSLLTNQFINKHSDQTTRLICIDYLGTVASTLRRDAVSSTINPSDIENLIIDLIKG 4101
            L P  + +S+T++ F + ++  L+ +ED+D        T       +P ++L+ + QL  +  E AK+KA G   ++  +K  K+L +L  NI  G+K+   +  +    E+ RL+++L  ER+ +S DA   TINIMTSP++   V+IEDV E V+   K+ L N ++P+YDP YR   H     SS KAKRA+    HK + IV  YN++ DI+S+LSEL+ IQ LTD  ILQ+SS+G++ FFVEN+SELQL +++L+T +FS+YEKHR LI+++I  SL+RLP+SK+++RN+RLNS D       IQM+TAL L L+Q VV++   E + N  E++              K D + VI  SY  A  TA +FL IFL K   K GE+DYR +FENFV DLL TVNKPEWPAAE +L+LLG LL +QF NK ++   R+  +DYLGTVA+ LR+DAV+S ++   IE ++  +  G
Sbjct: 1182 LTPEEMMDSSTFKRFTASIENILDNLEDMDF-------TAFGDDDEIPQELLLGKHQLNELGSESAKIKAMGIMDKLSTDKTVKVLNILEKNIQDGSKLSTLLNHNNDTEEEERLWRDLIMERVTKSADACLTTINIMTSPNMPKAVYIEDVIERVIQYTKFHLQNTLYPQYDPVYRVDPHGGGLLSS-KAKRAK-CSTHKQRVIVMLYNKVCDIVSSLSELLEIQLLTDTTILQVSSMGITPFFVENVSELQLCAIKLVTAVFSRYEKHRQLILEEIFTSLARLPTSKRSLRNFRLNSSDVDGEPMYIQMVTALVLQLIQCVVHLPSSEKDPNSEEDS------------NKKVDQDVVITNSYETAMRTAQNFLSIFLKKCGSKQGEEDYRPLFENFVQDLLSTVNKPEWPAAELLLSLLGRLLVHQFSNKSTEMALRVASLDYLGTVAARLRKDAVTSKMDQGSIERILKQVSGG 1638          
BLAST of Nipped-B protein vs. UniProt/SwissProt
Match: sp|Q6KC79|NIPBL_HUMAN (Nipped-B-like protein OS=Homo sapiens OX=9606 GN=NIPBL PE=1 SV=2)

HSP 1 Score: 704.131 bits (1816), Expect = 0.000e+0
Identity = 407/1066 (38.18%), Postives = 637/1066 (59.76%), Query Frame = 1
Query: 4285 KLLKNI----DKVQILRDALLDYLNAD-KFDTTAKYAREFYFGQWYTDCV----KELKSQNNQAIAISXXXXXXXXXXXXXXXXXXXXXXXXXXXXISIFQKAEDRRNHLLYKMFGTLPDESKKSKNNRINKLRIGSNPENNRYDIRLKGSLDYEDACLVCRYLASLKSSSQSFDIYLTKICRLLHDPSVALRTKAMRCLSAVVEADPTILRRDDIEKAVHLRFLDSSTSVREAAVELVGKYLLTRPELIDQYYPMIAERILDKGTSVRKRVIRIFRDICVEHTEFSKIPEICVKMIKRINDEEAIKKLVNEVFQNMWFSPVREKEGVKLLQKVMNITDVVSSCKDIGYEWFDQLLESLLKKEDSDKLRVVEKACKQIVDCLVQNIMRLEE-ISRDDNQ-----RLVSCMATLHLFTKIRPELMVQYTMTLQPYLNIRNVNDNDTYILHYVARILEVTVPLIEHPAQNHINQLEVDMVNLIDKQGKMVLESCVACLAASVNKISHNYSLVKDCFDNYFDTL--LKYRMEKDQTKTLPQATKRRILSRGLFTVGLLCKYFDFNC--LQLGKDINI--RIFETLMFYAEDNTLSCDIRTQAISGIGFLCIRYRELLICPRLLSFYHSILMNSLENTKTEDFPNLICCVLDNIYLFLVEEDDRLRHLDSSWKNNEKKESLKEMGDMSSGTGSHIAQLYLNAILENILQPWKPVRLKAVSLVVIIIRQGLINPISSVAYLISAQTDPNPSNRGKADNELAEIDKKFSGFINMKAVQGIRTSCKLQEVLEMYNIPENRLNWCSKHMLTTPVIVRGVYDHNADIPLALNHNLYTMLRSSKQFRRSFLYALLAIFGE-LKSRISLLIYVSENLAQFPYQSQEEPLYLVHNIDIMVSSIGPHFTQQIRDQLYPELVAHEFNSDPSSNHPATKPDTIHIDDEENPEVLYKRLMDN----------------PKALRNMRESIRNSRGCVLLISLKQYLRELYSLTDA*FDFNYG***YXXXXXXXGFRKIQKYSPLDTGKAWERQLTRRNGIRFDPLVALNLTEETVAQENIYQK 7368
            ++LK +    D++Q L+ ALLDYL+ + + D +  ++R+FY  QW+ D      K +KSQ ++  +   +   +++                      I  +AE+R+   L  +  T P        ++ + L++ S+            ++DY+DACL+ RYLAS++  +QSFDIYLT+I R+L + ++A+RTKAM+CLS VV  DP+IL R D+++ VH R +D+STSVREAAVEL+G+++L RP+L +QYY M+ ERILD G SVRKRVI+I RDIC+E   F KI E+CVKMI+R+NDEE IKKLVNE FQ +WF+P    +   + +K++NITDVV++C+D GY+WF+QLL++LLK E+    + V+KAC Q+VD LV++I++ EE ++  DN+     RLV+C+ TL LF+KIRP+LMV++ MT+QPYL  +    ND  ++  VA+ILE+ VPL+EHP++  +  +E D++ LI K G  V++ CV+CL A VNK++ N+  V  CF+ Y+  +  LK + ++D   T    T +  L R LFTVG LC++FDF+    +    +NI  ++ E LM++ + +    +++T+AI G+GF  I++  L+    + + Y++IL  S +N+      NL   VL N+  +L EED R++  D  WK   K+E LKEMGD+SSG  S I QLYL  +LE        VR  A++++ + + QGLI+P+  V YLI+  TDP P+ R KAD +L EIDKK++GFI+MKAV G++ S ++Q+           +N C    L  P  VRG     +    AL  +LY+M+R ++Q RR+FL +LL +F +  K+ +++L+Y+++NLA FPYQ+QEEPL+++H+IDI +S  G +  Q  ++ +  +    E  S PS  + ++       ++   P    KR+  +                P+    + E    S+G +LL+ LKQ+L+ L   +D+                     KIQKYSP ++ K +++ + R+ G+ F P   L+     +A   I ++
Sbjct: 1636 RILKQVSGGEDEIQQLQKALLDYLDENTETDPSLVFSRKFYIAQWFRDTTLETEKAMKSQKDEESSEGTHHAKEIETTGQ------------------IMHRAENRKK-FLRSIIKTTP--------SQFSTLKMNSD------------TVDYDDACLIVRYLASMRPFAQSFDIYLTQILRVLGENAIAVRTKAMKCLSEVVAVDPSILARLDMQRGVHGRLMDNSTSVREAAVELLGRFVLCRPQLAEQYYDMLIERILDTGISVRKRVIKILRDICIEQPTFPKITEMCVKMIRRVNDEEGIKKLVNETFQKLWFTPTPHNDKEAMTRKILNITDVVAACRDTGYDWFEQLLQNLLKSEEDSSYKPVKKACTQLVDNLVEHILKYEESLADSDNKGVNSGRLVACITTLFLFSKIRPQLMVKHAMTMQPYLTTKCSTQNDFMVICNVAKILELVVPLMEHPSETFLATIEEDLMKLIIKYGMTVVQHCVSCLGAVVNKVTQNFKFVWACFNRYYGAISKLKSQHQEDPNNT-SLLTNKPALLRSLFTVGALCRHFDFDLEDFKGNSKVNIKDKVLELLMYFTKHSDE--EVQTKAIIGLGFAFIQHPSLMFEQEVKNLYNNIL--SDKNSSV----NLKIQVLKNLQTYLQEEDTRMQQADRDWKKVAKQEDLKEMGDVSSGMSSSIMQLYLKQVLEAFFHTQSSVRHFALNVIALTLNQGLIHPVQCVPYLIAMGTDPEPAMRNKADQQLVEIDKKYAGFIHMKAVAGMKMSYQVQQA----------INTC----LKDP--VRGFRQDESSS--ALCSHLYSMIRGNRQHRRAFLISLLNLFDDTAKTDVTMLLYIADNLACFPYQTQEEPLFIMHHIDITLSVSGSNLLQSFKESMVKD-KRKERKSSPSKENESSD----SEEEVSRPRKSRKRVDSDSDSDSEDDINSVMKCLPENSAPLIEFANVSQGILLLLMLKQHLKNLCGFSDS---------------------KIQKYSPSESAKVYDKAINRKTGVHFHPKQTLDFLRSDMANSKITEE 2609          

HSP 2 Score: 345.125 bits (884), Expect = 1.110e-93
Identity = 211/478 (44.14%), Postives = 305/478 (63.81%), Query Frame = 1
Query: 2698 LDPSLITESTTYQHFISLVDGCLEVVEDLDLIKTMKEQTEXXXXXXXXXXXXXXREQLQAMCIEIAKLKATGSTKEVPMEKLTKILTLLMLNISSGAKVCLPVTEDG---EDNRLFKELAFERIGRSLDASFITINIMTSPDISNGVFIEDVQEAVVTSVKYQLVNLIFPEYDPAYRTVNHAKDNQSSIKAKRAREKELHKSKNIVYFYNRLVDIISNLSELVVIQTLTDNVILQLSSLGVSVFFVENISELQLVSLRLITTIFSKYEKHRNLIMDDIIASLSRLPSSKKNMRNYRLNSEDS------IQMLTAXXXXXXXXXXXXXKIEMNSNESEETALSVAPDKIVKETPKADSEAVIETSYNNAFATAYSFLRIFLHKSTVK-GEDDYRAIFENFVSDLLVTVNKPEWPAAETMLTLLGSLLTNQFINKHSDQTTRLICIDYLGTVASTLRRDAVSSTINPSDIENLIIDLIKG 4101
            L P  + +S+T++ F + ++  L+ +ED+D        T       +P ++L+ + QL  +  E AK+KA G   ++  +K  K+L +L  NI  G+K+   +  +    E+ RL+++L  ER+ +S DA   TINIMTSP++   V+IEDV E V+   K+ L N ++P+YDP YR   H     SS KAKRA+    HK + IV  YN++ DI+S+LSEL+ IQ LTD  ILQ+SS+G++ FFVEN+SELQL +++L+T +FS+YEKHR LI+++I  SL+RLP+SK+++RN+RLNS D       IQM+TAL L L+Q VV++   E +SN  E++              K D + VI  SY  A  TA +FL IFL K   K GE+DYR +FENFV DLL TVNKPEWPAAE +L+LLG LL +QF NK ++   R+  +DYLGTVA+ LR+DAV+S ++   IE ++  +  G
Sbjct: 1188 LTPEEMMDSSTFKRFTASIENILDNLEDMDF-------TAFGDDDEIPQELLLGKHQLNELGSESAKIKAMGIMDKLSTDKTVKVLNILEKNIQDGSKLSTLLNHNNDTEEEERLWRDLIMERVTKSADACLTTINIMTSPNMPKAVYIEDVIERVIQYTKFHLQNTLYPQYDPVYRLDPHGGGLLSS-KAKRAK-CSTHKQRVIVMLYNKVCDIVSSLSELLEIQLLTDTTILQVSSMGITPFFVENVSELQLCAIKLVTAVFSRYEKHRQLILEEIFTSLARLPTSKRSLRNFRLNSSDMDGEPMYIQMVTALVLQLIQCVVHLPSSEKDSNAEEDS------------NKKIDQDVVITNSYETAMRTAQNFLSIFLKKCGSKQGEEDYRPLFENFVQDLLSTVNKPEWPAAELLLSLLGRLLVHQFSNKSTEMALRVASLDYLGTVAARLRKDAVTSKMDQGSIERILKQVSGG 1644          
BLAST of Nipped-B protein vs. UniProt/SwissProt
Match: sp|F5HSE3|NIPLA_DANRE (Nipped-B-like protein A OS=Danio rerio OX=7955 GN=nipbla PE=2 SV=1)

HSP 1 Score: 672.544 bits (1734), Expect = 0.000e+0
Identity = 362/892 (40.58%), Postives = 558/892 (62.56%), Query Frame = 1
Query: 4303 DKVQILRDALLDYLNAD-KFDTTAKYAREFYFGQWYTDCVKE----LKSQNNQAIAISXXXXXXXXXXXXXXXXXXXXXXXXXXXXISIFQKAEDRRNHLLYKMFGTLPDESKKSKNNRINKLRIGSNPENNRYDIRLKGSLDYEDACLVCRYLASLKSSSQSFDIYLTKICRLLHDPSVALRTKAMRCLSAVVEADPTILRRDDIEKAVHLRFLDSSTSVREAAVELVGKYLLTRPELIDQYYPMIAERILDKGTSVRKRVIRIFRDICVEHTEFSKIPEICVKMIKRINDEEAIKKLVNEVFQNMWFSPVREKEGVKLLQKVMNITDVVSSCKDIGYEWFDQLLESLLKKEDSDKLRVVEKACKQIVDCLVQNIMRLEEISRD----DNQRLVSCMATLHLFTKIRPELMVQYTMTLQPYLNIRNVNDNDTYILHYVARILEVTVPLIEHPAQNHINQLEVDMVNLIDKQGKMVLESCVACLAASVNKISHNYSLVKDCFDNYFDTLLKYRME-KDQTKTLPQATKRRILSRGLFTVGLLCKYFDFNCLQLGKDINI----RIFETLMFYA--EDNTLSCDIRTQAISGIGFLCIRYRELLICPRLLSFYHSILMNSLENTKTEDFPNLICCVLDNIYLFLVEEDDRLRHLDSSWKNNEKKESLKEMGDMSSGTGSHIAQLYLNAILENILQPWKPVRLKAVSLVVIIIRQGLINPISSVAYLISAQTDPNPSNRGKADNELAEIDKKFSGFINMKAVQGIRTSCKLQEVLEMYNIPENRLNWCSKHMLTTPVIVRGVYDHNADIPLALNHNLYTMLRSSKQFRRSFLYALLAIFGE-LKSRISLLIYVSENLAQFPYQSQEEPLYLVHNIDIMVSSIGPHFTQQIRDQL 6927
            D+ Q L+ ALLDY++ + + D    +AR+FY  QW+ DC  E    ++SQN +                 +  ++             I Q+AE R+   L+ +  + P        N+   LR+ S+            ++DY+DACL+ RYLAS +  SQSFDIYLT+I R+L + ++A+RTKAM+CLS VV  DP+IL R D+++ VH R +D+STSVREAAVEL+G+++L+RP+L +QYY M+ ERILD G SVRKRVI+I RDIC+E   FSKI E+CVKMI+R+NDEE IKKLVNE FQ +WF+P    +   + +K++NITDVVS+CKD GY+WF+QLL++LLK E+    +   KAC Q+VD LV++I++ EE   +    ++ RLV+C+ TL+LF+KIR +LMV++ MT+QPYL  +  + +D  ++  VA+ILE+ VPL++HP+++ +  +E D++ LI K G  V++ CV+CL A VNK++HNY  V  CF+ Y+  L K +++ ++ T ++  A  +  L R LFT G LC++FDF+  Q      +    ++ E L+++   ED  + C    +AI G+GFL I +   +  P + + Y+ +L +   +        L   VL N+ ++L EED R++  D  W+   K+E LKEMGD+SSG  S I QLYL  +LE+       VR  A++++ + + QGLI+P+  V YLI+  TD  P+ R KAD +L EIDKK++GFI+MKAV G++ S ++Q+ +                  +   ++RG     ++   A   +LY+M+R+++Q RR+FL +LL +F +  K  +++L+++++NLA FPYQSQEEPL+++H+IDI +S  G +  Q  ++ L
Sbjct: 1177 DETQRLQKALLDYMDENAETDPALAFARKFYIAQWFRDCTTETEKAMRSQNQK-----------------EDDSDGAQHAKELQATGDIMQRAETRKK-FLHSVVKSTP--------NQFTTLRMNSD------------TVDYDDACLIVRYLASTRPFSQSFDIYLTQILRVLGESAIAVRTKAMKCLSEVVAVDPSILARSDMQRGVHGRLMDNSTSVREAAVELLGRFVLSRPQLTEQYYDMLIERILDTGISVRKRVIKILRDICLEQPNFSKITEMCVKMIRRVNDEEGIKKLVNETFQKLWFTPTPNHDKETMNRKILNITDVVSACKDTGYDWFEQLLQNLLKSEEDSSYKPTRKACVQLVDNLVEHILKYEEALAEHKSVNSTRLVACITTLYLFSKIRAQLMVKHAMTMQPYLTTKCSSQSDFMVICNVAKILELVVPLMDHPSESFLTTIEEDLMKLILKYGMTVVQYCVSCLGAIVNKVTHNYKFVWACFNRYYGALTKLKVQHQEGTNSMALAATKAALLRSLFTAGALCRHFDFDLEQFKGTTKVVIKEKVLELLLYFTNHEDEEVKC----KAIIGLGFLFIMHPSQMFVPEVKTLYNGLLSDKRSSI------TLKIQVLKNLQMYLQEEDTRMQEADREWQKLSKQEDLKEMGDISSGMSSSIMQLYLKQVLESFFHAQSSVRHFALNVIALTLSQGLIHPVQCVPYLIAMGTDAEPTMRNKADQQLVEIDKKYTGFIHMKAVAGMKMSYQVQQAV----------------FGSAGSVIRGFRQDESNS--AQCSHLYSMVRANRQHRRAFLISLLNLFDDSSKMEVNMLLFIADNLAYFPYQSQEEPLFIMHHIDITLSVSGSNLLQTFKESL 2002          

HSP 2 Score: 308.145 bits (788), Expect = 1.569e-82
Identity = 218/566 (38.52%), Postives = 334/566 (59.01%), Query Frame = 1
Query: 2488 ENSDDISQSRAKKRKKDDDEPFEVKLKDPNEIKYPHIKKSQEINHKRRER---------------VNGLTKLSNTTKKVQLPLDMLDPSLITESTTYQHFISLVDGCLEVVEDLDLIKTMKEQTEXXXXXXXXXXXXXXREQLQAMCIEIAKLKATGSTKEVPMEKLTKILTLLMLNISSGAKVC--LPVTEDGED-NRLFKELAFERIGRSLDASFITINIMTSPDISNGVFIEDVQEAVVTSVKYQLVNLIFPEYDPAYRTVNHAKDNQSSIKAKRAREKELHKSKNIVYFYNRLVDIISNLSELVVIQTLTDNVILQLSSLGVSVFFVENISELQLVSLRLITTIFSKYEKHRNLIMDDIIASLSRLPSSKKNMRNYRLNSEDS------IQMLTAXXXXXXXXXXXXXKIEMNSNESEETALSVAPDKIVKETPKADSEAVIETSYNNAFATAYSFLRIFLHKSTVK-GEDDYRAIFENFVSDLLVTVNKPEWPAAETMLTLLGSLLTNQFINKHSDQTTRLICIDYLGTVASTLRRDAVSSTINPSDIENLIIDLIKGSKS 4110
            ++S+D   S  K+++KD D  +E + +D       H + + +       R               V    K+    +KV  P   L P  + +S+T++ F   +D  LE +ED+D   T ++  E      +P ++L+ ++QL  +  E AK+KA G T  +P +KL K+L +L  NI  GA +   + +  +GED  RL+++L  ER+ +S DA    +NIMTS  +   V+IEDV E V+   K+ L N ++P+YDP YR VN    +  S +AKRA+     K K I+  YN++ D++SN+SEL+ IQ +TD  ILQ+SS+G++ FFVEN+SELQL +++L+T +FS+YEKHR LI+++I  SL+RLP+SK+++RN+RLNS D       IQM++AL L L+Q V     + + ++   E                 D +  I  SY  A  TA +FL +FL K   K GE+DYR +FENFV DLL TVNKP+WPA+E +L+LLG LL +QF NK ++   R+  +DYLGTVA+ LR+D+V+S ++   IE +I +  +G ++
Sbjct:  643 DSSEDEEFSSRKRQRKDRDRTWEAEERD-RRSSGEHRRGNFDARRGSGSRYDDSDQDSPPPSLNEVARRLKMKQKKRKVYEP--KLTPEEMMDSSTFKRFTLSIDNILENLEDVDF--TAQDDDE------IPQELLLGKQQLNELGSESAKIKAMGITSRIPSDKLVKLLNILEKNILDGASLSTLMNLDNEGEDEERLWRDLIMERVTKSADACLTALNIMTSTHMPKAVYIEDVIERVLQYTKFHLQNTLYPQYDPVYR-VNPKGGSMLSSRAKRAK-CSTAKQKVIIMLYNKVCDVVSNISELLEIQLMTDTTILQVSSMGITPFFVENVSELQLCAIKLVTAVFSRYEKHRQLILEEIFTSLARLPTSKRSLRNFRLNSSDDEGEPIYIQMVSALVLQLIQCV-----VHLPADRDSEDDHKK-----------VDDDVFITNSYETARRTAQNFLSVFLKKCGSKQGEEDYRPLFENFVQDLLSTVNKPDWPASELLLSLLGRLLVHQFSNKQTEMALRVASLDYLGTVAARLRKDSVTSRMDQKAIERIIRENTEGDET 1179          
BLAST of Nipped-B protein vs. UniProt/SwissProt
Match: sp|F1QBY1|NIPLB_DANRE (Nipped-B-like protein B OS=Danio rerio OX=7955 GN=nipblb PE=2 SV=1)

HSP 1 Score: 669.463 bits (1726), Expect = 0.000e+0
Identity = 364/897 (40.58%), Postives = 566/897 (63.10%), Query Frame = 1
Query: 4303 DKVQILRDALLDYLNAD-KFDTTAKYAREFYFGQWY----TDCVKELKSQNNQAIAISXXXXXXXXXXXXXXXXXXXXXXXXXXXXISIFQKAEDRRNHLLYKMFGTLPDESKKSKNNRINKLRIGSNPENNRYDIRLKGSLDYEDACLVCRYLASLKSSSQSFDIYLTKICRLLHDPSVALRTKAMRCLSAVVEADPTILRRDDIEKAVHLRFLDSSTSVREAAVELVGKYLLTRPELIDQYYPMIAERILDKGTSVRKRVIRIFRDICVEHTEFSKIPEICVKMIKRINDEEAIKKLVNEVFQNMWFSPVREKEGVKLLQKVMNITDVVSSCKDIGYEWFDQLLESLLKKEDSDKLRVVEKACKQIVDCLVQNIMRLEEISRD------DNQRLVSCMATLHLFTKIRPELMVQYTMTLQPYLNIRNVNDNDTYILHYVARILEVTVPLIEHPAQNHINQLEVDMVNLIDKQGKMVLESCVACLAASVNKISHNYSLVKDCFDNYFDTLLKYRM--EKDQTKTLPQATKRRILSRGLFTVGLLCKYFDFNCLQLGKD----INIRIFETLMFYAEDNTLSCDIRTQAISGIGFLCIRYRELLICPRLLSFYHSILMNSLENTKTEDFPNLICCVLDNIYLFLVEEDDRLRHLDSSWKNNEKKESLKEMGDMSSGTGSHIAQLYLNAILENILQPWKPVRLKAVSLVVIIIRQGLINPISSVAYLISAQTDPNPSNRGKADNELAEIDKKFSGFINMKAVQGIRTSCKLQEVLEMYNIPENRLNWCSKHMLTTPVIVRGV-YDHNADIPLALNHNLYTMLRSSKQFRRSFLYALLAIFGE-LKSRISLLIYVSENLAQFPYQSQEEPLYLVHNIDIMVSSIGPHFTQQIRDQLYPE 6936
            D++Q L+ ALL+YL+ + + D    +AR+FY  QWY    T+  K +KSQ +   +   +    ++  +                   I QKAE R+  L   +         K+  ++ + LR+ S+            ++DYED+CL+ RYLAS++  +QSFDIYLT+I R+L + ++A+RTKAM+CLS VV  DP+IL R D+++ VH R +D+STSVREAAVEL+G+++L+RP+L +QYY M+ ERILD G SVRKRVI+I RDIC+E   F+K+ E+CVKMI+R+NDEE IKKLVNE FQ +WF+P    +   + +K++NITDVV++C+D GY+WF+QLL++LLK E+    +   KAC Q+VD LV++I++ EE   D       + RLV+C+ TL+LF+KIRP LMV++ MT+QPYL  +    +D  ++  VA+ILE+ VPL++HP+++ +  +E D++ LI K G  V++ CV+CL A VN+++HNY  V  CF+ Y+  L K +M  ++D   T+  + K  +L R LFTVG LC++FDF+  +        I  ++ E L+++ +++    +++T+AI G+GFL I+   L+    + + Y+++L +   +       NL   VL N+  +L EED R++  D  W    KKE LKEMGD+SSG  S I QLYL  +LE        VR  A++++ + + QGLI+P+  V YLI+  TD  P+ R KAD +L EIDKK++GFI+MKAV G++ S ++Q+ +                + +   ++RG   D ++    AL  +LYTM+R ++Q RR+FL +LL +F +  KS +++L+Y+++NLA FPYQ+QEEP++++H++DI +S  G +  Q  ++ L  E
Sbjct: 1682 DEIQQLQKALLNYLDENVETDPFLLFARKFYLAQWYRDTSTETEKAMKSQRDDDSSDGPHHAKDVETTS------------------EILQKAEARKKFLRSVI---------KTTASKFSSLRVNSD------------TVDYEDSCLIVRYLASMRPFAQSFDIYLTQILRVLGESAIAVRTKAMKCLSEVVAVDPSILARLDMQRGVHGRLMDNSTSVREAAVELLGRFVLSRPQLTEQYYDMLIERILDTGISVRKRVIKILRDICLEQPTFNKVTEMCVKMIRRVNDEEGIKKLVNETFQKLWFTPTPNHDKEAMTRKILNITDVVAACRDSGYDWFEQLLQNLLKSEEDASYKPARKACAQLVDSLVEHILKYEESLADCENKGLTSNRLVACITTLYLFSKIRPHLMVKHAMTMQPYLTTKCNTQSDFMVICNVAKILELVVPLMDHPSESFLTTIEEDLMKLIIKYGMTVVQHCVSCLGAVVNRVTHNYKFVWSCFNRYYGALSKLKMQHQEDPNSTVLVSNKPALL-RSLFTVGALCRHFDFDQEEFKGSNKVVIKDKVLELLLYFTKND--DEEVQTKAIIGLGFLFIQDPGLMFVTEVKNLYNTLLADRKTSV------NLKIQVLKNLQTYLQEEDSRMQEADREWNKLSKKEDLKEMGDISSGMSSSIMQLYLKQVLEAFFHTQSSVRHYALNVIALTLNQGLIHPVQCVPYLIAMGTDSEPTMRNKADQQLVEIDKKYTGFIHMKAVAGMKMSYQVQQAI----------------VGSKDTVIRGFRLDESS---TALCSHLYTMVRGNRQHRRAFLISLLNLFDDNTKSDVNMLLYIADNLASFPYQTQEEPMFIMHHVDITLSVSGSNLLQSFKESLLKE 2511          

HSP 2 Score: 338.576 bits (867), Expect = 1.099e-91
Identity = 209/476 (43.91%), Postives = 297/476 (62.39%), Query Frame = 1
Query: 2713 ITESTTYQHFISLVDGCLEVVEDLDLIKTMKEQTEXXXXXXXXXXXXXXREQLQAMCIEIAKLKATGSTKEVPMEKLTKILTLLMLNISSGAKVCLPVTEDGE---DNRLFKELAFERIGRSLDASFITINIMTSPDISNGVFIEDVQEAVVTSVKYQLVNLIFPEYDPAYRTVNHAKDNQSSIKAKRAREKELHKSKNIVYFYNRLVDIISNLSELVVIQTLTDNVILQLSSLGVSVFFVENISELQLVSLRLITTIFSKYEKHRNLIMDDIIASLSRLPSSKKNMRNYRLNSEDS------IQMLTAXXXXXXXXXXXXXKIEMNSNESEETALSVAPDKIVKET--PKADSEAVIETSYNNAFATAYSFLRIFLHKSTVK-GEDDYRAIFENFVSDLLVTVNKPEWPAAETMLTLLGSLLTNQFINKHSDQTTRLICIDYLGTVASTLRRDAVSSTINPSDIENLIIDLIKGS 4104
            + +S+T++ F + VD  L+ +ED+DL     ++         P ++L+ + QL  +  E AK+KA G   ++  +K+ K+ ++L  NI  GAK+   +  D +   + RL+++L  ER+ +S DA    +NIMTS  +   V+IEDV E VV   K+ L N ++P+YDP YR  +H     SS KAKRA+    HK +  V  YN++ DIISNLSEL+ IQ LTD  ILQ+SSLG++ FFVEN+SELQL +++L+T +FS+YEKHR LI+++I  SL+RLP+SK+N+RNYRLNS D       IQM+TAL L L+                 +  +++  DK   E    K D + +I  SY  A  TA +FL +FL K   K GEDDYR +FENFV DLL TVNKP+WPAAE +L+LLG LL +QF NK ++   R+  +DYLGTVA+ LR+DAV+S ++   I N I+    GS
Sbjct: 1234 MMDSSTFKRFTTSVDNILDNLEDVDLTSLDDDEI--------PQELLLGKHQLSELSSESAKIKAMGIMHKITHDKMVKVQSILEKNIQDGAKLSTLMNHDNDRDDEERLWRDLIMERVTKSADACLTALNIMTSARMPKAVYIEDVIERVVQYTKFHLQNTLYPQYDPVYRVDHHGGGTLSS-KAKRAK-CSTHKQRVTVMLYNKVCDIISNLSELLEIQLLTDTTILQISSLGITPFFVENVSELQLCAIKLVTAVFSRYEKHRQLILEEIFTSLARLPTSKRNLRNYRLNSSDVDGEPMYIQMVTALVLQLI-----------------QCVVNLPSDKDSDEENDRKVDHDVLITNSYETAMRTAQNFLSVFLKKCGSKQGEDDYRPLFENFVQDLLSTVNKPDWPAAELLLSLLGRLLVHQFSNKQTEMALRVASLDYLGTVAARLRKDAVTSKMDQRSI-NRILGENSGS 1681          
BLAST of Nipped-B protein vs. TrEMBL
Match: A0A087VXD2 (Nipped-B protein OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000060800 PE=3 SV=1)

HSP 1 Score: 1277.69 bits (3305), Expect = 0.000e+0
Identity = 810/1953 (41.47%), Postives = 1149/1953 (58.83%), Query Frame = 1
Query: 2164 DGLKTWFVGSGPQKDANGEVVDLTVNQESNWDKTLGSYSQXXXXXXXXXXXXXXXXSENSAFVFENDEEY----------------VEATNVSNNADESDSYTDVSKRTLR----------NNSINYVGMEDGVENSDD------ISQSRAKKRKKDDDEPFEVKLKDPNEIKYPHIKK-SQEINHKRRERVNGLTKLSNTTKKVQLPLDMLDPSLITESTTYQHFISLVDGCLEVVEDLDLIKTMKEQTEXXXXXXXXXXXXXXREQLQAMCIEIAKLKATGSTKEVPMEKLTKILTLLMLNISSGAKVCLPVTEDGEDNRLFKELAFERIGRSLDASFITINIMTSPDISNGVFIEDVQEAVVTSVKYQLVNLIFPEYDPAYRTVNHAKDNQSSIKAKRAREKELHKSKNIVYFYNRLVDIISNLSELVVIQTLTDNVILQLSSLGVSVFFVENISELQLVSLRLITTIFSKYEKHRNLIMDDIIASLSRLPSSKKNMRNYRLNSEDSIQMLTAXXXXXXXXXXXXXKIEMNSNE------SEETALSVAPDKIVKETP---KADSEAVIETSYNNAFATAYSFLRIFLHKSTVKGEDDYRAIFENFVSDLLVTVNKPEWPAAETMLTLLGSLLTNQFINKHSDQTTRLICIDYLGTVASTLRRDAVSSTINPSDIENLIIDLIKGSKSSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXARGTKK-KNSDINHKSQYNKLLK----NIDKVQILRDALLDYLNADKFDTTAKYAREFYFGQWYTDCVKELKSQNNQAI--AISXXXXXXXXXXXXXXXXXXXXXXXXXXXXISIFQKAEDRRNHLL---------------YKMFGTLPDESKKSK--NNRINKLRIGSNPENNRYDIRLKGSLDYEDACLVCRYLASLKSSSQSFDIYLTKICRLLHDPSVALRTKAMRCLSAVVEADPTILRRDDIEKAVHLRFLDSSTSVREAAVELVGKYLLTRPELIDQYYPMIAERILDKGTSVRKRVIRIFRDICVEHTEFSKIPEICVKMIKRINDEEAIKKLVNEVFQNMWFSPVREKEGVKLLQKVMNITD-VVSSCKDIGYEWFDQLLESLLKKEDSDKLRVVEKACKQIVDCLVQNIMRLEEISRDDNQRLVSCMATLHLFTKIRPELMVQYTMTLQPYLN---------IRNVNDNDTYILHYVARILEVTVPLIEHPAQNHINQLEVDMVNLIDKQGKMVLESCVACLAASVNKISHNYSLVKDCFDNYFDTLLKYRME------KDQTKTLPQATKRRILSRGLFTVGLLCKYFDFNCLQL---GKDINIRIFETLMFYAEDNTLSCDIRTQAISGIGFLCIRYRELLICPRLLSFYHSILMNSLEN--TKTEDFPNLICCVLDNIYLFLVEEDDRLRHLDSSWKNNEKKESLKEMGDMSSGTGSHIAQLYLNAILENILQPWKPVRLKAVSLVVIIIRQGLINPISSVAYLISAQTDPNPSNRGKADNELAEIDKKFSGFINMKAVQGIRTSCKLQEVLE--------------MYNIPENRLNWCSKHMLTTP---------------------------------VIVRGVYDHNADIPLALNHNLYTMLRSSKQFRRSFLYALLAIFGELKSRISL--LIYVSENLAQFPYQSQEEPLYLVHNIDIMVSSIGPHFTQQIRDQLYPE----LVAH-----------------------EFNSDPSSNHPATKPDTIHID------------------DEENPEVLYKRLMD-NPKALRNMRESIRNSRGCVLLISLKQYLRELYSLTDA*FDFNYG***YXXXXXXXGFRKIQKYSPLDTGKAWERQLTRRNGIRFDPLVALNLTEETVAQENIYQKFVTDVQQTDINLDADLYPNEGYILINKFLHLRQLVM 7476
            +GL+TW V    Q+++     D   ++ S WD  +   +  +  K R+  R     + +  +V END++Y                VE  ++ ++  +++    VS R+ R           +  +YVGM+   E+  D          R ++R  DDD PFEV++K+P E ++PH++K + E +   RERV+   KL N+        D++  S    +++ Q F+S +D  LE VE++DL+ +     +  +         I  E    +C + AKLK+T +  +VP ++L K+LTLL+LNI  GA V + V  D E          E+I RS+ AS I +N+MTS D+   +++EDV E  V   ++QL N I+PEYDPAYR  N AKDNQSSI+++RARE++ HKS  +V+ Y RL++I++ L+ELV IQ LTD+++L L S+GVS+FFVEN+SELQL  L+L+T +F++Y   R LI+++II  ++RLPSSK+N+R YRLNSE+SIQM TAL+LLLVQSV+ +     +S +      S E  L    +   +  P   + D E ++ +SY  A  TA++FL  FL KST KGEDDYR IFENFV+DLL+TVNKPEWPAAE ML+LLGSLL  QF NK  DQ+ R+  +DYLGTVASTLRRDAV+S +   DI  ++ +L +GS+S  EEDD+E    + +++  N       N      +       G++  K+     +S+  K L+     +DK+ +LRDA+LDYL  D+ D    YA +FY GQW  DC  E++  +  A       +   K+     K +  ++  +      +S  + AE RR +L+                K+ G +P  S  +   + +   LR+             KGS+DYEDA L+CRYLASL+  SQSFDIYL++IC+LL + SV +RTKA+RCLSAVVEADP +L R DIE AV  R +D STSVREAAV+L+G++L+ RPEL  QYYPM++ERI DKG SVRKRVIRI RDICVE  +F +I EICV++I+R+NDEE++KKLV+EVFQ +WF+PVREKE VKLL KVMNITD VVS+ KD G EW +Q LE LL KE+ +K+R  EKAC QIV+CLVQNIMRL+EI     +RLV+C+ATLHLFTKIRP L V++ M LQPYL+          +  +  D+ ILHYVARILEVT+PLIEHP++  + QLE D+V L  +QGKMVLESCVACL A VN++S NYSL  +CF  +F+ L+K R E      K     LP+  +  IL R LFTVGLLCK+FD N        K +N ++FE LMF++E      ++R  A+SG+GFLC R++ELL    L  FYH +L    ++   K+ D   L   VL+N+  F +EE+ R+   D+ WK   K+ESLK MGD++SGTGS++AQ YL  I+E    P   VRL A+S+V  I+RQGLI+P+ +V YLI+ QTD + S R KA+ +L EI+ KF GFI M+A++G+  S +LQ VL               +Y+  E  +   S+     P                                   +RG  D ++D+P ALN  LY+MLR ++  RR+FL  L+ +F EL++ ISL  L+YV++NLA FPYQ Q EPL+++H+ID++VS  G    Q +R+ L+PE    LV+                         F+ D +   P   PD+  +                   +EEN + L  R++  +   L ++ ESIR SR C+LL++LKQYL+E+Y +TD   D+ +G          +   KIQK+SP D+GK WE+QLTR++G+RF P + L    E +  +     F      T   + + +  +    L+ +F   R+L++
Sbjct:  509 EGLRTWTVKYPGQRNS-----DRNSDESSAWDAAVDRQANYLRNKRRRMTRQPTALAAD--YVLENDKDYPKPLPRRSSAEDMVATVEVGSIEDSTLDAEDPIAVSLRSSRMGLGGVSGAGASRCSYVGMDGDTEDVPDEECYKDGGSVRRRRRPDDDDAPFEVRIKEPAEQRFPHLQKVAAEHSRPVRERVH--HKLLNSYS------DVVGSSDAASASSLQKFLSHIDHVLEAVEEVDLLASGDSAGDDGVLAEAIISPSIIAE----LCRDAAKLKSTHAANQVPTDRLLKLLTLLLLNIRDGASV-IRVVGDQE--------GMEKISRSVGASLIALNLMTSKDMPREIYLEDVIEQAVQVTRFQLSNCIYPEYDPAYRIENSAKDNQSSIRSRRARERDTHKSPTVVHLYYRLLEIVTGLAELVSIQRLTDSLVLSLYSVGVSIFFVENVSELQLAGLKLVTGVFAQYPFCRKLIIEEIITGIARLPSSKRNLRTYRLNSEESIQMFTALALLLVQSVIELPTSSASSQQRVSDGVSAEDKLDSGGNATGQNAPVVHRPDDEVLVTSSYKKAIITAHNFLSAFLRKSTTKGEDDYRIIFENFVNDLLLTVNKPEWPAAEVMLSLLGSLLVQQFNNKSLDQSIRVTSVDYLGTVASTLRRDAVTSQLKEHDINVILRELTEGSQSESEEDDEEGGGGDADKKSVNEVCSSSTNSFLTTDVRKA--GEGSEDVKDMKEEKRSKMKKCLEVNLSKMDKILVLRDAVLDYLLEDESDPVVVYACKFYMGQWLEDCTTEVERAHKAAAENPSQESTHQKLGVRRGKRSKIDDTEDEKEAAALSDVELAELRRAYLMDRLRDPPSFWRARCRPKVAGMMPPTSTSASIVSKQSQALRV-----------MFKGSIDYEDAYLICRYLASLRPFSQSFDIYLSQICKLLSESSVPVRTKALRCLSAVVEADPGVLARSDIEIAVRSRLMDISTSVREAAVDLLGRFLICRPELTAQYYPMLSERIRDKGVSVRKRVIRILRDICVEQPDFPRIAEICVRIIRRVNDEESVKKLVSEVFQALWFTPVREKESVKLLHKVMNITDVVVSASKDTGIEWLEQFLEGLLTKEEGEKVRPAEKACVQIVECLVQNIMRLDEIP-GQTKRLVACLATLHLFTKIRPYLTVKHAMLLQPYLSAHVPAPGAPTQPSSHLDSLILHYVARILEVTIPLIEHPSEAFLAQLEEDLVRLTLRQGKMVLESCVACLGAVVNRVSKNYSLAMECFRGFFNALVKIRRECLTSSDKASMPKLPRELRPSIL-RSLFTVGLLCKHFDINVFSTDAEPKTLN-QVFEILMFFSERMVSDLEVRKNALSGLGFLCTRHKELLCGTPLCKFYHELLQAPTDHDVDKSADL-ELKSLVLENLLSFFMEEERRMLEQDARWKATHKEESLKVMGDVASGTGSYVAQSYLKEIMETFFSPSTSVRLTALSVVTTILRQGLIHPVQTVPYLIAMQTDSDASTRIKAEAQLQEIENKFPGFIYMRAIEGVCFSYRLQRVLHSASKISHVERKGCGVYDTSETNITTTSQSTSVKPSRRSSGCSTTDNGVSANEGNISDSVLASAYPFACPIRGARDVDSDVPSALNSQLYSMLRVNRTSRRAFLNGLINLFDELQN-ISLGRLVYVADNLAFFPYQCQAEPLFVIHHIDLLVSVNGSTRLQAVREALFPELKELLVSQASINNGLNNTNSWAVSGLEGNRLPFSKDCAGVVPNVVPDSQTVQQVVDQGTSINSTLTRLEAEEENEDALVSRILSADSTRLASICESIRASRACLLLLNLKQYLKEVYGITDRYNDY-FG--------SQLLCSKIQKFSPSDSGKLWEKQLTRKSGVRFFPALCLRSATEELRSDACGTLFAP----TKSAMHSGITHHAARDLVLEFFEFRKLIL 2402          
BLAST of Nipped-B protein vs. TrEMBL
Match: W6UEK8 (Nipped-B protein OS=Echinococcus granulosus OX=6210 GN=EGR_05825 PE=3 SV=1)

HSP 1 Score: 1271.14 bits (3288), Expect = 0.000e+0
Identity = 796/1954 (40.74%), Postives = 1138/1954 (58.24%), Query Frame = 1
Query: 2164 DGLKTWFVGSGPQKDANGEVVDLTVNQESNWDKTLGSYSQXXXXXXXXXXXXXXXXSENSAFVFENDEEY----------------VEATNVSNNADESDSYTDVSKRTLR----------NNSINYVGMEDGVENSDD------ISQSRAKKRKKDDDEPFEVKLKDPNEIKYPHIKK-SQEINHKRRERVNGLTKLSNTTKKVQLPLDMLDPSLITESTTYQHFISLVDGCLEVVEDLDLIKTMKEQTEXXXXXXXXXXXXXXREQLQAMCIEIAKLKATGSTKEVPMEKLTKILTLLMLNISSGAKVCLPVTEDGEDNRLFKELAFERIGRSLDASFITINIMTSPDISNGVFIEDVQEAVVTSVKYQLVNLIFPEYDPAYRTVNHAKDNQSSIKAKRAREKELHKSKNIVYFYNRLVDIISNLSELVVIQTLTDNVILQLSSLGVSVFFVENISELQLVSLRLITTIFSKYEKHRNLIMDDIIASLSRLPSSKKNMRNYRLNSEDSIQMLTA------XXXXXXXXXXXXXKIEMNSNESEETALSVAPDKIVKETP---KADSEAVIETSYNNAFATAYSFLRIFLHKSTVKGEDDYRAIFENFVSDLLVTVNKPEWPAAETMLTLLGSLLTNQFINKHSDQTTRLICIDYLGTVASTLRRDAVSSTINPSDIENLIIDLIKGSKSSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXARGTKK-KNSDINHKSQYNKLLK----NIDKVQILRDALLDYLNADKFDTTAKYAREFYFGQWYTDCVKELKSQNNQAI--AISXXXXXXXXXXXXXXXXXXXXXXXXXXXXISIFQKAEDRRNHLL---------------YKMFGTLPDESKKSK--NNRINKLRIGSNPENNRYDIRLKGSLDYEDACLVCRYLASLKSSSQSFDIYLTKICRLLHDPSVALRTKAMRCLSAVVEADPTILRRDDIEKAVHLRFLDSSTSVREAAVELVGKYLLTRPELIDQYYPMIAERILDKGTSVRKRVIRIFRDICVEHTEFSKIPEICVKMIKRINDEEAIKKLVNEVFQNMWFSPVREKEGVKLLQKVMNITD-VVSSCKDIGYEWFDQLLESLLKKEDSDKLRVVEKACKQIVDCLVQNIMRLEEISRDDNQRLVSCMATLHLFTKIRPELMVQYTMTLQPYLN---------IRNVNDNDTYILHYVARILEVTVPLIEHPAQNHINQLEVDMVNLIDKQGKMVLESCVACLAASVNKISHNYSLVKDCFDNYFDTLLKYRME------KDQTKTLPQATKRRILSRGLFTVGLLCKYFDFNCLQL---GKDINIRIFETLMFYAEDNTLSCDIRTQAISGIGFLCIRYRELLICPRLLSFYHSILMNSLEN--TKTEDFPNLICCVLDNIYLFLVEEDDRLRHLDSSWKNNEKKESLKEMGDMSSGTGSHIAQLYLNAILENILQPWKPVRLKAVSLVVIIIRQGLINPISSVAYLISAQTDPNPSNRGKADNELAEIDKKFSGFINMKAVQGIRTSCKLQEVLE--------------MYNIPENRLNWCSKHMLTTP---------------------------------VIVRGVYDHNADIPLALNHNLYTMLRSSKQFRRSFLYALLAIFGELKSRISL--LIYVSENLAQFPYQSQEEPLYLVHNIDIMVSSIGPHFTQQIRDQLYP---ELVAHE------------------------FNSDPSSNHPATKPDT------------------IHIDDEE-NPEVLYKRLMD-NPKALRNMRESIRNSRGCVLLISLKQYLRELYSLTDA*FDFNYG***YXXXXXXXGFRKIQKYSPLDTGKAWERQLTRRNGIRFDPLVALNLTEETVAQENIYQKFVTDVQQTDINLDADLYPNEGYILINKFLHLRQLVM 7476
            +GL+TW V    Q+++     D   ++ S WD  +   +  +  K R+  R     + +  +V END++Y                 E  ++ ++  +++    VS R+ R           +  +YVGM+   E+  D          R ++R  DDD PFEV++K+P E ++PH++K + E +   RERV+   KL N+  +V      +  S    +++ + F+S +D  LE VE++DL+ +     +  +            E    +C + AKLK+T +  +VP ++L K+LTLL+LNI  GA V + V  D E          E+I RS+ AS I +N+MTS D+   +++EDV E  V   ++QL N I+PEYDPAYR  N AKDNQSSIK++RARE++ HKS  +V+ Y RL++I++ L+ELV IQ LTD+++L L S+GVS+FFVEN+SELQL  L+L+T +F++Y   R LI+++II  ++RLPSSK+N+R YRLNSE+SIQM TA       S++ + +    S+  ++   S E  L    +   +  P   + D E ++ +SY  A  TA++FL  FL KST KGEDDYR IFENFV+DLL+TVNKPEWPAAE ML+LLGSLL  QF NK  DQ+ R+  +DYLGTVASTLRRDAV+S +   DI N+I+  +     S+ E++D+++    +  K + +     +       D      G++  K+     +S+  K L+     +DK+ +LRDA+LDYL  D+ D    YA +FY GQW  DC  E++  +  A       +   K+     K +  ++  +      +S  + AE RR +L+                K+ G +P  S  +   + +   LR+             KGS+DYEDA L+CRYLASL+  SQSFDIYL++IC+LL + SV +RTKA+RCLSAVVEADP +L R DIE AV  R +D STSVREAAV+L+G++L+ RPEL  QYYPM++ERI DKG SVRKRVIRI RDICVE  +F +I EICV++I+R+NDEE++KKLV+EVFQ +WF+PVREKE VKLL KVMNITD VVS+ KD G EW +Q LE LL KE+ +K+R  EKAC QIV+CLVQNIMRL+EI     +RLV+C+ATLHLFTKIRP L V++ M LQPYL+          +  +  D+ ILHYVARILEVT+PLIEHP++  + QLE D+V L  +QGKMVLESCVACL A VN++S NYSL  +CF  +F+ L+K R E      K     LP+  +  IL R LFTVGLLCK+FD N        K +N ++FE LMF++E      ++R  A+SG+GFLC R++ELL    L  FYH +L    ++   K+ D   L   VL+N+  F +EE+ R+   D+ WK   K+ESLK MGD++SGTGS++AQ YL  I+E    P  PVRL A+S+V  I+RQGLI+P+ +V YLI+ QTD + S R KA+ +L EI+ KF GFI M+A++G+  S +LQ VL               +Y+  E  +   S+     P                                   +RG  D ++D+P ALN  LY+MLR ++  RR+FL  L+ +F EL++ ISL  L+YV++NLA FPYQ Q EPL+++H+ID++VS  G    Q +R+ L+P   EL+A +                        F+ D +   P    D+                    ++ EE N + L  R++  +   L ++RESIR SR C+LL++LKQYL+E+Y +TD+                     KIQK+SP D+GK WE+QLTR++G+RF P + L    E +  +     F  D       + + +  +    L+ +F   R+L++
Sbjct:  509 EGLRTWTVKYPGQRNS-----DRNSDESSAWDAAVDRQANYLRNKRRRMTRQPTALAAD--YVLENDKDYPKPLPRRSSAEDMVATAEVGSIEDSTLDAEDPIAVSLRSSRMGLGGVSGAGASRCSYVGMDGDTEDVPDEECYKDGGSVRRRRRPDDDDAPFEVRIKEPAEQRFPHLQKVAAEHSRPVRERVH--HKLLNSYSEV------VGSSDAASASSLKKFLSHIDHVLEAVEEVDLLASGDSAGDDGVLAEAIISPSNIAE----LCRDAAKLKSTHAANQVPTDRLLKLLTLLLLNIRDGASV-IRVVGDQE--------GMEKISRSVGASLIALNLMTSKDMPREIYLEDVIEQAVQVTRFQLSNCIYPEYDPAYRIENSAKDNQSSIKSRRARERDTHKSPTVVHLYYRLLEIVTGLAELVSIQRLTDSLVLSLYSVGVSIFFVENVSELQLAGLKLVTGVFAQYPFCRKLIIEEIITGIARLPSSKRNLRTYRLNSEESIQMFTALALLLVQSVIELPTSSASSQQRVSDGASAEDKLDSGGNATGQNAPVVHRPDDEVLVTSSYKKAIITAHNFLSAFLRKSTTKGEDDYRIIFENFVNDLLLTVNKPEWPAAEVMLSLLGSLLVQQFNNKSLDQSIRVTSVDYLGTVASTLRRDAVTSQLKEHDI-NVILRELTEGSQSESEEEDDEEGGGGDADKKSVNEVCSSSTNSFLTTDVRKAGEGSEDVKDMKEEKRSKMKKCLEVNLSKMDKILVLRDAVLDYLLEDESDPVVVYACKFYMGQWLEDCTTEVERAHKAAAENPSQESTHQKLGVRRGKRSKIDDIEDEKEAAALSDVELAELRRAYLMDRLRDPPSVWRARCRPKVAGMMPPTSTSASIVSKQSQALRV-----------VFKGSIDYEDAYLICRYLASLRPFSQSFDIYLSQICKLLSESSVPVRTKALRCLSAVVEADPGVLARSDIEMAVRSRLMDISTSVREAAVDLLGRFLICRPELTAQYYPMLSERIRDKGVSVRKRVIRILRDICVEQPDFPRIAEICVRIIRRVNDEESVKKLVSEVFQALWFTPVREKESVKLLHKVMNITDVVVSASKDTGIEWLEQFLEGLLTKEEGEKVRPAEKACVQIVECLVQNIMRLDEIP-GQTKRLVACLATLHLFTKIRPYLTVKHAMLLQPYLSAHVPAPGAPAQPSSHLDSLILHYVARILEVTIPLIEHPSEAFLAQLEEDLVRLTLRQGKMVLESCVACLGAVVNRVSKNYSLAMECFRGFFNALVKIRRECLTSSDKASMPKLPRELRPSIL-RSLFTVGLLCKHFDINVFSTDAEPKTLN-QVFEILMFFSERMVSDLEVRKNALSGLGFLCTRHKELLCGTPLCKFYHELLQAPADHDVDKSADL-ELKSLVLENLLSFFMEEERRMLEQDARWKATHKEESLKVMGDVASGTGSYVAQSYLKEIMETFFSPSTPVRLTALSVVTTILRQGLIHPVQTVPYLIAMQTDSDASTRIKAEAQLQEIENKFPGFIYMRAIEGVCFSYRLQRVLHSASKISHVERKGCGVYDTSETNITATSQSTSVKPSRRSSGCSTTDNGVSANEGNISDSVLASVYPFACPIRGARDVDSDVPSALNSQLYSMLRVNRTSRRAFLNGLINLFDELQN-ISLGRLVYVADNLAFFPYQCQAEPLFVIHHIDLLVSVNGSTRLQAVREALFPELKELLASQASINNGLNNTNSWAVSGLEGNRLPFSKDCAGVVPNVVSDSQTVQQVVVDQGTSINATLTRLEAEEENEDALVSRILSADSTRLASIRESIRASRACLLLLNLKQYLKEVYGITDS---------------------KIQKFSPSDSGKLWEKQLTRKSGVRFFPALCLRSATEELRSDACGTLFAPDKSA----MHSGITHHTARDLVLEFFEFRKLIL 2392          
BLAST of Nipped-B protein vs. TrEMBL
Match: A0A0R3X6L1 (Nipped-B protein OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS9134 PE=3 SV=2)

HSP 1 Score: 1263.83 bits (3269), Expect = 0.000e+0
Identity = 805/1925 (41.82%), Postives = 1131/1925 (58.75%), Query Frame = 1
Query: 2164 DGLKTWFVGSGPQKDANGEVVDLTVNQESNWDKTLGSYSQXXXXXXXXXXXXXXXXSENSAFVFENDEEYVEA-----------TNVSNNADE---------------SDSYTDVSKRTLRNNSINYVGMEDGV------ENSDDISQSRAKKRKKDDDEPFEVKLKDPNEIKYPHIKKSQEINHKR--RERVNGLTKLSNTTKKVQLPLDMLDPSLITESTTYQHFISLVDGCLEVVEDLDLIKTMKEQTEXXXXXXXXXXXXXXREQLQAMCIEIAKLKATGSTKEVPMEKLTKILTLLMLNISSGAKVCLPVTEDGEDNRLFKELAFERIGRSLDASFITINIMTSPDISNGVFIEDVQEAVVTSVKYQLVNLIFPEYDPAYRTVNHAKDNQSSIKAKRAREKELHKSKNIVYFYNRLVDIISNLSELVVIQTLTDNVILQLSSLGVSVFFVENISELQLVSLRLITTIFSKYEKHRNLIMDDIIASLSRLPSSKKNMRNYRLNSEDSIQMLTAXXXXXXXXXXXXXKIEMNSNES--EETALSVAPD-------KIVKETPKADSEAVIETSYNNAFATAYSFLRIFLHKSTVKGEDDYRAIFENFVSDLLVTVNKPEWPAAETMLTLLGSLLTNQFINKHSDQTTRLICIDYLGTVASTLRRDAVSSTINPSDIENLIIDLIKGSKSSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXARGTK-----------KKNSDINHKSQYNKLLKNIDKVQILRDALLDYLNADKFDTTAKYAREFYFGQWYTDCVKELKSQNNQAI---AISXXXXXXXXXXXXXXXXXXXXXXXXXXXXISIFQKAEDRRNHLL---------------YKMFGTLPDESKKSKNNRINKLRIGSNPENNRYDIRLKGSLDYEDACLVCRYLASLKSSSQSFDIYLTKICRLLHDPSVALRTKAMRCLSAVVEADPTILRRDDIEKAVHLRFLDSSTSVREAAVELVGKYLLTRPELIDQYYPMIAERILDKGTSVRKRVIRIFRDICVEHTEFSKIPEICVKMIKRINDEEAIKKLVNEVFQNMWFSPVREKEGVKLLQKVMNITD-VVSSCKDIGYEWFDQLLESLLKKEDSDKLRVVEKACKQIVDCLVQNIMRLEEISRDDNQRLVSCMATLHLFTKIRPELMVQYTMTLQPYLNIRNVNDN---------DTYILHYVARILEVTVPLIEHPAQNHINQLEVDMVNLIDKQGKMVLESCVACLAASVNKISHNYSLVKDCFDNYFDTLLKYRME------KDQTKTLPQATKRRILSRGLFTVGLLCKYFDFNCLQL---GKDINIRIFETLMFYAEDNTLSCDIRTQAISGIGFLCIRYRELLICPRLLSFYHSILMNSLEN--TKTEDFPNLICCVLDNIYLFLVEEDDRLRHLDSSWKNNEKKESLKEMGDMSSGTGSHIAQLYLNAILENILQPWKPVRLKAVSLVVIIIRQGLINPISSVAYLISAQTDPNPSNRGKADNELAEIDKKFSGFINMKAVQGIRTSCKLQEVLEMYN-IPEN----------------------------RLNWC-------------------SKHMLTTPVIVRGVYDHNADIPLALNHNLYTMLRSSKQFRRSFLYALLAIFGELKSRISL--LIYVSENLAQFPYQSQEEPLYLVHNIDIMVSSIGPHFTQQIRDQLYPE----LVAHEFNSDPSSN-----------------------HPATKPDTIHID--------------DEENPEVLYKRLMD-NPKALRNMRESIRNSRGCVLLISLKQYLRELYSLTDA*FDFNYG***YXXXXXXXGFRKIQKYSPLDTGKAWERQLTRRNGIRFDPLVALNLTEETVAQENIYQKFVTDV 7383
            +GL+TW V    Q+++     D   ++ S WD  +   +  +  K R+  R     + +  +V END++Y +              V   A E               S S T +   T      +YVGM+D        E   D S  R +++  DDD PFEV++K+P E ++PH++K+    H R  RERV+   KL N+  +V    D         +++ + F+S +D  LE VE++DL+       +  +P           E    +C + AKLK+T +  +VP ++L K+LTLL+LNI  GA V + V  D E          E+I R++ AS I +N+MTS D+   +++EDV E  V   ++QL N I+PEYDPAYR  N AKDNQSSIK++RARE++ HKS  +V+ Y RL++I+S L+ELV IQ LTD+++L L S+GVS+FFVEN+SELQL  L+L+T +F++Y   R LI+++II  ++RLPSSK+N+R YRLNSE+SIQM TAL+LLLVQSV+ +    ++S +   + T+  +  D       +      + D E ++ +SY  A  TA++FL  FL KST KGEDDYR IFENFV+DLL+TVNKPEWPAAE ML+LLGSLL  QF NK  DQ+ R+  +DYLGTVASTLRRDAV+S +   DI  ++ +L +GS+S  EED++E D     ++   + +         + L   +++   K           KK S +N        L  +DK+ +LRDA+LDYL  D+ D    YA +FY GQW  DC  E++  +   +   +  +  +        K +   +       + IS  + AE RR +L+                K+ G +P  S  +  + ++K       ++    +  KGS+DYEDA L+CRYLASL+  SQSFD+YL++IC+LL + SV +RTKA+RCLSAVVEADP +L R DIE AV  R +D STSVREAAV+L+G++L+ RPEL  QYYPM++ERI DKG SVRKRVIRI RDICVE  +F +I EICVK+I+R+NDEE++KKLV+EVFQ +WF+PVREKE VKLL KVMNITD VVS+ KD G EW +Q LE LL KE+ +K+R  EKAC QIV+CLVQNIMRL+EI     +RLV+C+ATLHLFTKIRP L V++ M LQPYL+ R              D+ ILHYVARILEVT+PLIEHP++  + QLE D+V L  +QGKMVLESCVACL A VN++S NYSL  +CF  +F+ L+K R E      K    TLP+  +  IL R LFTVGLLCK+FD N        K +N ++FE LMF++E      ++R  A+SG+GFLC R++ELL    L  FYH +L    ++   K+ D   L   VL+N+  F +EE+ R+   D+ WK   K+ESLK MGD++SGTGS++AQ YL  I+E    P   VRL A+S+V  I+RQGLI+P+ +V+YLI+ QTD + S R KA+ +L EI+ KF GFI M+A++G+  S +LQ VL   + +P                              R + C                   S      P+  RG  D ++D+P ALN  LY+MLR ++  RR+FL  L+ +F E+++ ISL  L+YV++NLA FPYQ Q EPL+++H+ID+++S  G    Q +RD L+PE    LV+    ++ S+N                        P   PD+ H D              +EEN + L  R++  +   L  +R+S++ SR C+LL++LKQYL+E+Y +TD+                     KIQK+SP D+GK WE+QLTR++G+RF P + L    E +  +     + +DV
Sbjct:  508 EGLRTWTVKYPGQRNS-----DRNSDESSAWDAAVDRQANYLRNKRRRMTRQPTALAAD--YVLENDKDYPKPLPRRSSEENMVATVEAGATEDPTLDSEVAVATSLRSSSRTGLGVSTASAGRCSYVGMDDDTEDVLDDECYKDGSSVRRRRKPDDDDAPFEVRIKEPAEQRFPHLQKAAA-EHSRPVRERVH--HKLLNSYSEVAGSSDA------ALASSLKKFLSHIDRVLEAVEEVDLLAGGDSGGDDGVPAEAIISPSDIAE----LCRDAAKLKSTHAANQVPTDRLLKLLTLLLLNIRDGASV-VRVVGDQE--------GMEKISRAVGASLIALNLMTSKDMPREIYLEDVIEQAVQVTRFQLSNCIYPEYDPAYRIENSAKDNQSSIKSRRARERDTHKSPAVVHLYYRLLEIVSGLAELVNIQRLTDSLVLTLYSVGVSIFFVENVSELQLAGLKLVTGVFAQYPLCRKLIIEEIITGIARLPSSKRNLRTYRLNSEESIQMFTALALLLVQSVIELPVPNVSSQQRVLDGTSADIKTDNGETTIGQGASAAYRPDDEVLVTSSYKKAIITAHNFLSAFLRKSTTKGEDDYRIIFENFVNDLLLTVNKPEWPAAEVMLSLLGSLLVQQFNNKSLDQSIRVTSVDYLGTVASTLRRDAVTSQLKEHDINVILRELTEGSQSESEEDEEEKDGGNAGKKGGEDVSSTANLFLITDTLKTKEESEDVKIVRAEEKKPKNKKRSGVN--------LSKMDKILVLRDAVLDYLLEDESDPVVLYACKFYMGQWLEDCTTEVERAHKAVMENPSQESTHQKLGGVRRGKRSKIEDTECEKDGSPISDVELAESRRAYLMDRLRDPPSVWRARCRPKVAGMMPLTSTSA--SVVSK-------QSQALRVMFKGSIDYEDAYLICRYLASLRPFSQSFDVYLSQICKLLSESSVPVRTKALRCLSAVVEADPGVLARSDIEMAVRSRLMDISTSVREAAVDLLGRFLICRPELTAQYYPMLSERIRDKGVSVRKRVIRILRDICVEQPDFPRIAEICVKIIRRVNDEESVKKLVSEVFQALWFTPVREKESVKLLHKVMNITDVVVSASKDTGIEWLEQFLEGLLTKEEGEKVRPAEKACVQIVECLVQNIMRLDEIP-GQTKRLVACLATLHLFTKIRPYLTVKHAMLLQPYLSARVPTTGAPAQPSSHLDSLILHYVARILEVTIPLIEHPSETFLAQLEEDLVRLTLRQGKMVLESCVACLGAVVNRVSKNYSLAMECFRGFFNALVKIRRECLSSSDKGSMPTLPRELRPSIL-RSLFTVGLLCKHFDINVFSTDAEPKTLN-QVFEILMFFSERMVSDLEVRKNALSGLGFLCTRHKELLCGTPLCKFYHELLQAPADHDLDKSADL-ELKSLVLENLLSFFMEEERRMLEQDAKWKATHKEESLKVMGDVASGTGSYVAQSYLKEIMETFFSPSASVRLTALSVVTTILRQGLIHPVQTVSYLIAMQTDSDASTRVKAEAQLQEIENKFPGFIYMRAIEGVCFSYRLQRVLHSNSKVPHTERKGSGVHNTSESTTSSTSQSGAVKSSRRSSGCNTTDNGVATNEGDASTASASADPFANPI--RGARDVDSDVPNALNSQLYSMLRVNRTSRRAFLSGLVNLFDEMQN-ISLGRLLYVADNLAFFPYQCQAEPLFVIHHIDLLISVNGSTRLQAVRDALFPELKGLLVSQASVNNGSNNANSWIVPGSESSRLPFPKDCVVFGPNEVPDS-HTDQGNGVTAALMRVETEEENEDALVSRILSADSTRLALIRDSVKASRVCLLLLNLKQYLKEVYGITDS---------------------KIQKFSPSDSGKLWEKQLTRKSGVRFFPALCLRSAVEELRTDACDTTYPSDV 2357          
BLAST of Nipped-B protein vs. TrEMBL
Match: A0A068WWI6 (Nipped-B protein OS=Echinococcus granulosus OX=6210 GN=EgrG_000060800 PE=3 SV=1)

HSP 1 Score: 1221.07 bits (3158), Expect = 0.000e+0
Identity = 746/1728 (43.17%), Postives = 1048/1728 (60.65%), Query Frame = 1
Query: 2164 DGLKTWFVGSGPQKDANGEVVDLTVNQESNWDKTLGSYSQXXXXXXXXXXXXXXXXSENSAFVFENDEEY----------------VEATNVSNNADESDSYTDVSKRTLR----------NNSINYVGMEDGVENSDD------ISQSRAKKRKKDDDEPFEVKLKDPNEIKYPHIKK-SQEINHKRRERVNGLTKLSNTTKKVQLPLDMLDPSLITESTTYQHFISLVDGCLEVVEDLDLIKTMKEQTEXXXXXXXXXXXXXXREQLQAMCIEIAKLKATGSTKEVPMEKLTKILTLLMLNISSGAKVCLPVTEDGEDNRLFKELAFERIGRSLDASFITINIMTSPDISNGVFIEDVQEAVVTSVKYQLVNLIFPEYDPAYRTVNHAKDNQSSIKAKRAREKELHKSKNIVYFYNRLVDIISNLSELVVIQTLTDNVILQLSSLGVSVFFVENISELQLVSLRLITTIFSKYEKHRNLIMDDIIASLSRLPSSKKNMRNYRLNSEDSIQMLTAXXXXXXXXXXXXXKIEMNSNE------SEETALSVAPDKIVKETP---KADSEAVIETSYNNAFATAYSFLRIFLHKSTVKGEDDYRAIFENFVSDLLVTVNKPEWPAAETMLTLLGSLLTNQFINKHSDQTTRLICIDYLGTVASTLRRDAVSSTINPSDIENLIIDLIKGSKSSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXARGTKK-KNSDINHKSQYNKLLK----NIDKVQILRDALLDYLNADKFDTTAKYAREFYFGQWYTDCVKELKSQNNQAI--AISXXXXXXXXXXXXXXXXXXXXXXXXXXXXISIFQKAEDRRNHLL---------------YKMFGTLPDESKKSK--NNRINKLRIGSNPENNRYDIRLKGSLDYEDACLVCRYLASLKSSSQSFDIYLTKICRLLHDPSVALRTKAMRCLSAVVEADPTILRRDDIEKAVHLRFLDSSTSVREAAVELVGKYLLTRPELIDQYYPMIAERILDKGTSVRKRVIRIFRDICVEHTEFSKIPEICVKMIKRINDEEAIKKLVNEVFQNMWFSPVREKEGVKLLQKVMNITD-VVSSCKDIGYEWFDQLLESLLKKEDSDKLRVVEKACKQIVDCLVQNIMRLEEISRDDNQRLVSCMATLHLFTKIRPELMVQYTMTLQPYLN---------IRNVNDNDTYILHYVARILEVTVPLIEHPAQNHINQLEVDMVNLIDKQGKMVLESCVACLAASVNKISHNYSLVKDCFDNYFDTLLKYRME------KDQTKTLPQATKRRILSRGLFTVGLLCKYFDFNCLQL---GKDINIRIFETLMFYAEDNTLSCDIRTQAISGIGFLCIRYRELLICPRLLSFYHSILMNSLEN--TKTEDFPNLICCVLDNIYLFLVEEDDRLRHLDSSWKNNEKKESLKEMGDMSSGTGSHIAQLYLNAILENILQPWKPVRLKAVSLVVIIIRQGLINPISSVAYLISAQTDPNPSNRGKADNELAEIDKKFSGFINMKAVQGIRTSCKLQEVLE--------------MYNIPENRLNWCSKHMLTTP---------------------------------VIVRGVYDHNADIPLALNHNLYTMLRSSKQFRRSFLYALLAIFGELKSRISL--LIYVSENLAQFPYQSQEEPLYLVHNIDIMVSSIGPHFTQQIRDQLYPEL 6939
            +GL+TW V    Q+++     D   ++ S WD  +   +  +  K R+  R     + +  +V END++Y                 E  ++ ++  +++    VS R+ R           +  +YVGM+   E+  D          R ++R  DDD PFEV++K+P E ++PH++K + E +   RERV+   KL N+  +V      +  S    +++ + F+S +D  LE VE++DL+ +     +  +            E    +C + AKLK+T +  +VP ++L K+LTLL+LNI  GA V + V  D E          E+I RS+ AS I +N+MTS D+   +++EDV E  V   ++QL N I+PEYDPAYR  N AKDNQSSIK++RARE++ HKS  +V+ Y RL++I++ L+ELV IQ LTD+++L L S+GVS+FFVEN+SELQL  L+L+T +F++Y   R LI+++II  ++RLPSSK+N+R YRLNSE+SIQM TAL+LLLVQSV+ +     +S +      S E  L    +   +  P   + D E ++ +SY  A  TA++FL  FL KST KGEDDYR IFENFV+DLL+TVNKPEWPAAE ML+LLGSLL  QF NK  DQ+ R+  +DYLGTVASTLRRDAV+S +   DI N+I+  +     S+ E++D+++    +  K + +     +       D      G++  K+     +S+  K L+     +DK+ +LRDA+LDYL  D+ D    YA +FY GQW  DC  E++  +  A       +   K+     K +  ++  +      +S  + AE RR +L+                K+ G +P  S  +   + +   LR+             KGS+DYEDA L+CRYLASL+  SQSFDIYL++IC+LL + SV +RTKA+RCLSAVVEADP +L R DIE AV  R +D STSVREAAV+L+G++L+ RPEL  QYYPM++ERI DKG SVRKRVIRI RDICVE  +F +I EICV++I+R+NDEE++KKLV+EVFQ +WF+PVREKE VKLL KVMNITD VVS+ KD G EW +Q LE LL KE+ +K+R  EKAC QIV+CLVQNIMRL+EI     +RLV+C+ATLHLFTKIRP L V++ M LQPYL+          +  +  D+ ILHYVARILEVT+PLIEHP++  + QLE D+V L  +QGKMVLESCVACL A VN++S NYSL  +CF  +F+ L+K R E      K     LP+  +  IL R LFTVGLLCK+FD N        K +N ++FE LMF++E      ++R  A+SG+GFLC R++ELL    L  FYH +L    ++   K+ D   L   VL+N+  F +EE+ R+   D+ WK   K+ESLK MGD++SGTGS++AQ YL  I+E    P  PVRL A+S+V  I+RQGLI+P+ +V YLI+ QTD + S R KA+ +L EI+ KF GFI M+A++G+  S +LQ VL               +Y+  E  +   S+     P                                   +RG  D ++D+P ALN  LY+MLR ++  RR+FL  L+ +F EL++ ISL  L+YV++NLA FPYQ Q EPL+++H+ID++VS  G    Q +R+ L+PEL
Sbjct:  509 EGLRTWTVKYPGQRNS-----DRNSDESSAWDAAVDRQANYLRNKRRRMTRQPTALAAD--YVLENDKDYPKPLPRRSSAEDMVATAEVGSIEDSTLDAEDPIAVSLRSSRMGLGGVSGAGASRCSYVGMDGDTEDVPDEECYKDGGSVRRRRRPDDDDAPFEVRIKEPAEQRFPHLQKVAAEHSRPVRERVH--HKLLNSYSEV------VGSSDAASASSLKKFLSHIDHVLEAVEEVDLLASGDSAGDDGVLAEAIISPSNIAE----LCRDAAKLKSTHAANQVPTDRLLKLLTLLLLNIRDGASV-IRVVGDQE--------GMEKISRSVGASLIALNLMTSKDMPREIYLEDVIEQAVQVTRFQLSNCIYPEYDPAYRIENSAKDNQSSIKSRRARERDTHKSPTVVHLYYRLLEIVTGLAELVSIQRLTDSLVLSLYSVGVSIFFVENVSELQLAGLKLVTGVFAQYPFCRKLIIEEIITGIARLPSSKRNLRTYRLNSEESIQMFTALALLLVQSVIELPTSSASSQQRVSDGASAEDKLDSGGNATGQNAPVVHRPDDEVLVTSSYKKAIITAHNFLSAFLRKSTTKGEDDYRIIFENFVNDLLLTVNKPEWPAAEVMLSLLGSLLVQQFNNKSLDQSIRVTSVDYLGTVASTLRRDAVTSQLKEHDI-NVILRELTEGSQSESEEEDDEEGGGGDADKKSVNEVCSSSTNSFLTTDVRKAGEGSEDVKDMKEEKRSKMKKCLEVNLSKMDKILVLRDAVLDYLLEDESDPVVVYACKFYMGQWLEDCTTEVERAHKAAAENPSQESTHQKLGVRRGKRSKIDDIEDEKEAAALSDVELAELRRAYLMDRLRDPPSVWRARCRPKVAGMMPPMSTSASIVSKQSQALRV-----------VFKGSIDYEDAYLICRYLASLRPFSQSFDIYLSQICKLLSESSVPVRTKALRCLSAVVEADPGVLARSDIEMAVRSRLMDISTSVREAAVDLLGRFLICRPELTAQYYPMLSERIRDKGVSVRKRVIRILRDICVEQPDFPRIAEICVRIIRRVNDEESVKKLVSEVFQALWFTPVREKESVKLLHKVMNITDVVVSASKDTGIEWLEQFLEGLLTKEEGEKVRPAEKACVQIVECLVQNIMRLDEIP-GQTKRLVACLATLHLFTKIRPYLTVKHAMLLQPYLSAHVPAPGAPAQPSSHLDSLILHYVARILEVTIPLIEHPSEAFLAQLEEDLVRLTLRQGKMVLESCVACLGAVVNRVSKNYSLAMECFRGFFNALVKIRRECLTSSDKASMPKLPRELRPSIL-RSLFTVGLLCKHFDINVFSTDAEPKTLN-QVFEILMFFSERMVSDLEVRKNALSGLGFLCTRHKELLCGTPLCKFYHELLQAPADHDVDKSADL-ELKSLVLENLLSFFMEEERRMLEQDARWKATHKEESLKVMGDVASGTGSYVAQSYLKEIMETFFSPSTPVRLTALSVVTTILRQGLIHPVQTVPYLIAMQTDSDASTRIKAEAQLQEIENKFPGFIYMRAIEGVCFSYRLQRVLHSASKISHVERKGCGVYDTSETNITATSQSTSVKPSRRSSGCSTTDNGVSANEGNISDSVLASVYPFACPIRGARDVDSDVPSALNSQLYSMLRVNRTSRRAFLNGLINLFDELQN-ISLGRLVYVADNLAFFPYQCQAEPLFVIHHIDLLVSVNGSTRLQAVREALFPEL 2191          

HSP 2 Score: 83.1889 bits (204), Expect = 1.223e-11
Identity = 53/156 (33.97%), Postives = 86/156 (55.13%), Query Frame = 1
Query: 7012 DEENPEVLYKRLMD-NPKALRNMRESIRNSRGCVLLISLKQYLRELYSLTDA*FDFNYG***YXXXXXXXGFRKIQKYSPLDTGKAWERQLTRRNGIRFDPLVALNLTEETVAQENIYQKFVTDVQQTDINLDADLYPNEGYILINKFLHLRQLVM 7476
            +EEN + L  R++  +   L ++RESIR SR C+LL++LKQYL+E+Y +TD   D+             +   KIQK+SP D+GK WE+QLTR++G+RF P + L    E +  +     F  D       + + +  +    L+ +F   R+L++
Sbjct: 2262 EEENEDALVSRILSADSTRLASIRESIRASRACLLLLNLKQYLKEVYGITDRYGDY---------FSSQLLCSKIQKFSPSDSGKLWEKQLTRKSGVRFFPALCLRSATEELRSDACGTLFAPDKSA----MHSGITHHTARDLVLEFFEFRKLIL 2404          
BLAST of Nipped-B protein vs. TrEMBL
Match: A0A0R3VW00 (Nipped-B protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS1593 PE=3 SV=2)

HSP 1 Score: 1149.81 bits (2973), Expect = 0.000e+0
Identity = 685/1558 (43.97%), Postives = 950/1558 (60.98%), Query Frame = 1
Query: 2164 DGLKTWFVGSGPQKDANGEVVDLTVNQESNWDKTLGSYSQXXXXXXXXXXXXXXXXSENSAFVFENDEEY----------------VEATNVSNNADESDSYTDVSKRTLRNNSIN-----------YVGMEDGVENSDD------ISQSRAKKRKKDDDEPFEVKLKDPNEIKYPHIKK-SQEINHKRRERVNGLTKLSNTTKKVQLPLDMLDPSLITESTTYQHFISLVDGCLEVVEDLDLIKTMKEQTEXXXXXXXXXXXXXXREQLQAMCIEIAKLKATGSTKEVPMEKLTKILTLLMLNISSGAKVCLPVTEDGEDNRLFKELAFERIGRSLDASFITINIMTSPDISNGVFIEDVQEAVVTSVKYQLVNLIFPEYDPAYRTVNHAKDNQSSIKAKRAREKELHKSKNIVYFYNRLVDIISNLSELVVIQTLTDNVILQLSSLGVSVFFVENISELQLVSLRLITTIFSKYEKHRNLIMDDIIASLSRLPSSKKNMRNYRLNSEDSIQMLTAXXX---------XXXXXXXXXXKIEMNSNESEETALSVAPDKIVKETPKADSEAVIETSYNNAFATAYSFLRIFLHKSTVKGEDDYRAIFENFVSDLLVTVNKPEWPAAETMLTLLGSLLTNQFINKHSDQTTRLICIDYLGTVASTLRRDAVSSTINPSDIENLIIDLIKGSKSSXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-----XXXXXXXXXXARGTKKKNSDINHKSQYNKLLKNIDKVQILRDALLDYLNADKFDTTAKYAREFYFGQWYTDCVKELKSQNNQAI---AISXXXXXXXXXXXXXXXXXXXXXXXXXXXXISIFQKAEDRRNHLL---------------YKMFGTLPDESKKSK--NNRINKLRIGSNPENNRYDIRLKGSLDYEDACLVCRYLASLKSSSQSFDIYLTKICRLLHDPSVALRTKAMRCLSAVVEADPTILRRDDIEKAVHLRFLDSSTSVREAAVELVGKYLLTRPELIDQYYPMIAERILDKGTSVRKRVIRIFRDICVEHTEFSKIPEICVKMIKRINDEEAIKKLVNEVFQNMWFSPVREKEGVKLLQKVMNITD-VVSSCKDIGYEWFDQLLESLLKKEDSDKLRVVEKACKQIVDCLVQNIMRLEEISRDDNQRLVSCMATLHLFTKIRPELMVQYTMTLQPYLNIRNVNDN---------DTYILHYVARILEVTVPLIEHPAQNHINQLEVDMVNLIDKQGKMVLESCVACLAASVNKISHNYSLVKDCFDNYFDTLLKYRME------KDQTKTLPQATKRRILSRGLFTVGLLCKYFDFNCLQLGKDINI--RIFETLMFYAEDNTLSCDIRTQAISGIGFLCIRYRELLICPRLLSFYHSILMNSLEN--TKTEDFPNLICCVLDNIYLFLVEEDDRLRHLDSSWKNNEKKESLKEMGDMSSGTGSHIAQLYLNAILENILQPWKPVRLKAVSLVVIIIRQGLINPISSVAYLISAQTDPNPSNRGKADNELAEIDKKFSGFINMKAVQGIRTSCKLQEVL 6573
            +GL+TW V    Q+++     D   ++ S WD  +   +  +  K R+  R     + +  +V END++Y                VEA  V +   +++    VS R+     +            Y GM+D  E++ D          R +++  DDD PFEV++K+P E ++PH++K + E +   RERV+   KL N+  +V   +   D +L   +++ + F+S +D  LE VE++DL+       +  +P           E    +C ++AKLK+T +  +VP ++L K+LTLL+LNI  GA V L V  D E          E+I RS+ AS I +N+MTS D+   +++EDV E  V   + QL N I+PEYDPAYR  N AKDNQSSIK++RARE++ HKS  +V+ Y RL++I+S L+ELV +Q LTD+++L L S+GVS+FFVEN+SELQL  L+L+T IF++Y   R LI+++II  ++RLPSSK+N+R YRLNSE+SIQM TAL+L                     +  S ES+  +      +      + D E ++ +SY  A  TA++FL  FL KST KGEDDYR IFENFV+DLL+TVNKPEWPAAE ML+LLGSLL  QF NK  DQ+ R+  +DYLGTVASTLRRDAV+S +   DI  ++ +L +GS+S  E++ DE+       +K   ++             ++  +  ++    K++      K +    L  +DK+ +LRDA+LDYL  D+ D    YA +FY GQW  DC  E++  +  A    +  +  +        K    ++         IS  + AE RR +L+                K+ G +P  S  +   + +   LR+             KGS+DYEDA L+CRYLASL+  SQSFD+YL++IC+LL + SV +RTKA+RCLSAVVEADP +L R DIE AV  R +D STSVREAAV+L+G++L+ RPEL  QYYPM++ERI DKG SVRKRVIRI RDICVE  +F +I EICVK+I+R+NDEE++KKLV+EVFQ +WF+PVREKE VKLL KV NITD VVS+ KD G EW +Q LE LL KE+ +K+R  EKAC QIV+CLVQNI+RL+EIS    +RLV+C+ATLHLFTKIRP L V++ M LQPYL+ R              D+ ILHYVARILEVT+PLIEHP++  + QLE D+V L  +QGKMVLESCVACL A VN++S NYSL  +CF  +F+ L+K R E      K     LP+  +  IL R LFTVGLLCK+FD N      +     ++F+ LMF++E      ++R  A+SG+GFLC R++ELL    L  FYH +L    ++   K  D   L   VL+N+  F +EE+ R+   D+ WK   K+ESLK MGD++SGTGS++AQ YL  I+E    P   VRL A+S+V  I+RQGLI+P+ +V YLI+ QTDP+ S R KA+ +L EI+ KF GFI M+A++G+  S +LQ VL
Sbjct:  507 EGLRTWTVKYPGQRNS-----DRNSDESSAWDAAVDRQANYLRNKRRRMTRQPTALAAD--YVLENDKDYPKPLPRRSSDEDMVATVEADGVEDPTFDAEDAVAVSLRSSSRTGLGGVSAASAGRCSYAGMDDDTEDAPDEECYKDGGSVRRRRKPDDDDAPFEVRIKEPAEQRFPHLQKVTAEHSRPVRERVH--HKLLNSYSEV---VGSSDAAL---ASSLRKFLSHIDRVLEAVEEVDLLAGGDSAGDDGVPAEAIISPSDIAE----LCRDVAKLKSTHAANQVPTDRLLKLLTLLLLNIRDGASVVL-VAGDQE--------GMEKISRSVGASLIALNLMTSKDMPREIYLEDVIEQAVQVTRSQLSNCIYPEYDPAYRIENSAKDNQSSIKSRRARERDTHKSPAVVHLYYRLLEIVSGLAELVNVQRLTDSLVLTLYSVGVSIFFVENVSELQLAGLKLVTGIFAQYPLCRKLIIEEIITGIARLPSSKRNLRTYRLNSEESIQMFTALALLLVQSVIELPTSSVSSQQRVSDGASAESKPDSSDNTTGQDASAAHRPDDEVLVTSSYKKAIITAHNFLSAFLRKSTTKGEDDYRIIFENFVNDLLLTVNKPEWPAAEVMLSLLGSLLVQQFNNKSLDQSIRVTSVDYLGTVASTLRRDAVTSQLKEHDINVILRELTEGSQSESEDEGDEEGGGGDTGKKGVGEDFSSTASPFLNTDALKAEEGSENVNAAKREEQKPKTKRRLEVNLSKMDKILVLRDAVLDYLLEDESDPVVVYACKFYMGQWLEDCTTEVERAHKAATENPSQESTHQKLGGIRRGKRGKIDDAEGEKEAAAISDVELAELRRAYLMDRLRDPPSVWRARCRPKVAGMMPLTSASASIVSKQSQALRV-----------MFKGSIDYEDAYLICRYLASLRPFSQSFDVYLSQICKLLSESSVPVRTKALRCLSAVVEADPGVLARSDIEMAVRSRLMDISTSVREAAVDLLGRFLICRPELTAQYYPMLSERIRDKGVSVRKRVIRILRDICVEQPDFPRIAEICVKIIRRVNDEESVKKLVSEVFQALWFTPVREKESVKLLHKVRNITDVVVSASKDTGIEWLEQFLEGLLTKEEGEKIRPAEKACVQIVECLVQNIIRLDEIS-GQPKRLVACLATLHLFTKIRPYLTVKHAMLLQPYLSARVPATGATSQPSSHLDSLILHYVARILEVTIPLIEHPSETFLAQLEEDLVRLTLRQGKMVLESCVACLGAVVNRVSKNYSLAMECFRGFFNALVKIRRECFTSSDKGSMLMLPRELRPSIL-RSLFTVGLLCKHFDINVFSTDAEPKTLDQVFDILMFFSERMVSDLEVRKNALSGLGFLCTRHKELLCGTPLCKFYHELLQAPADHDVDKPADL-ELKSLVLENLLSFFLEEERRMLEQDAKWKATHKEESLKVMGDVASGTGSYVAQSYLKEIMETFFSPSASVRLTALSVVTTILRQGLIHPVQTVPYLIAMQTDPDASTRVKAEAQLQEIENKFPGFIYMRAIKGVCFSYRLQRVL 2022          

HSP 2 Score: 154.066 bits (388), Expect = 4.321e-33
Identity = 103/276 (37.32%), Postives = 154/276 (55.80%), Query Frame = 1
Query: 6643 VRGVYDHNADIPLALNHNLYTMLRSSKQFRRSFLYALLAIFGELKSRISL--LIYVSENLAQFPYQSQEEPLYLVHNIDIMVSSIGPHFTQQIRDQLYPEL----------------------VAHEFNSDP-SSNHPATKPDTIH---------ID--------------DEENPEVLYKRLMD-NPKALRNMRESIRNSRGCVLLISLKQYLRELYSLTDA*FDFNYG***YXXXXXXXGFRKIQKYSPLDTGKAWERQLTRRNGIRFDPLVAL 7323
            +RG  D ++D+P ALN  LY+MLR ++  RR+FL  L+ +F E+++ ISL  L+YV++NLA FPYQ Q EPL+++H+ID++VS  G    Q +R+ L+PEL                         E N  P S +   + PD I          ID              +EEN + L  R++  +   L ++RESI+ SR C+LL++LKQYL+E+Y +TD    +N+           +   KIQK+SP D+GK WE+QLTR++G+RF P + L
Sbjct: 2093 IRGARDVDSDVPNALNSQLYSMLRVNRTSRRAFLNGLINLFDEMQN-ISLGKLVYVADNLAFFPYQCQAEPLFVIHHIDLLVSVNGSTRLQAVREALFPELKELLVSQTSVNNGLNSTNSWVVPGLESNRSPFSKDCAGSGPDEISGSQTVQQFVIDQGTSINATLMRLGAEEENEDALVSRILSADSTRLASIRESIKASRACLLLLNLKQYLKEVYGITDR---YNH------VFSSQLLCSKIQKFSPSDSGKLWEKQLTRKSGVRFFPALCL 2358          
BLAST of Nipped-B protein vs. Ensembl Cavefish
Match: nipblb (NIPBL cohesin loading factor [Source:NCBI gene;Acc:103029793])

HSP 1 Score: 702.59 bits (1812), Expect = 0.000e+0
Identity = 414/1064 (38.91%), Postives = 625/1064 (58.74%), Query Frame = 1
Query: 4303 DKVQILRDALLDYLNAD-KFDTTAKYAREFYFGQWYTDCVKE----LKSQNNQAIAISXXXXXXXXXXXXXXXXXXXXXXXXXXXXISIFQKAEDRRNHLLYKMFGTLPDESKKSKNNRINKLRIGSNPENNRYDIRLKGSLDYEDACLVCRYLASLKSSSQSFDIYLTKICRLLHDPSVALRTKAMRCLSAVVEADPTILRRDDIEKAVHLRFLDSSTSVREAAVELVGKYLLTRPELIDQYYPMIAERILDKGTSVRKRVIRIFRDICVEHTEFSKIPEICVKMIKRINDEEAIKKLVNEVFQNMWFSPVREKEGVKLLQKVMNITDVVSSCKDIGYEWFDQLLESLLKKEDSDKLRVVEKACKQIVDCLVQNIMRLEEISRD------DNQRLVSCMATLHLFTKIRPELMVQYTMTLQPYLNIRNVNDNDTYILHYVARILEVTVPLIEHPAQNHINQLEVDMVNLIDKQGKMVLESCVACLAASVNKISHNYSLVKDCFDNYFDTL--LKYRMEKDQTKTLPQATKRRILSRGLFTVGLLCKYFDFNCLQLGKD----INIRIFETLMFYAEDNTLSCDIRTQAISGIGFLCIRYRELLICPRLLSFYHSILMNSLENTKTEDFPNLICCVLDNIYLFLVEEDDRLRHLDSSWKNNEKKESLKEMGDMSSGTGSHIAQLYLNAILENILQPWKPVRLKAVSLVVIIIRQGLINPISSVAYLISAQTDPNPSNRGKADNELAEIDKKFSGFINMKAVQGIRTSCKLQEVLEMYNIPENRLNWCSKHMLTTPVIVRGV-YDHNADIPLALNHNLYTMLRSSKQFRRSFLYALLAIFGE-LKSRISLLIYVSENLAQFPYQSQEEPLYLVHNIDIMVSSIGPHFTQQIRDQLYPELVAHEFNSDPSSN-----------------------------HPATKPD--TIHID-----DEENPEVLYKRLMDNPKALRNMRESIRNSRGCVLLISLKQYLRELYSLTDA*FDFNYG***YXXXXXXXGFRKIQKYSPLDTGKAWERQLTRRNGIRFDPLVALNL 7329
            D+ Q L+ ALLDYLN +   D +  ++R+FY  QW+ D   E    +KSQN +    S         +T                   I Q+AE R+   L  +  T P        ++   L++ S+            ++DY+DACLV RYLAS++  +QSFDIYLT+I R+L + ++A+RTKAM+CLS VV  DP+IL R D+++ VH R +D+STSVREAAVELVG+++L+RP+L +QYY M+ ERILD G SVRKRVI+I RDIC+E   F+KI E+CVKMI+R+NDEE IKKLVNE FQ +WF+P    +   + +K++NITDVVS+CKD GY+WF+QLL++LLK E+    +   KAC Q+VD LV++I++ EE   D      ++ RLVSC+ TL+LF+K R +LMV++ MT+QPYL  +  N ND  ++  VA+ILE+ VPL++HP++  +  +E D++ LI K G  V++ CV+CL A VNK++HNY  V  CF+ Y+  L  LK + ++D   T+  + K  +L R LFTVG LC++FDF+      +    I  ++ E L+++ ++     +++++AI G+GFL I++  L+  P + + Y+ +L +   +       NL   VL N+  +L EED R++  D  WK   K+E LKEMGD+SSG  S I QLYL  +LE        VR  A++++ + + QGLI+P+  V YLI+  TDP P+ R KAD +L EIDKK++GFI+MKAV G++ S ++Q+ +                M +   I+RG   D N+    AL  +L+TM+R ++Q RR+FL +LL +F +  K+ +++L+++++NLA FP+QSQEEPL+++H+IDI +S  G +  Q  ++ L  E    E                                     H A +P     ++D     D E+ E +  RL DNP  L +   +   S+G +LL+ LKQ+L+ LY  +D+                     KIQKYSP ++ K +++ + R+N + F+P   L  
Sbjct: 1567 DETQQLQKALLDYLNENIDTDPSLVFSRKFYIAQWFRDSTTETEKAMKSQNQKDDDSSEGQHHTKDVETTG----------------EIMQRAEARKK-FLRSIIKTTP--------SQFTTLKMNSD------------TVDYDDACLVVRYLASMRPFAQSFDIYLTQILRVLGESAIAVRTKAMKCLSEVVAVDPSILARLDMQRGVHGRLMDNSTSVREAAVELVGRFVLSRPQLTEQYYDMLIERILDTGISVRKRVIKILRDICLEQPTFNKITEMCVKMIRRVNDEEGIKKLVNETFQKLWFTPTPNHDKEAMTRKILNITDVVSACKDSGYDWFEQLLQNLLKTEEDASYKPARKACAQLVDNLVEHILKYEEAPDDCENKGGNSNRLVSCITTLYLFSKNRAQLMVKHAMTMQPYLTTKCNNQNDFMVICNVAKILELVVPLMDHPSETFLTTIEEDLMKLIIKYGMTVVQHCVSCLGAVVNKVTHNYKFVWACFNRYYGALNKLKTQHQEDSNSTVLVSNKPALL-RSLFTVGALCRHFDFDLEDFKGNNKVVIKDKVLELLLYFTKNE--DEEVQSKAIIGLGFLFIQHPGLMFVPEVKTLYNGLLSDRKTSV------NLKIQVLKNLQTYLQEEDTRMQEADREWKKLSKQEDLKEMGDISSGMSSSIMQLYLKQVLEAFFHTQSSVRHFALNVIALTLNQGLIHPVQCVPYLIAMGTDPEPTMRNKADQQLVEIDKKYTGFIHMKAVAGMKMSYQVQQAI----------------MASKDTIIRGFRQDENSS---ALCSHLFTMVRGNRQHRRAFLISLLNLFDDSAKTEVNMLLFIADNLACFPFQSQEEPLFIMHHIDITLSVSGSNLLQSFKESLLKEPRPREKKRKKKKVREKKYSSDEEDEDESSSSSSSSSDEDEVVHRAKRPKRAAANVDSDSDLDVEDVEKVMDRLPDNPLPLLDFANA---SQGILLLLVLKQHLKNLYGFSDS---------------------KIQKYSPTESAKVYDKAVNRKNNVHFNPRQTLEF 2541          

HSP 2 Score: 337.806 bits (865), Expect = 2.383e-92
Identity = 209/472 (44.28%), Postives = 301/472 (63.77%), Query Frame = 1
Query: 2698 LDPSLITESTTYQHFISLVDGCLEVVEDLDLIKTMKEQTEXXXXXXXXXXXXXXREQLQAMCIEIAKLKATGSTKEVPMEKLTKILTLLMLNISSGAKVCLPVTE--DGEDN-RLFKELAFERIGRSLDASFITINIMTSPDISNGVFIEDVQEAVVTSVKYQLVNLIFPEYDPAYRTVNHAKDNQSSIKAKRAREKELHKSKNIVYFYNRLVDIISNLSELVVIQTLTDNVILQLSSLGVSVFFVENISELQLVSLRLITTIFSKYEKHRNLIMDDIIASLSRLPSSKKNMRNYRLNSEDS------IQMLTAXXXXXXXXXXXXXKIEMNSNESEETALSVAPDKIVKETPKADSEAVIETSYNNAFATAYSFLRIFLHKSTVK-GEDDYRAIFENFVSDLLVTVNKPEWPAAETMLTLLGSLLTNQFINKHSDQTTRLICIDYLGTVASTLRRDAVSSTINPSDIENLI 4083
            L P  + +S+T++ F + VD  LE +ED+DL     +         +P ++L+ + QL  +  E AK+KA G T  +  EKL K+L +L  NI  G+K+   +    D ED  RL+++L  ER+ +S DA    +NIMTS  +   V+IEDV E V+   K+ L N ++P+YDP YR   H     SS KAKRA+    HK + IV  YN++ DI+SN+SEL+ IQ LTD  ILQ+SS+G++ FFVEN+SELQL +++L+T +FS+YEKHR LI+++I  SL+RLP+SK+++RN+RLNS D       IQM+TAL L L+Q VV++   + N+++  +               K D + +I  SY  A  TA +FL +FL K   K GE+DYR +FENFV DLL TVNKPEWPAAE +L+LLG LL +QF NK ++   R+  +DYLGTVA+ LR+DAV+S ++   I+ ++
Sbjct: 1112 LTPEEMMDSSTFKRFTASVDNILENLEDVDLSLAADDD-------EIPQELLLGKHQLSELGSESAKIKAMGITYRISSEKLVKVLGILEKNIQDGSKLSTLMNHGNDAEDEERLWRDLIMERVTKSADACLTALNIMTSTRMPKAVYIEDVIERVLQYTKFHLQNTLYPQYDPVYRVGPHGGGMLSS-KAKRAK-CSTHKQRVIVMLYNKVCDIVSNISELLEIQLLTDTTILQVSSMGITPFFVENVSELQLCAIKLVTAVFSRYEKHRQLILEEIFTSLARLPTSKRSLRNFRLNSSDVDGEPMYIQMVTALVLQLIQCVVHLPNDKDNTDDEYDK--------------KVDQDVLITNSYETAMRTAQNFLSVFLKKCGSKQGEEDYRPLFENFVQDLLSTVNKPEWPAAELLLSLLGRLLVHQFSNKQTEMALRVASLDYLGTVAARLRKDAVTSKMDQRSIDRIL 1560          
BLAST of Nipped-B protein vs. Ensembl Cavefish
Match: ddx3xb (DEAD-box helicase 3 X-linked b [Source:ZFIN;Acc:ZDB-GENE-980526-150])

HSP 1 Score: 283.878 bits (725), Expect = 8.554e-150
Identity = 133/235 (56.60%), Postives = 175/235 (74.47%), Query Frame = 3
Query:  510 SAINFDKYDAIPVSVTGPDYSAINVENFDELKLNPIIRNNILLASYQRPTPIQKNAIPAILEHRDIMACAQTGSGKTAAFLIPIINHLISQDLSPQ------RYTKTA-YPKCLILAPTRELAIQILSESQKFSLNTQMRSCVVYGGADTHSQIREVQIGCHLLVATPGRLVDFIEKNKISLEMCKYIVLDEADRMLDMGFEPQIRKIIEESNMPSGINRQTLMFSATFPKEIQV 1193
            + INF+KYD IPV  TG + S  ++++F ++++  II  NI L+ Y RPTP+QK+AIP I   RD+MACAQTGSGKTAAFL+P+++ + +            RY +   YP  L+LAPTRELA+QI  E++KF+  +++R CVVYGGAD   QIR+++ GCHLLVATPGRLVD +E+ KI L+ C Y+VLDEADRMLDMGFEPQIR+I+E+  MP    RQT+MFSATFPKEIQ+
Sbjct:  114 TGINFEKYDDIPVEATGHN-SPPHIDSFHDVEMGEIIMGNIALSRYTRPTPVQKHAIPIIKTKRDLMACAQTGSGKTAAFLLPVLSQIYTDGPGEALQAENGRYGRRKQYPLSLVLAPTRELALQIYDEARKFAYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDYCNYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGLRQTMMFSATFPKEIQI 347          

HSP 2 Score: 270.011 bits (689), Expect = 8.554e-150
Identity = 132/217 (60.83%), Postives = 168/217 (77.42%), Query Frame = 2
Query: 1259 LAADFLYNYIFMTVGRVGSTSDSIKQEIIYMTDVEKLNYLKNIFNTTAPNTLILIFVETKKGADSLARFLLSKGYPVSSIHGDRNQGEREHALNMFRNGQCPILVATAVAARGLDIPNVKHVINYDLPSDIEEYVHRIGRTGRLGNHGRATSFYVDKNNNIAIDLVDLLKEANQIVPQWLSALADELKRNSVIGSNNKRHNQRRFKNGNFGGRDYRQ 1909
            LA DFL +YIF+ VGRVGSTS++I Q+++++ + +K ++L ++ N T  ++L L+FVETKKGAD+L  FL  +GY  +SIHGDR+Q +RE ALN FR+G+CPILVATAVAARGLDI NVKHVIN+DLPSDIEEYVHRIGRTGR+GN G ATSF+ DKN+NI  DL+D+L EA Q VP WL +LA E +  S     + R   +RF +G FG RDYRQ
Sbjct:  348 LARDFLEDYIFLAVGRVGSTSENITQKVVWVEESDKRSFLLDLLNATGKDSLTLVFVETKKGADALEDFLYREGYACTSIHGDRSQRDREEALNQFRSGRCPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNDKNSNITKDLLDILVEAKQEVPSWLESLAYEHQHKS-----SSRGRSKRF-SGGFGARDYRQ 558          
BLAST of Nipped-B protein vs. Ensembl Cavefish
Match: ddx3xa (DEAD-box helicase 3 X-linked [Source:NCBI gene;Acc:103040126])

HSP 1 Score: 281.952 bits (720), Expect = 2.634e-148
Identity = 136/241 (56.43%), Postives = 172/241 (71.37%), Query Frame = 3
Query:  510 SAINFDKYDAIPVSVTGPDYSAINVENFDELKLNPIIRNNILLASYQRPTPIQKNAIPAILEHRDIMACAQTGSGKTAAFLIPIINH---------LISQDLSPQRYTKTA----YPKCLILAPTRELAIQILSESQKFSLNTQMRSCVVYGGADTHSQIREVQIGCHLLVATPGRLVDFIEKNKISLEMCKYIVLDEADRMLDMGFEPQIRKIIEESNMPSGINRQTLMFSATFPKEIQV 1193
            + INF+KYD IPV  TG +     +ENF ++ +  II  NI L+ Y RPTP+QK+AIP I   RD+MACAQTGSGKTAAFL+P+++          L +   S Q   K      YP  L+LAPTRELA+QI  E++KF+  +++R CVVYGGAD   QIR+++ GCHLLVATPGRLVD +E+ KI L+ C Y+VLDEADRMLDMGFEPQIR+I+E+  MP    RQT+MFSATFPKEIQ+
Sbjct:  273 TGINFEKYDDIPVEATGNNCPGP-IENFHDVDMGEIIMGNITLSRYTRPTPVQKHAIPIIKAKRDLMACAQTGSGKTAAFLLPVLSQIYTDGPGEALQASKASGQENGKYGRRKQYPISLVLAPTRELALQIYDEARKFAYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDYCNYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGARQTMMFSATFPKEIQI 512          

HSP 2 Score: 266.929 bits (681), Expect = 2.634e-148
Identity = 131/217 (60.37%), Postives = 167/217 (76.96%), Query Frame = 2
Query: 1259 LAADFLYNYIFMTVGRVGSTSDSIKQEIIYMTDVEKLNYLKNIFNTTAPNTLILIFVETKKGADSLARFLLSKGYPVSSIHGDRNQGEREHALNMFRNGQCPILVATAVAARGLDIPNVKHVINYDLPSDIEEYVHRIGRTGRLGNHGRATSFYVDKNNNIAIDLVDLLKEANQIVPQWLSALADELKRNSVIGSNNKRHNQRRFKNGNFGGRDYRQ 1909
            LA DFL  YIF+ VGRVGSTS++I Q+++++ + +K ++L ++ N T  ++L L+FVETKKGAD+L  FL  +GY  +SIHGDR+Q +RE AL+ FR+G+CPI+VATAVAARGLDI NVKHVIN+DLPSDIEEYVHRIGRTGR+GN G ATSFY DKN+NI  DL+D+L EA Q VP WL +LA E +       N+ R   +RF +G FG RDYRQ
Sbjct:  513 LARDFLEEYIFLAVGRVGSTSENITQKVVWVEESDKRSFLLDLLNATGKDSLTLVFVETKKGADALEDFLYREGYACTSIHGDRSQRDREEALHQFRSGRCPIMVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFYNDKNSNITKDLLDILVEAKQEVPSWLESLAFEHQHK-----NSNRGRSKRF-SGGFGARDYRQ 723          
BLAST of Nipped-B protein vs. Ensembl Cavefish
Match: ddx3xa (DEAD-box helicase 3 X-linked [Source:NCBI gene;Acc:103040126])

HSP 1 Score: 281.952 bits (720), Expect = 2.724e-148
Identity = 136/241 (56.43%), Postives = 172/241 (71.37%), Query Frame = 3
Query:  510 SAINFDKYDAIPVSVTGPDYSAINVENFDELKLNPIIRNNILLASYQRPTPIQKNAIPAILEHRDIMACAQTGSGKTAAFLIPIINH---------LISQDLSPQRYTKTA----YPKCLILAPTRELAIQILSESQKFSLNTQMRSCVVYGGADTHSQIREVQIGCHLLVATPGRLVDFIEKNKISLEMCKYIVLDEADRMLDMGFEPQIRKIIEESNMPSGINRQTLMFSATFPKEIQV 1193
            + INF+KYD IPV  TG +     +ENF ++ +  II  NI L+ Y RPTP+QK+AIP I   RD+MACAQTGSGKTAAFL+P+++          L +   S Q   K      YP  L+LAPTRELA+QI  E++KF+  +++R CVVYGGAD   QIR+++ GCHLLVATPGRLVD +E+ KI L+ C Y+VLDEADRMLDMGFEPQIR+I+E+  MP    RQT+MFSATFPKEIQ+
Sbjct:  244 TGINFEKYDDIPVEATGNNCPG-PIENFHDVDMGEIIMGNITLSRYTRPTPVQKHAIPIIKAKRDLMACAQTGSGKTAAFLLPVLSQIYTDGPGEALQASKASGQENGKYGRRKQYPISLVLAPTRELALQIYDEARKFAYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDYCNYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGARQTMMFSATFPKEIQI 483          

HSP 2 Score: 266.544 bits (680), Expect = 2.724e-148
Identity = 131/217 (60.37%), Postives = 167/217 (76.96%), Query Frame = 2
Query: 1259 LAADFLYNYIFMTVGRVGSTSDSIKQEIIYMTDVEKLNYLKNIFNTTAPNTLILIFVETKKGADSLARFLLSKGYPVSSIHGDRNQGEREHALNMFRNGQCPILVATAVAARGLDIPNVKHVINYDLPSDIEEYVHRIGRTGRLGNHGRATSFYVDKNNNIAIDLVDLLKEANQIVPQWLSALADELKRNSVIGSNNKRHNQRRFKNGNFGGRDYRQ 1909
            LA DFL  YIF+ VGRVGSTS++I Q+++++ + +K ++L ++ N T  ++L L+FVETKKGAD+L  FL  +GY  +SIHGDR+Q +RE AL+ FR+G+CPI+VATAVAARGLDI NVKHVIN+DLPSDIEEYVHRIGRTGR+GN G ATSFY DKN+NI  DL+D+L EA Q VP WL +LA E +       N+ R   +RF +G FG RDYRQ
Sbjct:  484 LARDFLEEYIFLAVGRVGSTSENITQKVVWVEESDKRSFLLDLLNATGKDSLTLVFVETKKGADALEDFLYREGYACTSIHGDRSQRDREEALHQFRSGRCPIMVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFYNDKNSNITKDLLDILVEAKQEVPSWLESLAFEHQHK-----NSNRGRSKRF-SGGFGARDYRQ 694          
BLAST of Nipped-B protein vs. Ensembl Cavefish
Match: ddx3xa (DEAD-box helicase 3 X-linked [Source:NCBI gene;Acc:103040126])

HSP 1 Score: 282.337 bits (721), Expect = 2.543e-145
Identity = 136/241 (56.43%), Postives = 172/241 (71.37%), Query Frame = 3
Query:  510 SAINFDKYDAIPVSVTGPDYSAINVENFDELKLNPIIRNNILLASYQRPTPIQKNAIPAILEHRDIMACAQTGSGKTAAFLIPIINH---------LISQDLSPQRYTKTA----YPKCLILAPTRELAIQILSESQKFSLNTQMRSCVVYGGADTHSQIREVQIGCHLLVATPGRLVDFIEKNKISLEMCKYIVLDEADRMLDMGFEPQIRKIIEESNMPSGINRQTLMFSATFPKEIQV 1193
            + INF+KYD IPV  TG +     +ENF ++ +  II  NI L+ Y RPTP+QK+AIP I   RD+MACAQTGSGKTAAFL+P+++          L +   S Q   K      YP  L+LAPTRELA+QI  E++KF+  +++R CVVYGGAD   QIR+++ GCHLLVATPGRLVD +E+ KI L+ C Y+VLDEADRMLDMGFEPQIR+I+E+  MP    RQT+MFSATFPKEIQ+
Sbjct:  220 TGINFEKYDDIPVEATGNNCPG-PIENFHDVDMGEIIMGNITLSRYTRPTPVQKHAIPIIKAKRDLMACAQTGSGKTAAFLLPVLSQIYTDGPGEALQASKASGQENGKYGRRKQYPISLVLAPTRELALQIYDEARKFAYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDYCNYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGARQTMMFSATFPKEIQI 459          

HSP 2 Score: 256.529 bits (654), Expect = 2.543e-145
Identity = 131/234 (55.98%), Postives = 167/234 (71.37%), Query Frame = 2
Query: 1259 LAADFLYNYIFMTVGRVGSTSDSIKQEIIYMTDVEKLNYLKNIFNTT-----------------APNTLILIFVETKKGADSLARFLLSKGYPVSSIHGDRNQGEREHALNMFRNGQCPILVATAVAARGLDIPNVKHVINYDLPSDIEEYVHRIGRTGRLGNHGRATSFYVDKNNNIAIDLVDLLKEANQIVPQWLSALADELKRNSVIGSNNKRHNQRRFKNGNFGGRDYRQ 1909
            LA DFL  YIF+ VGRVGSTS++I Q+++++ + +K ++L ++ N T                   ++L L+FVETKKGAD+L  FL  +GY  +SIHGDR+Q +RE AL+ FR+G+CPI+VATAVAARGLDI NVKHVIN+DLPSDIEEYVHRIGRTGR+GN G ATSFY DKN+NI  DL+D+L EA Q VP WL +LA E +       N+ R   +RF +G FG RDYRQ
Sbjct:  460 LARDFLEEYIFLAVGRVGSTSENITQKVVWVEESDKRSFLLDLLNATVIPSEVQENATETPERPGKDSLTLVFVETKKGADALEDFLYREGYACTSIHGDRSQRDREEALHQFRSGRCPIMVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFYNDKNSNITKDLLDILVEAKQEVPSWLESLAFEHQHK-----NSNRGRSKRF-SGGFGARDYRQ 687          
BLAST of Nipped-B protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003898.1 (pep scaffold:Pmarinus_7.0:GL481305:13824:21767:-1 gene:ENSPMAG00000003524.1 transcript:ENSPMAT00000003898.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 291.582 bits (745), Expect = 2.186e-151
Identity = 139/240 (57.92%), Postives = 180/240 (75.00%), Query Frame = 3
Query:  510 SAINFDKYDAIPVSVTGPDYSAINVENFDELKLNPIIRNNILLASYQRPTPIQKNAIPAILEHRDIMACAQTGSGKTAAFLIPIINHLIS-------QDLSPQRYT-----KTAYPKCLILAPTRELAIQILSESQKFSLNTQMRSCVVYGGADTHSQIREVQIGCHLLVATPGRLVDFIEKNKISLEMCKYIVLDEADRMLDMGFEPQIRKIIEESNMPSGINRQTLMFSATFPKEIQV 1193
            + INF+KYD IPV  TG D    ++E+F EL+L  II +++ L  Y+RPTP+QK AIP I   RD+MACAQTGSGKTAAFL+PI++ + S       +D   Q+ T     +  YP  L+LAPTRELA+QI  E++KF+  + +R CVVYGGAD  +Q+RE+Q GCHLLVATPGRLVD +E+ K+ L+ C+Y+VLDEADRMLDMGFEPQIR+I+E+  MP+  +RQTLMFSATFPKEIQ+
Sbjct:   35 TGINFEKYDDIPVEATGNDCPP-HIESFHELELGEIIMSSVTLCRYERPTPVQKYAIPIIKAKRDLMACAQTGSGKTAAFLLPILSQIYSGGPGKVVEDTKNQQETVKYGQRKQYPMSLVLAPTRELALQIYDEARKFAYRSCVRPCVVYGGADIGNQVRELQKGCHLLVATPGRLVDMMERGKVGLDHCRYLVLDEADRMLDMGFEPQIRRIVEQDVMPTKGDRQTLMFSATFPKEIQI 273          

HSP 2 Score: 265.388 bits (677), Expect = 2.186e-151
Identity = 129/217 (59.45%), Postives = 167/217 (76.96%), Query Frame = 2
Query: 1259 LAADFLYNYIFMTVGRVGSTSDSIKQEIIYMTDVEKLNYLKNIFNTTAPNTLILIFVETKKGADSLARFLLSKGYPVSSIHGDRNQGEREHALNMFRNGQCPILVATAVAARGLDIPNVKHVINYDLPSDIEEYVHRIGRTGRLGNHGRATSFYVDKNNNIAIDLVDLLKEANQIVPQWLSALADELKRNSVIGSNNKRHNQRRFKNGNFGGRDYRQ 1909
            LA DFL +YIF+ VGRVGS S++I Q+++++ +++K ++L ++ N T  ++L L+FVETKKGAD+L  FL S+GY  +SIHGDR+Q +RE AL++FR G+ PILVATAVAARGLDIPNVKHVIN+DLPSDIEEYVHRIGRTGR+GN G+ATSFY +KN N+  +L+ LL EA+Q VP WL  +A E +      S   R   +RF  G FGGRDYRQ
Sbjct:  274 LARDFLEDYIFLAVGRVGSASENITQKVVWVEEMDKRSFLLDLLNATGRDSLTLVFVETKKGADALQGFLCSEGYSCTSIHGDRSQRDREEALSLFRTGRRPILVATAVAARGLDIPNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGQATSFYNEKNENMTRELLHLLVEAHQEVPSWLETMAQEHR------SKPARGRPKRFA-GGFGGRDYRQ 483          
BLAST of Nipped-B protein vs. Ensembl Sea Lamprey
Match: ddx46 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 [Source:NCBI gene;Acc:321948])

HSP 1 Score: 174.096 bits (440), Expect = 1.085e-72
Identity = 87/195 (44.62%), Postives = 123/195 (63.08%), Query Frame = 3
Query:  618 IRNNILLASYQRPTPIQKNAIPAILEHRDIMACAQTGSGKTAAFLIPIINHLISQDLSPQRYTKTAYPKCLILAPTRELAIQILSESQKFSLNTQMRSCVVYGGADTHSQIREVQIGCHLLVATPGRLVDFIEKNK---ISLEMCKYIVLDEADRMLDMGFEPQIRKIIEESNMPSGINRQTLMFSATFPKEIQV 1193
            I N +   +Y++PTPIQ  AIPAI+  RD++  A+TGSGKT  FL+P+  H++ Q    +   +   P  +I+ PTRELA+QI  E +KF+    +R   VYGG     QI E++ G  ++V TPGR++D +  N     +     Y+VLDEADRM DMGFEPQ+ +IIE S  P   +RQT+MFSATFP+ ++ 
Sbjct:  380 ILNTLKKQNYEKPTPIQAQAIPAIMSGRDLIGIAKTGSGKTIGFLLPMFRHVMDQ----RPLEEGEGPIGVIMTPTRELALQIAKECRKFTKQLALRVVCVYGGTGISEQIAELKRGAEIIVCTPGRMIDMLAANSGRVTNFRRATYMVLDEADRMFDMGFEPQVMRIIETSR-P---DRQTVMFSATFPRAMEA 566          

HSP 2 Score: 120.168 bits (300), Expect = 1.085e-72
Identity = 65/216 (30.09%), Postives = 114/216 (52.78%), Query Frame = 2
Query: 1259 LAADFLYNYIFMTVGRVGSTSDSIKQEIIYMTDVEKLNYLKNIFNTTAPNTLILIFVETKKGADSLARFLLSKGYPVSSIHGDRNQGEREHALNMFRNGQCPILVATAVAARGLDIPNVKHVINYDLPSDIEEYVHRIGRTGRLGNHGRATSFYVDKNNNIAIDLVDLLKEANQIVPQWLSALADELKRNSVIGSNNKRHNQRRFKNGNFGGRDYR 1906
            LA   L   + + VG        ++Q +I + +  K   L  +         +++FV+ ++ AD+L + L+   YP  S+HG  +Q +R+  +N F++G C ++VAT+VAARGLD+ ++  V+NYD P+  E+YVHR+GRTGR GN G + +F   +    + D++  L+ +   +P  L  L  E +         K   +   K+  F G+ ++
Sbjct:  567 LARRILNKPVEVQVGGRSVVCSDVEQHVIVIEEDTKFYKLLELLGLYQEKGAVIVFVDKQEHADTLLKDLMKASYPCLSLHGGIDQYDRDSIINDFKSGVCRLMVATSVAARGLDVKHLIMVVNYDCPNHYEDYVHRVGRTGRAGNKGYSYTFITSEQERYSGDIIKALELSGTPLPPDLERLWTEFR------EKQKAEGKTMRKSSGFSGKGFK 776          
BLAST of Nipped-B protein vs. Ensembl Sea Lamprey
Match: ddx42 (DEAD (Asp-Glu-Ala-Asp) box helicase 42 [Source:ZFIN;Acc:ZDB-GENE-050706-53])

HSP 1 Score: 153.68 bits (387), Expect = 1.680e-69
Identity = 84/197 (42.64%), Postives = 116/197 (58.88%), Query Frame = 3
Query:  588 NFDELKLNPIIRNNILLASYQRPTPIQKNAIPAILEHRDIMACAQTGSGKTAAFLIPIINHLISQ-DLSPQRYTKTAYPKCLILAPTRELAIQILSESQKFSLNTQMRSCVVYGGADTHSQIREVQIGCHLLVATPGRLVDFIEKNKISLEMCKYIVLDEADRMLDMGFEPQIRKIIEESNMPSGINRQTLMFSATF 1175
             FDE  LN +IR     + + +PTPIQ   IP  L  RDI+  A+TGSGKTA+F+ P++ H+++Q +L P        P  LI  PTREL  QI  E ++F     + S  VYGG     Q + +Q G  ++V TPGRL+D ++K   +L+   Y+V DEADRM DMGFE Q+R I          +RQT+++SATF
Sbjct:  255 GFDEQLLN-LIRK----SEFTQPTPIQCQGIPIALSGRDIIGIAKTGSGKTASFIWPMLVHIMAQKELKP-----GDGPIGLICVPTRELCQQINVECKRFGKAYNLHSVAVYGGGSMWEQAKALQEGAEIVVCTPGRLIDHVKKKATNLQRVTYLVFDEADRMFDMGFEYQVRSIANHVRP----DRQTMLYSATF 437          

HSP 2 Score: 130.183 bits (326), Expect = 1.680e-69
Identity = 83/226 (36.73%), Postives = 119/226 (52.65%), Query Frame = 2
Query: 1256 KLAADFLYNYIFMTVGRVGSTSDSIKQEI-IYMTDVEKLNYLKNIFNTTAPNTLILIFVETKKGADSLARFLLSKGYPVSSIHGDRNQGEREHALNMFRNGQCPILVATAVAARGLDIPNVKHVINYDLPSDIEEYVHRIGRTGRLGNHGRATSFYVDKNNNIAIDLVDLLKEANQIVPQWLSALADELKRNSVIGSNNKRHNQRRFKNG-------NFGGRDYRQ 1909
            KLA D L + I +  G +G  ++ + Q + I+     K N+L +       +  +LIFV  K  ++ L+  L  +G+ V  +HGD +Q ER   ++ F+    PI+VAT VAARGLDIP++K V+NYD+  DI+ + HR+GRTGR G  G A +    K+ N A DLV  L+ ANQ V + L  LA            N    + RFK G         GG  YR+
Sbjct:  443 KLARDILIDPIRVVQGDIGEANEDVTQRVEIFSNGAAKWNWLCSHLVEFTSSGSVLIFVTRKDNSEELSNDLEQEGFQVGLLHGDMDQSERNKVISDFKKKVIPIMVATDVAARGLDIPSIKTVVNYDVARDIDTHTHRVGRTGRAGEKGTAFTLMTHKDMNFAGDLVRNLEGANQHVHKELMDLA----------MQNPWFRKTRFKGGRGRKLNVGGGGLGYRE 658          
BLAST of Nipped-B protein vs. Ensembl Sea Lamprey
Match: ddx23 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 23 [Source:ZFIN;Acc:ZDB-GENE-030131-6215])

HSP 1 Score: 166.007 bits (419), Expect = 3.003e-69
Identity = 89/213 (41.78%), Postives = 125/213 (58.69%), Query Frame = 3
Query:  618 IRNNILLASYQRPTPIQKNAIPAILEHRDIMACAQTGSGKTAAFLIPIINHLISQDLSPQRYTKTAYPKCLILAPTRELAIQILSESQKFSLNTQMRSCVVYGGADTHSQIREVQIGCHLLVATPGRLVDFIEKNKISLEMCKYIVLDEADRMLDMGFEPQIRKIIEE--------------------SNMPSGIN--RQTLMFSATFPKEIQ 1190
            IR  I    Y+ PTPIQ+ AIP  L++RDI+  A+TGSGKTAAFLIP++  + +     +       P  +ILAPTRELA QI  E+ KF     +R+  V GG     Q   +++GC +++ATPGRL+D +E   + L  C Y+VLDEADRM+DMGFEP +++I+E                     +N  SG +  RQT+MF+AT P  ++
Sbjct:  331 IREVIEKCGYKDPTPIQRQAIPIGLQNRDIIGIAETGSGKTAAFLIPLLVWITTLPKIDRIEDTDQGPYAVILAPTRELAQQIEEETIKFGKPLGIRTVAVIGGISREDQGFRLRMGCKIVIATPGRLIDVLENRYLVLSRCTYVVLDEADRMIDMGFEPDVQRILEHMPVSNQKPDTDDAEDPDKMTANFESGRHKYRQTVMFTATMPAAVE 543          

HSP 2 Score: 116.701 bits (291), Expect = 3.003e-69
Identity = 63/166 (37.95%), Postives = 94/166 (56.63%), Query Frame = 2
Query: 1256 KLAADFLYNYIFMTVGRVGSTSDSIKQEIIYMTDVEKLNYLKNIFNTTAPNTLILIFVETKKGADSLARFLLSKGYPVSSIHGDRNQGEREHALNMFRNGQCPILVATAVAARGLDIPNVKHVINYDLPSDIEEYVHRIGRTGRLGNHGRATSFYVDKNNNIAIDL 1753
            +LA  +L     + +G VG   + ++Q +  M + EK   L  + +       I+IFV  KKG D LA+ L   G+   ++HG + Q +RE AL+  + G   ILVAT VA RG+DI +V  V+NYD+  +IE+Y HRIGRTGR G  G + +F   ++  +  DL
Sbjct:  544 RLARSYLRRPAVVYIGSVGKPIERVEQRVFIMGESEKRKKLLELLSRGF-EPPIIIFVNQKKGCDVLAKSLEKMGFNACTLHGGKGQEQREFALSNLKAGAKDILVATDVAGRGIDIHDVSMVLNYDMAKNIEDYTHRIGRTGRAGKSGVSVTFLTKEDAAVFYDL 708          
BLAST of Nipped-B protein vs. Ensembl Sea Lamprey
Match: ddx49 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 49 [Source:ZFIN;Acc:ZDB-GENE-031030-3])

HSP 1 Score: 134.035 bits (336), Expect = 5.482e-48
Identity = 80/204 (39.22%), Postives = 117/204 (57.35%), Query Frame = 3
Query:  591 FDELKLNPIIRNNILLASYQRPTPIQKNAIPAILEHRDIMACAQTGSGKTAAFLIPIINHLISQDLSPQRYTKTAYPKCLILAPTRELAIQILSESQKFSLNTQMRSCVVYGGADTHSQIREVQIGCHLLVATPGRLVDFIE-KNKISLEMCKYIVLDEADRMLDMG---FEPQIRKIIEESNMPSGINRQTLMFSATFPKEIQ 1190
            F  L L+  +          +PTP+Q+N IP IL  +D M CAQTGSGKTAAF++PI+     Q LS   +       CL+LAPTRELA QI  + +       ++  V+ GG D+  Q +E+    H+++ATPGRL D +   N  SL+  +++V+DEADR+L+ G   F   ++ I+    +P+   RQTL+FSAT    +Q
Sbjct:    7 FKRLGLDDWLMQQCKQMGISKPTPVQENCIPPILRGQDCMGCAQTGSGKTAAFVLPIL-----QKLSEDPFGIF----CLVLAPTRELAYQIAEQFRVMGKPLGLKDSVIVGGMDSVRQAQELARKPHVVIATPGRLADHLRSSNTFSLKKIQFLVMDEADRLLEQGATDFTKDLQVIL---ALPA--KRQTLLFSATLTDTLQ 196          

HSP 2 Score: 77.7962 bits (190), Expect = 5.482e-48
Identity = 52/155 (33.55%), Postives = 76/155 (49.03%), Query Frame = 2
Query: 1274 LYNYIFMTVGRVGSTSDSIKQEIIYMTDVEKLNYLKNIFNTTAP---NTLILIFVETKKGADSLARFLLSKGYPVSSIHGDRNQGEREHALNMFRNGQCPILVATAVA----ARGLDIPNVKHVINYDLPSDIEEYVHRIGRTGRLGNHGRATSF 1717
            L N  F        T + + Q  I + D  K  YL +I         +  I++F  T K    L   L    +P  ++H    Q ER  +L+ F++    IL+AT VA    ARGLDIP V+ V+N++ PS  + Y+HR+GRT R G +G A + 
Sbjct:  203 LTNPFFWESKEPVRTVEELDQRYILVADKVKDAYLVHIIQKIQDAHDDWSIIVFTNTCKNCQVLNMMLRHFNFPSVALHSMMRQTERFASLSKFKSSMFKILIATDVASSFWARGLDIPTVQVVLNHNTPSLPKTYIHRVGRTARAGRNGVAITI 357          
BLAST of Nipped-B protein vs. Ensembl Yeast
Match: DBP1 (Putative ATP-dependent RNA helicase of the DEAD-box protein family; mutants show reduced stability of the 40S ribosomal subunit scanning through 5' untranslated regions of mRNAs; protein abundance increases in response to DNA replication stress; DBP1 has a paralog, DED1, that arose from the whole genome duplication [Source:SGD;Acc:S000006040])

HSP 1 Score: 267.314 bits (682), Expect = 9.344e-129
Identity = 129/234 (55.13%), Postives = 161/234 (68.80%), Query Frame = 3
Query:  507 TSAINFDKYDAIPVSVTGPDYSAINVENFDELKLNPIIRNNILLASYQRPTPIQKNAIPAILEHRDIMACAQTGSGKTAAFLIPIINHLISQDLSP------QRYTKTAYPKCLILAPTRELAIQILSESQKFSLNTQMRSCVVYGGADTHSQIREVQIGCHLLVATPGRLVDFIEKNKISLEMCKYIVLDEADRMLDMGFEPQIRKIIEESNMPSGINRQTLMFSATFPKEIQ 1190
            +S I FD YD IPV  +G D     + +F    L+ ++  NI LAS+ +PTP+QK +IP + + RD+MACAQTGSGKT  FL P+   L     SP        Y++  YP  L+LAPTRELA QI  E++KF+  + +R CVVYGGA   +Q+REV  GC LLVATPGRL D +E+ K+SL   KY+VLDEADRMLDMGFEPQIR I+EE +MPS  NRQTLMFSATFP +IQ
Sbjct:  129 SSGIKFDNYDNIPVDASGKDVPEP-ILDFSSPPLDELLMENIKLASFTKPTPVQKYSIPIVTKGRDLMACAQTGSGKTGGFLFPLFTELFRSGPSPVPEKAQSFYSRKGYPSALVLAPTRELATQIFEEARKFTYRSWVRPCVVYGGAPIGNQMREVDRGCDLLVATPGRLNDLLERGKVSLANIKYLVLDEADRMLDMGFEPQIRHIVEECDMPSVENRQTLMFSATFPVDIQ 361          

HSP 2 Score: 213.386 bits (542), Expect = 9.344e-129
Identity = 117/217 (53.92%), Postives = 147/217 (67.74%), Query Frame = 2
Query: 1259 LAADFLYNYIFMTVGRVGSTSDSIKQEIIYMTDVEKLNYLKNIFNTTAPNTLILIFVETKKGADSLARFLLSKGYPVSSIHGDRNQGEREHALNMFRNGQCPILVATAVAARGLDIPNVKHVINYDLPSDIEEYVHRIGRTGRLGNHGRATSFYVDKNNNIAIDLVDLLKEANQIVPQWLSALADELKRNSVIGSNNKRHNQRRFKNGNFGGRDYRQ 1909
            LA DFL NYIF++VGRVGSTS++I Q I+Y+ D++K + L ++ +      L LIFVETK+ AD L  FL+ + +  ++IHGDR Q ERE AL+ F+     ILVATAVAARGLDIPNV HVINYDLPSDI++YVHRIGRTGR GN G ATSF+   N NI   L+++L EANQ VP +LS L+ +  R           N R     N G RDYR+
Sbjct:  363 LARDFLDNYIFLSVGRVGSTSENITQRILYVDDMDKKSALLDLLSAEH-KGLTLIFVETKRMADQLTDFLIMQNFKATAIHGDRTQAERERALSAFKANVADILVATAVAARGLDIPNVTHVINYDLPSDIDDYVHRIGRTGRAGNTGVATSFFNSNNQNIVKGLMEILNEANQEVPTFLSDLSRQNSRGGRTRGGGGFFNSR-----NNGSRDYRK 573          
BLAST of Nipped-B protein vs. Ensembl Yeast
Match: DED1 (ATP-dependent DEAD (Asp-Glu-Ala-Asp)-box RNA helicase; required for translation initiation of all yeast mRNAs; binds to mRNA cap-associated factors, and binding stimulates Ded1p RNA-dependent ATPase activity; mutation in human homolog DBY is associated with male infertility; human homolog DDX3X complements ded1 null mutation; DED1 has a paralog, DBP1, that arose from the whole genome duplication [Source:SGD;Acc:S000005730])

HSP 1 Score: 257.684 bits (657), Expect = 9.523e-127
Identity = 124/239 (51.88%), Postives = 162/239 (67.78%), Query Frame = 3
Query:  492 DNNSLTSAINFDKYDAIPVSVTGPDYSAINVENFDELKLNPIIRNNILLASYQRPTPIQKNAIPAILEHRDIMACAQTGSGKTAAFLIPIINHLISQDLSPQR------YTKTAYPKCLILAPTRELAIQILSESQKFSLNTQMRSCVVYGGADTHSQIREVQIGCHLLVATPGRLVDFIEKNKISLEMCKYIVLDEADRMLDMGFEPQIRKIIEESNMPSGINRQTLMFSATFPKEIQ 1190
            D N  +S INFD YD IPV  +G D     +  F    L+ ++  NI LA + +PTP+QK ++P +   RD+MACAQTGSGKT  FL P+++       SPQ       Y + AYP  +I+APTRELA QI  E++KF+  + +++CVVYGG+   +Q+RE++ GC LLVATPGRL D +E+ KISL   KY+VLDEADRMLDMGFEPQIR I+E+ +M     RQTLMFSATFP +IQ
Sbjct:  112 DPNFQSSGINFDNYDDIPVDASGKDVPE-PITEFTSPPLDGLLLENIKLARFTKPTPVQKYSVPIVANGRDLMACAQTGSGKTGGFLFPVLSESFKTGPSPQPESQGSFYQRKAYPTAVIMAPTRELATQIFDEAKKFTYRSWVKACVVYGGSPIGNQLREIERGCDLLVATPGRLNDLLERGKISLANVKYLVLDEADRMLDMGFEPQIRHIVEDCDMTPVGERQTLMFSATFPADIQ 349          

HSP 2 Score: 216.468 bits (550), Expect = 9.523e-127
Identity = 111/217 (51.15%), Postives = 153/217 (70.51%), Query Frame = 2
Query: 1259 LAADFLYNYIFMTVGRVGSTSDSIKQEIIYMTDVEKLNYLKNIFNTTAPNTLILIFVETKKGADSLARFLLSKGYPVSSIHGDRNQGEREHALNMFRNGQCPILVATAVAARGLDIPNVKHVINYDLPSDIEEYVHRIGRTGRLGNHGRATSFYVDKNNNIAIDLVDLLKEANQIVPQWLSALADELKRNSVIGSNNKRHNQRRFKNGNFGGRDYRQ 1909
            LA DFL +YIF++VGRVGSTS++I Q+++Y+ + +K + L ++ + +  + L LIFVETK+ AD L  FL+ + +  ++IHGDR Q ERE AL  FR+G   +LVATAVAARGLDIPNV HVINYDLPSD+++YVHRIGRTGR GN G AT+F+  +N+NI   L ++L EANQ VP +L        +++++ +   R N RR   G    RDYR+
Sbjct:  351 LARDFLSDYIFLSVGRVGSTSENITQKVLYVENQDKKSALLDLLSAST-DGLTLIFVETKRMADQLTDFLIMQNFRATAIHGDRTQSERERALAAFRSGAATLLVATAVAARGLDIPNVTHVINYDLPSDVDDYVHRIGRTGRAGNTGLATAFFNSENSNIVKGLHEILTEANQEVPSFL--------KDAMMSAPGSRSNSRRGGFGRNNNRDYRK 558          
BLAST of Nipped-B protein vs. Ensembl Yeast
Match: DBP2 (ATP-dependent RNA helicase of the DEAD-box protein family; has strong preference for dsRNA; interacts with YRA1; required for assembly of Yra1p, Nab2p and Mex67p onto mRNA and formation of nuclear mRNP; involved in mRNA decay and rRNA processing; may be involved in suppression of transcription from cryptic initiation sites [Source:SGD;Acc:S000005056])

HSP 1 Score: 181.03 bits (458), Expect = 1.342e-86
Identity = 90/203 (44.33%), Postives = 128/203 (63.05%), Query Frame = 3
Query:  582 VENFDELKLNPIIRNNILLASYQRPTPIQKNAIPAILEHRDIMACAQTGSGKTAAFLIPIINHLISQDLSPQRYTKTAYPKCLILAPTRELAIQILSESQKFSLNTQMRSCVVYGGADTHSQIREVQIGCHLLVATPGRLVDFIEKNKISLEMCKYIVLDEADRMLDMGFEPQIRKIIEESNMPSGINRQTLMFSATFPKEIQ 1190
            +  FDE      + N +    + +PT IQ    P  L  RD++  A TGSGKT ++ +P I H+ +Q L          P  L+LAPTRELA+QI +E  KF  ++++R+  VYGG     QIR++  G  +++ATPGRL+D +E  K +L+   Y+VLDEADRMLDMGFEPQIRKI+++       +RQTLM+SAT+PKE++
Sbjct:  112 ITTFDEAGFPDYVLNEVKAEGFDKPTGIQCQGWPMALSGRDMVGIAATGSGKTLSYCLPGIVHINAQPL----LAPGDGPIVLVLAPTRELAVQIQTECSKFGHSSRIRNTCVYGGVPKSQQIRDLSRGSEIVIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRP----DRQTLMWSATWPKEVK 306          

HSP 2 Score: 159.073 bits (401), Expect = 1.342e-86
Identity = 80/184 (43.48%), Postives = 119/184 (64.67%), Query Frame = 2
Query: 1256 KLAADFLYNYIFMTVGRVG-STSDSIKQEIIYMTDVEKLNYLKNIFNTTAPNT--LILIFVETKKGADSLARFLLSKGYPVSSIHGDRNQGEREHALNMFRNGQCPILVATAVAARGLDIPNVKHVINYDLPSDIEEYVHRIGRTGRLGNHGRATSFYVDKNNNIAIDLVDLLKEANQIVPQWL 1798
            +LAAD+L + I + VG +  S S +I Q +  ++D EK + L     T + +     LIF  TK+  D + ++L   G+P  +IHGD++Q ER+  L  FRNG+ PI+VAT VAARG+D+  + +VINYD+P +IE+YVHRIGRTGR G  G A SF+ ++N  +   L+ +++EANQ +P  L
Sbjct:  307 QLAADYLNDPIQVQVGSLELSASHNITQIVEVVSDFEKRDRLNKYLETASQDNEYKTLIFASTKRMCDDITKYLREDGWPALAIHGDKDQRERDWVLQEFRNGRSPIMVATDVAARGIDVKGINYVINYDMPGNIEDYVHRIGRTGRAGATGTAISFFTEQNKGLGAKLISIMREANQNIPPEL 490          
BLAST of Nipped-B protein vs. Ensembl Yeast
Match: DBP3 (RNA-Dependent ATPase, member of DExD/H-box family; involved in cleavage of site A3 within the ITS1 spacer during rRNA processing; not essential for growth, but deletion causes severe slow-growth phenotype [Source:SGD;Acc:S000003046])

HSP 1 Score: 150.984 bits (380), Expect = 5.936e-69
Identity = 82/201 (40.80%), Postives = 122/201 (60.70%), Query Frame = 3
Query:  588 NFDELKLNPIIRNNILLASYQRPTPIQKNAIPAILEHRDIMACAQTGSGKTAAFLIPIINHLISQDLSPQRYTKTAYPKCLILAPTRELAIQILSESQKFSLNTQMRSCVVYGGADTHSQIREVQIGCHLLVATPGRLVDFIEKNKISLEMCKYIVLDEADRMLDMGFEPQIRKIIEESNMPSGINRQTLMFSATFPKEIQ 1190
            +FD L L+  I+  I  + + +PTPIQ  A P +L  +D++  A+TGSGKT AF +P I+HL++         K    + L+++PTRELA QI       +    M+ C VYGG     Q  +++    ++VATPGRL+D +++  + L    Y+VLDEADRML+ GFE  I+ II E++      RQTLMF+AT+PKE++
Sbjct:  115 SFDYLSLDSSIQAEI--SKFPKPTPIQAVAWPYLLSGKDVVGVAETGSGKTFAFGVPAISHLMNDQ-------KKRGIQVLVISPTRELASQIYDNLIVLTDKVGMQCCCVYGGVPKDEQRIQLK-KSQVVVATPGRLLDLLQEGSVDLSQVNYLVLDEADRMLEKGFEEDIKNIIRETDAS---KRQTLMFTATWPKEVR 302          

HSP 2 Score: 130.183 bits (326), Expect = 5.936e-69
Identity = 78/187 (41.71%), Postives = 113/187 (60.43%), Query Frame = 2
Query: 1256 KLAADFLYNYIFMTVGRVGS-TSDSIKQEIIYMTDV-----EKLNYLKNIFNTTAPNTLILIFVETKKGADSLARFLLSKGYPVSSIHGDRNQGEREHALNMFRNGQCPILVATAVAARGLDIPNVKHVINYDLPSDIEEYVHRIGRTGRLGNHGRATSFYVDKNNNIAIDLVDLLKEANQIVPQWL 1798
            +LA+ F+ N I +++G     T++    +I+ + D      + L  LK   +    N  +LIF   KK A  + R L   GY V++IHGD +Q +R  ALN F++G+  +L+AT VAARGLDIPNVK VIN   P  +E+YVHRIGRTGR G  G A + + ++  ++A  LV++L  ANQ VP+ L
Sbjct:  303 ELASTFMNNPIKVSIGNTDQLTANKRITQIVEVVDPRGKERKLLELLKKYHSGPKKNEKVLIFALYKKEAARVERNLKYNGYNVAAIHGDLSQQQRTQALNEFKSGKSNLLLATDVAARGLDIPNVKTVINLTFPLTVEDYVHRIGRTGRAGQTGTAHTLFTEQEKHLAGGLVNVLNGANQPVPEDL 489          
BLAST of Nipped-B protein vs. Ensembl Yeast
Match: PRP28 (RNA binding protein; involved in RNA isomerization at the 5' splice site and for exchange of U6 for U1 snRNA at the 5' splice site; similar to the RNA helicases of the DEAD-box family [Source:SGD;Acc:S000002651])

HSP 1 Score: 142.124 bits (357), Expect = 7.008e-63
Identity = 90/215 (41.86%), Postives = 124/215 (57.67%), Query Frame = 3
Query:  582 VENFDELKLNP--IIRNNILLASYQRPTPIQKNAIPAIL---EHRDIMACAQTGSGKTAAFLIPIINHLISQDLSPQRYTKTAY---PKCLILAPTRELAIQILSESQKFSLNTQMRS---CVVYGGADTHSQIREVQI----GCHLLVATPGRLVDFIEKNKISLEMCKYIVLDEADRMLDMGFEPQIRKIIEES--NMPSGINRQTLMFSATF 1175
            + N++EL + P  ++R  I    +  PTPIQ+  IP +    ++RD +  A TGSGKT AF+IPI   LI    SP R         PK LILAPTREL  QI  E+QK +      S   C V      HS + E+      GC +LVATPGRL+D +E + + ++  + +VLDEAD+M+D+GFE Q+  I+ +   N  S +NRQTLMF+AT 
Sbjct:  171 LRNWEELNIIPRDLLRVIIQELRFPSPTPIQRITIPNVCNMKQYRDFLGVASTGSGKTLAFVIPI---LIKMSRSPPRPPSLKIIDGPKALILAPTRELVQQIQKETQKVTKIWSKESNYDCKVISIVGGHS-LEEISFSLSEGCDILVATPGRLIDSLENHLLVMKQVETLVLDEADKMIDLGFEDQVTNILTKVDINADSAVNRQTLMFTATM 381          

HSP 2 Score: 118.627 bits (296), Expect = 7.008e-63
Identity = 63/156 (40.38%), Postives = 94/156 (60.26%), Query Frame = 2
Query: 1256 KLAADFLYNYIFMTVGRVGSTSDSIKQEIIYM-TDVEKLNYLKNIFNTTAPNTLILIFVETKKGADSLA-RFLLSKGYPVSSIHGDRNQGEREHALNMFRNGQCPILVATAVAARGLDIPNVKHVINYDLPSDIEEYVHRIGRTGRLGNHGRATSF 1717
            K+AA ++   ++ T+G    +   I+Q + Y   D +K   LK I     P   I+IF+  K+ AD LA +F       V+ +HG ++Q +REH+L +FR  +  I++AT VAARGLDIPNV  V+N+ +   +++Y+HRIGRTGR  N G A SF
Sbjct:  387 KIAAGYMQKPVYATIGVETGSEPLIQQVVEYADNDEDKFKKLKPIVAKYDPP--IIIFINYKQTADWLAEKFQKETNMKVTILHGSKSQEQREHSLQLFRTNKVQIMIATNVAARGLDIPNVSLVVNFQISKKMDDYIHRIGRTGRAANEGTAVSF 540          
BLAST of Nipped-B protein vs. Ensembl Nematostella
Match: PL10 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM49])

HSP 1 Score: 276.559 bits (706), Expect = 1.366e-140
Identity = 143/282 (50.71%), Postives = 189/282 (67.02%), Query Frame = 3
Query:  369 YSQNSNSW--RPAMNNPNLYDGVKQNPLSLHYLQNGMDMYTNLDNNSLTSAINFDKYDAIPVSVTGPDYSAINVENFDELKLNPIIRNNILLASYQRPTPIQKNAIPAILEHRDIMACAQTGSGKTAAFLIPIINHLISQDLSPQRYTKTA-----YPKCLILAPTRELAIQILSESQKFSLNTQMRSCVVYGGADTHSQIREVQIGCHLLVATPGRLVDFIEKNKISLEMCKYIVLDEADRMLDMGFEPQIRKIIEESNMPSGINRQTLMFSATFPKEIQV 1193
            YS  SN W   PA ++ +   G +  P     LQ   +        S  + INF+KYD IPV  TG +    N+E F+++ L  I+ +N+ LA Y++PTP+QK AIP +   RD+MACAQTGSGKTAAFLIPI++ +  +        K A     YP CL+LAPTRELA+QI  E++KFS  +  R CVVYGGAD  SQ+RE+   CHLLVATPGRLVD +++ ++ L+  +++VLDEADRMLDMGFEPQIR+I+++ +MP    RQTLMFSATFPKEIQ+
Sbjct:  120 YSGGSN-WGSSPAGDDRDYGYGQQHPPEDWSKLQPKNERVERDLFASHNTGINFEKYDDIPVEATGQECPK-NIELFEDVDLGEILLHNVGLAGYKKPTPVQKYAIPIVKGKRDLMACAQTGSGKTAAFLIPILSRIYMEGPPAPPDIKHAGRRRQYPICLVLAPTRELAVQIFDEARKFSYRSLCRPCVVYGGADIGSQLRELDRNCHLLVATPGRLVDMMDRGRVGLDSIRFLVLDEADRMLDMGFEPQIRRIVDQDSMPKTGIRQTLMFSATFPKEIQM 399          

HSP 2 Score: 244.973 bits (624), Expect = 1.366e-140
Identity = 120/217 (55.30%), Postives = 155/217 (71.43%), Query Frame = 2
Query: 1259 LAADFLYNYIFMTVGRVGSTSDSIKQEIIYMTDVEKLNYLKNIFNTTAPNTLILIFVETKKGADSLARFLLSKGYPVSSIHGDRNQGEREHALNMFRNGQCPILVATAVAARGLDIPNVKHVINYDLPSDIEEYVHRIGRTGRLGNHGRATSFYVDKNNNIAIDLVDLLKEANQIVPQWLSALADELKRNSVIGSNNKRHNQRRFKNGNFGGRDYRQ 1909
            LA DFL NYIF+ VG+VGSTS++I Q+++++ + +K ++L ++ N + P  L L+FVETKKGAD+L  FL   GY  +SIHGDR+Q ERE AL  FR G  PILVATAVAARGLDIPNVKHVIN+DLP+DIEEYVHRIGRTGR+G+ G ATSF+  KN N+A +L+D+L+E+ Q +P WL ++A E    S             F +     RDYRQ
Sbjct:  400 LARDFLENYIFLAVGKVGSTSENITQKVVWVDEFDKRSFLLDLLNASGPQQLTLVFVETKKGADALEMFLAKDGYYCTSIHGDRSQREREEALRTFRCGDTPILVATAVAARGLDIPNVKHVINFDLPTDIEEYVHRIGRTGRVGHTGLATSFFNHKNKNVAKELMDILEESKQEIPSWLESMAYEASSGSRNRGRRHGGGGGAFSS-----RDYRQ 611          
BLAST of Nipped-B protein vs. Ensembl Nematostella
Match: VAS1 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJG3])

HSP 1 Score: 192.586 bits (488), Expect = 1.910e-97
Identity = 102/187 (54.55%), Postives = 129/187 (68.98%), Query Frame = 2
Query: 1259 LAADFLY-NYIFMTVGRVGSTSDSIKQEIIYMTDVEKLNYLKNIFNTTAPNTLILIFVETKKGADSLARFLLSKGYPVSSIHGDRNQGEREHALNMFRNGQCPILVATAVAARGLDIPNVKHVINYDLPSDIEEYVHRIGRTGRLGNHGRATSFY-VDKNNNIAIDLVDLLKEANQIVPQWLSALAD 1813
            LA  FL  +Y+F+ VGRVG T+  I Q +I +   EK + L  I + T  +   L+FVE K+ AD LA +L    +P +SI  DR Q ERE AL  FR+G+  ILVAT+VAARGLDIPNVKHVINYDLP DIEEYVHR+GRTGR+GN G+AT+FY V +++ +A  LV +L EA Q VP WL   A+
Sbjct:  159 LAGSFLKPDYLFLAVGRVGGTNLDITQHVITVNGSEKRDKLHEILSATGTDR-TLVFVELKRVADFLAAWLSQNNFPTTSISSDRCQSEREAALRDFRDGRANILVATSVAARGLDIPNVKHVINYDLPQDIEEYVHRVGRTGRIGNEGKATAFYEVGRDDRLARSLVKVLSEALQEVPAWLDEAAE 344          

HSP 2 Score: 184.882 bits (468), Expect = 1.910e-97
Identity = 91/162 (56.17%), Postives = 116/162 (71.60%), Query Frame = 3
Query:  708 MACAQTGSGKTAAFLIPIINHLISQDL-SPQRYTKTAYPKCLILAPTRELAIQILSESQKFSLNTQMRSCVVYGGADTHSQIREVQIGCHLLVATPGRLVDFIEKNKISLEMCKYIVLDEADRMLDMGFEPQIRKIIEESNMPSGINRQTLMFSATFPKEIQ 1190
            MACAQTGSGKTAA+++P++  LI Q L +P R      P  L +APTRELA QI  E++KFS +T ++ CV YGG     Q  +++ GCH LV TPGRL DF+ + KI L   ++++LDEADRMLD+GF P I K+IEESNM +  +RQTLMFSATFP EIQ
Sbjct:    1 MACAQTGSGKTAAYMLPVLTSLIKQGLNAPPRS-----PLALCVAPTRELAKQIYIEARKFSDHTPIKVCVCYGGVSVPYQASQLERGCHFLVGTPGRLQDFVSREKIYLGSIQHLILDEADRMLDLGFGPDIHKLIEESNMTAKESRQTLMFSATFPDEIQ 157          
BLAST of Nipped-B protein vs. Ensembl Nematostella
Match: EDO27708 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T8H9])

HSP 1 Score: 223.402 bits (568), Expect = 8.325e-94
Identity = 114/218 (52.29%), Postives = 151/218 (69.27%), Query Frame = 2
Query: 1256 KLAADFLYNYIFMTVGRVGSTSDSIKQEIIYMTDVEKLNYLKNIFNTTAPNTLILIFVETKKGADSLARFLLSKGYPVSSIHGDRNQGEREHALNMFRNGQCPILVATAVAARGLDIPNVKHVINYDLPSDIEEYVHRIGRTGRLGNHGRATSFYV-DKNNNIAIDLVDLLKEANQIVPQWLSALADELKRNSVIGSNNKRHNQRRFKNGNFGGRDYR 1906
            +LA DFL +Y+F+TVGRVG T+  I+Q +I +TD EK + L  I          L+FVE+K+ AD LA FL  +G+P +SIHGDR Q ERE AL+ FR G+CP+L+AT VAARGLDI +VKHVIN+DLPSDI+EYVHRIGRTGR+GN G+AT+F++  +++ +A  LV +L EANQ VP+WL  +A+       IG++           G FG RD R
Sbjct:  421 RLAGDFLNDYLFLTVGRVGGTTSDIEQTVIEVTDNEKRDRLTQILGDA---DRTLVFVESKRSADFLAIFLSGEGFPTTSIHGDRLQQEREEALDDFRKGRCPVLIATNVAARGLDIDDVKHVINFDLPSDIDEYVHRIGRTGRIGNKGKATTFFLRGRDDKVARGLVKVLSEANQEVPEWLEEIAE-----GAIGTDYGP------AGGRFGSRDTR 624          

HSP 2 Score: 142.124 bits (357), Expect = 8.325e-94
Identity = 91/234 (38.89%), Postives = 133/234 (56.84%), Query Frame = 3
Query:  498 NSLTSAINFDKYDAIPVSVTGPDYSAINVENFDELKLNPIIRNNILLASYQRPTPIQKNAIPAILEHRDIMACAQTGSGKTAAFLIPIINHLISQDLSPQRYT--KTAYPKCLILAPTRELAIQILSESQKFSLNTQMRSCVVYGGADTHSQIREVQIGCHLLVATPGRLVDFIEKNK-ISLEMCKYIVLDEADRMLDMGFEPQIRKIIEESNMPSGINRQTLMFSATFPKEIQ 1190
            +++   INF+KYD I V V+G +    ++ +F+E  L     NN+  A Y++PTP+QK +IP ++  RD+MACAQTGSGKT  F    I  +    +S QR T    A  KC+++     +     S   +  +   M +  ++  A T    R   +    L  +    +  IE+N  +SL+  ++++LDEADRMLDMGFEP IR+I+E   MP    RQTLMFSATFP+EIQ
Sbjct:  194 STIQQGINFEKYDQIEVLVSG-NNPVRHINSFEEANLYEAFLNNVRKAQYKKPTPVQKYSIPIVIAGRDVMACAQTGSGKTYWFSKYCIATIF---ISRQRQTFLNLAQFKCVLVISYPSIIHSYFSGLSELVV-IVMSAPFLHNTASTCGNKRTACMVISFLNFSG--FISLIEQNSTVSLKGLQFLILDEADRMLDMGFEPAIRRIVESMGMPDKSERQTLMFSATFPEEIQ 420          
BLAST of Nipped-B protein vs. Ensembl Nematostella
Match: VAS2 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNU5])

HSP 1 Score: 180.644 bits (457), Expect = 9.577e-86
Identity = 81/150 (54.00%), Postives = 111/150 (74.00%), Query Frame = 3
Query:  741 AAFLIPIINHLISQDLSPQRYTKTAYPKCLILAPTRELAIQILSESQKFSLNTQMRSCVVYGGADTHSQIREVQIGCHLLVATPGRLVDFIEKNKISLEMCKYIVLDEADRMLDMGFEPQIRKIIEESNMPSGINRQTLMFSATFPKEIQ 1190
            AAFL+P++  +++  L+   +++T  P+ + +APTRELA QI  E++KF+  T +R  V YGG     Q+R++Q GC+LLV TPGRL DFIEK K+SL+  ++++LDEADRMLDMGFEP IR+I+E   MP    RQTLMFSATFP+EIQ
Sbjct:    4 AAFLLPVMTSMMNAGLTSSSFSETQTPQAMCIAPTRELANQIYLEARKFAHGTMLRPVVCYGGVSVSHQLRQLQSGCNLLVGTPGRLTDFIEKGKVSLKGLQFLILDEADRMLDMGFEPAIRRIVESMGMPDKSERQTLMFSATFPEEIQ 153          

HSP 2 Score: 157.918 bits (398), Expect = 9.577e-86
Identity = 76/133 (57.14%), Postives = 99/133 (74.44%), Query Frame = 2
Query: 1256 KLAADFLYNYIFMTVGRVGSTSDSIKQEIIYMTDVEKLNYLKNIFNTTAPNTLILIFVETKKGADSLARFLLSKGYPVSSIHGDRNQGEREHALNMFRNGQCPILVATAVAARGLDIPNVKHVINYDLPSDIE 1654
            +LA DFL +Y+F+TVGRVG T+  I+Q +I +TD EK + L  I      +   L+FVE+K+ AD LA FL  +G+P +SIHGDR Q ERE AL+ FR G+CP+L+AT VAARGLDI +VKHVIN+DLPSDI+
Sbjct:  154 RLAGDFLNDYLFLTVGRVGGTTSDIEQTVIEVTDNEKRDRLTQILGDAGTDR-TLVFVESKRSADFLAIFLSGEGFPTTSIHGDRLQQEREEALDDFRKGRCPVLIATNVAARGLDIDDVKHVINFDLPSDID 285          
BLAST of Nipped-B protein vs. Ensembl Nematostella
Match: EDO38061 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDX5])

HSP 1 Score: 170.629 bits (431), Expect = 1.547e-79
Identity = 90/203 (44.33%), Postives = 122/203 (60.10%), Query Frame = 3
Query:  582 VENFDELKLNPIIRNNILLASYQRPTPIQKNAIPAILEHRDIMACAQTGSGKTAAFLIPIINHLISQDLSPQRYTKTAYPKCLILAPTRELAIQILSESQKFSLNTQMRSCVVYGGADTHSQIREVQIGCHLLVATPGRLVDFIEKNKISLEMCKYIVLDEADRMLDMGFEPQIRKIIEESNMPSGINRQTLMFSATFPKEIQ 1190
            V  F+E      I++      +  PT IQ    P  L  R+++  AQTGSGKT +F++P I H+  Q L          P  L+L PTRELA Q+   +     + ++RS  +YGGA    QIRE++ G  + +ATPGRL+D +E  K +L  C Y+VLDEADRMLDMGFEPQIR II++       +RQTLM+SAT+PKE+Q
Sbjct:   57 VTTFEESAFPDYIQSYFKREGFTEPTMIQAQGWPVALTGRNLVGIAQTGSGKTLSFILPGIVHINHQPL----LQPGDGPIVLVLCPTRELAQQVQEVAYSVGKHCKLRSTCIYGGAPKGPQIRELERGVEICIATPGRLIDMLESRKTNLRRCTYLVLDEADRMLDMGFEPQIRTIIDQIRP----DRQTLMWSATWPKEVQ 251          

HSP 2 Score: 147.517 bits (371), Expect = 1.547e-79
Identity = 85/181 (46.96%), Postives = 110/181 (60.77%), Query Frame = 2
Query: 1259 LAADFLYNYIFMTVGRVGSTSD-SIKQEIIYMTDVEK----LNYLKNIFNTTAPNTLILIFVETKKGADSLARFLLSKGYPVSSIHGDRNQGEREHALNMFRNGQCPILVATAVAARGLDIPNVKHVINYDLPSDIEEYVHRIGRTGRLGNHGRATSFYVDKNNNIAIDLVDLLKEANQIV 1786
            LA DFL +Y+ +TVG +G T++  I Q +    D EK    L  L+ I       TLI  F ETK+ AD L R L S G+P   IHGD+ Q ER+  L+ FR G  PILVAT VA+RGLDI ++K VIN+D P+  E+YVHRIGRT R    G + +F+   N   A +LV +L+EA Q V
Sbjct:  253 LAHDFLSDYVHITVGSLGLTANHKILQIVDVCEDHEKEHKLLKLLEEIMGEKENKTLI--FTETKRRADELTRKLRSDGWPAMCIHGDKAQPERDWVLSEFRKGHAPILVATDVASRGLDISDIKFVINFDFPNCTEDYVHRIGRTARSDRTGTSYTFFTVNNAKQAKELVSVLQEAKQHV 431          
BLAST of Nipped-B protein vs. Ensembl Medaka
Match: ENSORLT00000009536.2 (nipped-B-like protein [Source:NCBI gene;Acc:101156754])

HSP 1 Score: 683.715 bits (1763), Expect = 0.000e+0
Identity = 376/901 (41.73%), Postives = 565/901 (62.71%), Query Frame = 1
Query: 4303 DKVQILRDALLDYLN-ADKFDTTAKYAREFYFGQWYTDCVKE----LKSQNNQAIAISXXXXXXXXXXXXXXXXXXXXXXXXXXXXISIFQKAEDRRNHLLYKMFGTLPDESKKSKNNRINKLRIGSNPENNRYDIRLKGSLDYEDACLVCRYLASLKSSSQSFDIYLTKICRLLHDPSVALRTKAMRCLSAVVEADPTILRRDDIEKAVHLRFLDSSTSVREAAVELVGKYLLTRPELIDQYYPMIAERILDKGTSVRKRVIRIFRDICVEHTEFSKIPEICVKMIKRINDEEAIKKLVNEVFQNMWFSPVREKEGVKLLQKVMNITDVVSSCKDIGYEWFDQLLESLLKKEDSDKLRVVEKACKQIVDCLVQNIMRLEEISRD------DNQRLVSCMATLHLFTKIRPELMVQYTMTLQPYLNIRNVNDNDTYILHYVARILEVTVPLIEHPAQNHINQLEVDMVNLIDKQGKMVLESCVACLAASVNKISHNYSLVKDCFDNYFDTL--LKYRMEKDQTKTLPQATKRRILSRGLFTVGLLCKYFDFNCLQL-GKD---INIRIFETLMFYAEDNTLSCDIRTQAISGIGFLCIRYRELLICPRLLSFYHSILMNSLENTKTEDFPNLICCVLDNIYLFLVEEDDRLRHLDSSWKNNEKKESLKEMGDMSSGTGSHIAQLYLNAILENILQPWKPVRLKAVSLVVIIIRQGLINPISSVAYLISAQTDPNPSNRGKADNELAEIDKKFSGFINMKAVQGIRTSCKLQEVLEMYNIPENRLNWCSKHMLTTPVIVRGVYDHNADIPLALNHNLYTMLRSSKQFRRSFLYALLAIFGE-LKSRISLLIYVSENLAQFPYQSQEEPLYLVHNIDIMVSSIGPHFTQQIRDQLYPELVAHE 6951
            D++Q L+ ALL +L+ +   D    +AR FY  QWY D   E    LKSQN+                        ++ +    +   I QKAE R+   L K+         K+ ++ I   R+ S+            ++DYED+CL+ RYLAS++  +QSFDIYL++I R+L + ++A+RTKAM+CL  VV  DP+IL R D+++ VH R +D+STSVREAAVEL+G+++L+RPELI+QYY M+ ERILD G SVRKRVI+I RDIC+E  +F KI E+CVKMI+R+NDEE IKKLVNE FQ +WFSP    +   + +K++NITDVV +CKD GY+WF+QLL++LLK E++   +  +KAC Q+VD LV++I++ +E   D      ++ RLVSC+ TL LFTKIRP+LM+++ MT+QPYL  +  + N   ++  VA+ILE+ VPL+E+P++  +  +E D++ LI K G  V++ CV+CL A +NK++HNY  V  CF+ ++  L  LK ++++D + +   AT +  L R LFTVG LC++FDF+  +  G +   I  ++ E L+ +         I+  AI G+GF  I + EL+    +   Y++IL  S EN+      NL   +L N+  +L EED R++  D  WK   K+E LKEMGD+SSG  S I Q+YL  +LE+       VR  A++++ + + QGLI+P+  V YLI+  TDP P+ + KAD +L EIDKK+SGFI+MKAV G++ S ++Q+ +                  +  V++RG Y H+ D   AL  +LYTM+R ++Q RR+FL +LL +F +  K+ +++L+++++NLA FPYQ+Q+EPL+++H+IDI +S  G +  Q   + L  E V  E
Sbjct: 1483 DEIQQLQKALLSFLDESSDTDPALAFARNFYIAQWYRDTTTEVEKALKSQNDD------------------EDTKFHHLSKEDDSTEEIVQKAESRKK-FLRKVI--------KTSSSNITSQRMNSD------------TVDYEDSCLIVRYLASMRPFAQSFDIYLSQILRVLGESAIAVRTKAMKCLCEVVAVDPSILARLDMQRGVHCRLMDNSTSVREAAVELLGRFVLSRPELIEQYYDMLIERILDTGISVRKRVIKILRDICLELPDFHKITEMCVKMIRRVNDEEGIKKLVNETFQKLWFSPTPNHDKEAMTRKILNITDVVLACKDSGYDWFEQLLQNLLKSEENASYKPAKKACVQLVDNLVEHILKYDESLADCEEKGINSSRLVSCITTLLLFTKIRPQLMIKHAMTIQPYLTTKCNSQNVFMVICNVAKILELVVPLMENPSETFLTTIEEDLMKLIVKHGMTVVQHCVSCLGAIINKVTHNYKFVWACFNRFYGALAKLKTQLQEDPSSST-LATNKPTLLRALFTVGALCRHFDFDQEEFKGANKIVIKDKVLELLLCFTTHEEEEVQIK--AIIGLGFQFIMHPELMFVQDVKVLYNNIL--SDENSSV----NLKIQILKNLQTYLQEEDSRMQEADREWKKQAKQEDLKEMGDVSSGMSSSIMQIYLKQVLESFFHSHSTVRHFALNVITLTLNQGLIHPVQCVPYLIAMGTDPEPTMKNKADQQLVEIDKKYSGFIHMKAVAGLKMSYQVQQAING----------------SKDVVIRG-YRHD-DSDSALCSHLYTMVRGNRQHRRAFLISLLNLFDDSSKAEVNMLLFIADNLACFPYQTQDEPLFIMHHIDITLSVSGSNLLQSFNECLRKEPVRPE 2317          

HSP 2 Score: 315.464 bits (807), Expect = 1.302e-85
Identity = 198/467 (42.40%), Postives = 291/467 (62.31%), Query Frame = 1
Query: 2713 ITESTTYQHFISLVDGCLEVVEDLDLIKTMKEQTEXXXXXXXXXXXXXXREQLQAMCIEIAKLKATGSTKEVPMEKLTKILTLLMLNISSGAKVCLPVTEDGE---DNRLFKELAFERIGRSLDASFITINIMTSPDISNGVFIEDVQEAVVTSVKYQLVNLIFPEYDPAYRTVNHAKDNQSSIKAKRAREKELHKSKNIVYFYNRLVDIISNLSELVVIQTLTDNVILQLSSLGVSVFFVENISELQLVSLRLITTIFSKYEKHRNLIMDDIIASLSRLPSSKKNMRNYRLNSEDS------IQMLTAXXXXXXXXXXXXXKIEMNSNESEETALSVAPDKIVKETPKADSEAVIETSYNNAFATAYSFLRIFLHKSTVK-GEDDYRAIFENFVSDLLVTVNKPEWPAAETMLTLLGSLLTNQFINKHSDQTTRLICIDYLGTVASTLRRDAVSSTINPSDIENLI 4083
            + +S+T++ F + +D  LE +ED+DL +T  +  E      L       ++QL  +  +  K+K  G   +    K+ KIL +L  NI    K+   +++D E   + RL+++L  ER+ +S DA    +NIMTSP +   V+IEDV E V+   K+ L N ++P+YDPAYR   H   +  S KAK +  K+    K +V  YN++ DIISN+SEL+ IQ LTD  ILQ+S+LG++ FFVEN+SELQL ++ L+T +FS+YEKHR LI+++I  SL+RLP++K+ +RN+RLN+ DS      IQM++AL L L+Q VV +   + N +E ++               K D +  I  SY  A  TA +FL +FL K   K GEDDYR +FENF+ DLL  VNKPEWPAAE +L+LLG LL +QF NK ++   R+  +DYLGTVAS LR+DAV++ ++  DI+ ++
Sbjct: 1035 MMDSSTFKRFTASMDNILESLEDVDLNETEDDDDEIPPEYLLG------KQQLSELSSDSNKIKMMGIFNKFSSSKMVKILNILEKNIQDSVKLSTLMSQDNESMDEERLWRDLIMERVTKSADACLTALNIMTSPRMPKAVYIEDVIERVLQFTKFHLQNTLYPQYDPAYRLDRHGGGSSKSKKAKFSSHKQ----KVVVVLYNKVCDIISNISELLEIQLLTDTTILQVSNLGITPFFVENVSELQLCAITLVTAVFSRYEKHRQLILEEIFNSLARLPTNKRGLRNFRLNNCDSDGEGLYIQMVSALVLQLIQCVVRLPFEKENEDEQKK---------------KVDKDVFITNSYETAMRTAQNFLSVFLKKCGSKQGEDDYRPLFENFIHDLLSAVNKPEWPAAELLLSLLGRLLVHQFSNKQTEMALRVASLDYLGTVASRLRKDAVANKMDQKDIDRIL 1476          
BLAST of Nipped-B protein vs. Ensembl Medaka
Match: nipbla (NIPBL cohesin loading factor [Source:NCBI gene;Acc:101173229])

HSP 1 Score: 682.174 bits (1759), Expect = 0.000e+0
Identity = 404/1074 (37.62%), Postives = 618/1074 (57.54%), Query Frame = 1
Query: 4303 DKVQILRDALLDYLNAD-KFDTTAKYAREFYFGQWYTDCVKEL-KSQNNQAIAISXXXXXXXXXXXXXXXXXXXXXXXXXXXXISIFQKAEDRRNHLLYKMFGTLPDESKKSKNNRINKLRIGSNPENNRYDIRLKGSLDYEDACLVCRYLASLKSSSQSFDIYLTKICRLLHDPSVALRTKAMRCLSAVVEADPTILRRDDIEKAVHLRFLDSSTSVREAAVELVGKYLLTRPELIDQYYPMIAERILDKGTSVRKRVIRIFRDICVEHTEFSKIPEICVKMIKRINDEEAIKKLVNEVFQNMWFSPVREKEGVKLLQKVMNITDVVSSCKDIGYEWFDQLLESLLKKEDSDKLRVVEKACKQIVDCLVQNIMRLEEISRD----DNQRLVSCMATLHLFTKIRPELMVQYTMTLQPYLNIRNVNDNDTYILHYVARILEVTVPLIEHPAQNHINQLEVDMVNLIDKQGKMVLESCVACLAASVNKISHNYSLVKDCFDNYFDTLLKYRME-KDQTKTLPQATKRRILSRGLFTVGLLCKYFDFNCLQLGKD----INIRIFETLMFYAEDNTLSCDIRTQAISGIGFLCIRYRELLICPRLLSFYHSILMNSLENTKTEDFPNLICCVLDNIYLFLVEEDDRLRHLDSSWKNNEKKESLKEMGDMSSGTGSHIAQLYLNAILENILQPWKPVRLKAVSLVVIIIRQGLINPISSVAYLISAQTDPNPSNRGKADNELAEIDKKFSGFINMKAVQGIRTSCKLQEVLEMYNIPENRLNWCSKHMLTTPVIVRGVYDHNADIPLALNHNLYTMLRSSKQFRRSFLYALLAIFGE-LKSRISLLIYVSENLAQFPYQSQEEPLYLVHNIDIMVSSIGPHFTQQIRD----QLYPELVA------------HEFNSD-PSSNHPATKPDTIHIDDEEN----PEVLYKRLM---------------DNPKALRNMRESIRN-------SRGCVLLISLKQYLRELYSLTDA*FDFNYG***YXXXXXXXGFRKIQKYSPLDTGKAWERQLTRRNGIRFDPLVALNLTEETVAQENI 7359
            D+ Q L+ ALLDYL  + + D +  +AR+FY  QW+ D   E  KS  NQ                ++ +++             I Q+AE RR   L  +  T P             L++ S+            ++DYED+CL+ RYLAS++  +QSFDIYLT+I R+L + ++A+RTKAM+CLS VV  DP+IL R ++++ VH R +D+STSVREAAVEL+GK++L+RP+L +QYY M+ ERILD G SVRKRVI+I RDIC+E   FSKI E+CVKMI+R+NDEE IKKLVNE FQ +WF+P    +   + +K++NITDVV++C+D GY+WF+QLL++LLK E+    +  +KAC Q+VD LV++I++ EE   +    ++ RLV+C+ TL+LF+KIR +LMV++ MT+QPYL  +    ND  ++  VA+ILE+ VPL+EHP++  +  +E D++ LI K G  V++ CV+CL A VNK++HNY  V  CF+ ++  L K +++ ++   +      +  L R LFTVG L ++FDF+  +   +    I  ++ E L+++ +      +++T+AI G+GFL I +   +  P + + Y+ IL +   +       NL   VL N+  +L EED R++  D  WK   K+E LKEMGD+SSG  S I QLYL  +LE        VR  A++++ + + QGLI+P+  V YLI+  TDP P+ R K+D +L EIDKK++GFI+MKAV G++ S  LQ+ +   N P                 +RG          AL  +LYTM+R ++Q RR+FL +LL +F +  K+ +++L+++++NLA FPYQSQEEPL+++H+IDI +S  G +  Q  R+     +Y + V              E N D P S         I  D++E+    P+   K +                D  K +R + ES           +G +LL+ LKQ+L+ LY  +D+                     KIQKYSP ++ K +++ + R++ + F P   ++     +A   +
Sbjct: 1143 DETQQLQKALLDYLEENAETDPSLVFARKFYVAQWFRDATTEAEKSMRNQ-------------NPKDEDSSDGPQHAKEMETTGEIMQRAE-RRKKFLRGIIKTTP--------AHFATLKMNSD------------TVDYEDSCLIVRYLASMRPFAQSFDIYLTQILRVLGESAIAVRTKAMKCLSEVVAVDPSILARSEMQRGVHGRLMDNSTSVREAAVELLGKFVLSRPQLTEQYYDMLIERILDTGISVRKRVIKILRDICLEQPTFSKITEMCVKMIRRVNDEEGIKKLVNETFQKLWFTPTPAHDKETMTRKILNITDVVAACRDTGYDWFEQLLQNLLKSEEDASYKPAKKACVQLVDNLVEHILKYEESLAENKGVNSTRLVACITTLYLFSKIRAQLMVKHAMTMQPYLTTKCNTANDFMVICNVAKILELVVPLMEHPSETFLATIEEDLMKLIIKHGMTVVQHCVSCLGAVVNKVTHNYKFVMACFNKFYTALNKLKIQHQEDPNSSSLVVNKPFLLRSLFTVGALARHFDFDLEEFKGNNKVVIKEKVLELLLYFTKHE--EEEVKTKAIIGLGFLVIMHPSQMFVPEVKALYNGILADGSSSI------NLKIQVLKNLQTYLQEEDTRMQEADREWKKLSKQEDLKEMGDISSGMSSSIMQLYLKQVLEAFFHTQSSVRHFALNVIALTLNQGLIHPVQCVPYLIAMGTDPEPTMRNKSDQQLVEIDKKYTGFIHMKAVAGMKMSYSLQQAI---NSPRK-------------TTIRGFRQDETHT--ALCSHLYTMIRGNRQHRRAFLISLLNLFDDSAKTEVNMLLFIADNLACFPYQSQEEPLFIMHHIDITLSVSGSNLLQTFREVGIISIYKKKVKEWVNTSDGEDKEEEMNCDSPRSEKEENGNSEIENDEDEDVVRRPKKTRKPIANSSDSESDFEDLAVEDADKVMRLLPESPTGLLDFANAVQGILLLLVLKQHLKNLYGFSDS---------------------KIQKYSPTESAKVYDKAVNRKSNVHFHPRQTIDFISNNMAHATL 2135          

HSP 2 Score: 295.434 bits (755), Expect = 1.395e-79
Identity = 195/476 (40.97%), Postives = 280/476 (58.82%), Query Frame = 1
Query: 2713 ITESTTYQHFISLVDGCLEVVEDLDLIKTMKEQTEXXXXXXXXXXXXXXREQLQAMCIEIAKLKATGSTKEVPMEKLTKILTLLMLNISSGAKVCLPVT--EDGEDN-RLFKELAFERIGRSLDASFITINIMTSPDISNGVFIEDVQEAVVTSVKYQLVNLIFPEYDPAYRTVNHAKDNQSSIKAKRAREKELHKSKNIVYFYNRLVDIISNLSELVVIQTLTDNVILQLSS-----LGVSVFFVENISEL-QLVSLRLITTIFSKYEKHRNLIMDDIIASLSRLPSSKKNMRNYRLNSEDS------IQMLTAXXXXXXXXXXXXXKIEMNSNESEETALSVAPDKIVKET--PKADSEAVIETSYNNAFATAYSFLRIFLHKSTVK-GEDDYRAIFENFVSDLLVTVNKPEWPAAETMLTLLGSLLTNQFINKHSDQTTRLICIDYLGTVASTLRRDAVSSTINPSDIENLII 4086
            + +S+T++ F++ +D  L+ +ED+D      ++   ++ +         + Q+  +  E AK+KA G T  +P +KL K+L +L  NI  G+K+   +   +D ED  RL+++L  ER+ +S DA    +N+MTS  +   V+IEDV E V+   K+ L N ++P+YDP YR   H     SS KAKRA+    HK + IV  YN++ DI+SN+SEL+ IQ LTD  ILQL          S FF  N S     + L+    +FS+YEKHR LI+++I  SL+RLP+SK+++RN+RLNS D       IQM+TAL L L+                 +  + +  DK V E    K D + +I  SY  A  TA +FL +FL K   K GE+DYR +FENFV DLL TVNKPEWPAAE +L+LLG LL +QF NK ++   R+  +DYLGTVAS LR+DAV+S ++   I+ L I
Sbjct:  688 LMDSSTFKRFLASIDNILDSLEDVDFTAMDDDEIPQELLLG--------KHQVNELGSESAKIKAMGITGRIPSDKLVKLLNILEKNIQDGSKLSTLMNHDQDAEDEERLWRDLIMERVTKSADACLTALNVMTSARMPKAVYIEDVIERVLQYTKFHLQNTLYPQYDPVYRVDPHGGGMLSS-KAKRAK-CSTHKQRVIVMLYNKVCDIVSNISELLEIQLLTDTTILQLHPRCLLLTSFSGFFNGNHSFFCGELFLKFSIYVFSRYEKHRQLILEEIFTSLARLPTSKRSLRNFRLNSSDQDGEPMYIQMVTALVLQLI-----------------QCVVHLPSDKDVFEEFENKVDQDVLITNSYETAMRTARNFLSVFLKKCGSKQGEEDYRPLFENFVQDLLSTVNKPEWPAAELLLSLLGRLLVHQFSNKQTEMALRVASLDYLGTVASRLRKDAVTSKMDQRSIDRLHI 1136          
BLAST of Nipped-B protein vs. Ensembl Medaka
Match: ddx3xa (DEAD-box helicase 3 X-linked [Source:NCBI gene;Acc:101158982])

HSP 1 Score: 283.493 bits (724), Expect = 2.833e-148
Identity = 134/235 (57.02%), Postives = 171/235 (72.77%), Query Frame = 3
Query:  510 SAINFDKYDAIPVSVTGPDYSAINVENFDELKLNPIIRNNILLASYQRPTPIQKNAIPAILEHRDIMACAQTGSGKTAAFLIPIINHLISQDLSPQ------RYTKTA-YPKCLILAPTRELAIQILSESQKFSLNTQMRSCVVYGGADTHSQIREVQIGCHLLVATPGRLVDFIEKNKISLEMCKYIVLDEADRMLDMGFEPQIRKIIEESNMPSGINRQTLMFSATFPKEIQV 1193
            + INF+KYD IPV  TG +    ++E+F ++ +  I+  NI L  Y RPTP+QK AIP I   RD+MACAQTGSGKTAAFL+P+++ + S            RY +   YP  L+LAPTRELA+QI  E++KF+  +++R CVVYGGAD   QIRE++ GCHLLVATPGRLVD +E+ KI L+ C Y+VLDEADRMLDMGFEPQIR+I+E+  MP    RQT+MFSATFPKEIQ+
Sbjct:  125 TGINFEKYDDIPVEATGSNCPP-HIESFHDVDMGEIVMGNIALTRYDRPTPVQKYAIPIIKTKRDLMACAQTGSGKTAAFLLPVLSQIYSDGPGDALQADNGRYGRRKQYPLSLVLAPTRELALQIYDEARKFAYRSRVRPCVVYGGADIGQQIRELERGCHLLVATPGRLVDMMERGKIGLDYCNYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGIRQTMMFSATFPKEIQI 358          

HSP 2 Score: 265.388 bits (677), Expect = 2.833e-148
Identity = 131/217 (60.37%), Postives = 166/217 (76.50%), Query Frame = 2
Query: 1259 LAADFLYNYIFMTVGRVGSTSDSIKQEIIYMTDVEKLNYLKNIFNTTAPNTLILIFVETKKGADSLARFLLSKGYPVSSIHGDRNQGEREHALNMFRNGQCPILVATAVAARGLDIPNVKHVINYDLPSDIEEYVHRIGRTGRLGNHGRATSFYVDKNNNIAIDLVDLLKEANQIVPQWLSALADELKRNSVIGSNNKRHNQRRFKNGNFGGRDYRQ 1909
            LA DFL +YIF+ VGRVGSTS++I Q+++++ D +K ++L ++ N T  ++L L+FVETKKGAD+L  FL  +GY  +SIHGDR+Q +RE AL+ FR+G CPILVATAVAARGLDI NVKHVIN+DLPSDIEEYVHRIGRTGR+GN G ATSF+ DKN+NI  DL+D+L EA Q VP WL +LA E +  S          ++RF +G FG RDYRQ
Sbjct:  359 LARDFLEDYIFLAVGRVGSTSENITQKVVWVEDNDKRSFLLDLLNATGKDSLTLVFVETKKGADALEDFLYREGYACTSIHGDRSQRDREEALHQFRSGHCPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNDKNSNITKDLLDILVEAKQEVPSWLESLAYEHQHKS------STRGRKRF-SGGFGARDYRQ 568          
BLAST of Nipped-B protein vs. Ensembl Medaka
Match: ddx3xa (DEAD-box helicase 3 X-linked [Source:NCBI gene;Acc:101158982])

HSP 1 Score: 281.952 bits (720), Expect = 7.816e-148
Identity = 134/241 (55.60%), Postives = 171/241 (70.95%), Query Frame = 3
Query:  510 SAINFDKYDAIPVSVTGPDYSAINVENFDELKLNPIIRNNILLASYQRPTPIQKNAIPAILEHRDIMACAQTGSGKTAAFLIPIINHLISQDLSPQ------------RYTKTA-YPKCLILAPTRELAIQILSESQKFSLNTQMRSCVVYGGADTHSQIREVQIGCHLLVATPGRLVDFIEKNKISLEMCKYIVLDEADRMLDMGFEPQIRKIIEESNMPSGINRQTLMFSATFPKEIQV 1193
            + INF+KYD IPV  TG +    ++E+F ++ +  I+  NI L  Y RPTP+QK AIP I   RD+MACAQTGSGKTAAFL+P+++ + S                  RY +   YP  L+LAPTRELA+QI  E++KF+  +++R CVVYGGAD   QIRE++ GCHLLVATPGRLVD +E+ KI L+ C Y+VLDEADRMLDMGFEPQIR+I+E+  MP    RQT+MFSATFPKEIQ+
Sbjct:  173 TGINFEKYDDIPVEATGSN-CPPHIESFHDVDMGEIVMGNIALTRYDRPTPVQKYAIPIIKTKRDLMACAQTGSGKTAAFLLPVLSQIYSDGPGDALQAAKNNGQDNGRYGRRKQYPLSLVLAPTRELALQIYDEARKFAYRSRVRPCVVYGGADIGQQIRELERGCHLLVATPGRLVDMMERGKIGLDYCNYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGIRQTMMFSATFPKEIQI 412          

HSP 2 Score: 265.388 bits (677), Expect = 7.816e-148
Identity = 131/217 (60.37%), Postives = 166/217 (76.50%), Query Frame = 2
Query: 1259 LAADFLYNYIFMTVGRVGSTSDSIKQEIIYMTDVEKLNYLKNIFNTTAPNTLILIFVETKKGADSLARFLLSKGYPVSSIHGDRNQGEREHALNMFRNGQCPILVATAVAARGLDIPNVKHVINYDLPSDIEEYVHRIGRTGRLGNHGRATSFYVDKNNNIAIDLVDLLKEANQIVPQWLSALADELKRNSVIGSNNKRHNQRRFKNGNFGGRDYRQ 1909
            LA DFL +YIF+ VGRVGSTS++I Q+++++ D +K ++L ++ N T  ++L L+FVETKKGAD+L  FL  +GY  +SIHGDR+Q +RE AL+ FR+G CPILVATAVAARGLDI NVKHVIN+DLPSDIEEYVHRIGRTGR+GN G ATSF+ DKN+NI  DL+D+L EA Q VP WL +LA E +  S          ++RF +G FG RDYRQ
Sbjct:  413 LARDFLEDYIFLAVGRVGSTSENITQKVVWVEDNDKRSFLLDLLNATGKDSLTLVFVETKKGADALEDFLYREGYACTSIHGDRSQRDREEALHQFRSGHCPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNDKNSNITKDLLDILVEAKQEVPSWLESLAYEHQHKSST------RGRKRF-SGGFGARDYRQ 622          
BLAST of Nipped-B protein vs. Ensembl Medaka
Match: ddx3xa (DEAD-box helicase 3 X-linked [Source:NCBI gene;Acc:101158982])

HSP 1 Score: 281.952 bits (720), Expect = 9.702e-148
Identity = 134/241 (55.60%), Postives = 171/241 (70.95%), Query Frame = 3
Query:  510 SAINFDKYDAIPVSVTGPDYSAINVENFDELKLNPIIRNNILLASYQRPTPIQKNAIPAILEHRDIMACAQTGSGKTAAFLIPIINHLISQDLSPQ------------RYTKTA-YPKCLILAPTRELAIQILSESQKFSLNTQMRSCVVYGGADTHSQIREVQIGCHLLVATPGRLVDFIEKNKISLEMCKYIVLDEADRMLDMGFEPQIRKIIEESNMPSGINRQTLMFSATFPKEIQV 1193
            + INF+KYD IPV  TG +    ++E+F ++ +  I+  NI L  Y RPTP+QK AIP I   RD+MACAQTGSGKTAAFL+P+++ + S                  RY +   YP  L+LAPTRELA+QI  E++KF+  +++R CVVYGGAD   QIRE++ GCHLLVATPGRLVD +E+ KI L+ C Y+VLDEADRMLDMGFEPQIR+I+E+  MP    RQT+MFSATFPKEIQ+
Sbjct:  209 TGINFEKYDDIPVEATGSN-CPPHIESFHDVDMGEIVMGNIALTRYDRPTPVQKYAIPIIKTKRDLMACAQTGSGKTAAFLLPVLSQIYSDGPGDALQAAKNNGQDNGRYGRRKQYPLSLVLAPTRELALQIYDEARKFAYRSRVRPCVVYGGADIGQQIRELERGCHLLVATPGRLVDMMERGKIGLDYCNYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGIRQTMMFSATFPKEIQI 448          

HSP 2 Score: 265.003 bits (676), Expect = 9.702e-148
Identity = 131/217 (60.37%), Postives = 166/217 (76.50%), Query Frame = 2
Query: 1259 LAADFLYNYIFMTVGRVGSTSDSIKQEIIYMTDVEKLNYLKNIFNTTAPNTLILIFVETKKGADSLARFLLSKGYPVSSIHGDRNQGEREHALNMFRNGQCPILVATAVAARGLDIPNVKHVINYDLPSDIEEYVHRIGRTGRLGNHGRATSFYVDKNNNIAIDLVDLLKEANQIVPQWLSALADELKRNSVIGSNNKRHNQRRFKNGNFGGRDYRQ 1909
            LA DFL +YIF+ VGRVGSTS++I Q+++++ D +K ++L ++ N T  ++L L+FVETKKGAD+L  FL  +GY  +SIHGDR+Q +RE AL+ FR+G CPILVATAVAARGLDI NVKHVIN+DLPSDIEEYVHRIGRTGR+GN G ATSF+ DKN+NI  DL+D+L EA Q VP WL +LA E +  S          ++RF +G FG RDYRQ
Sbjct:  449 LARDFLEDYIFLAVGRVGSTSENITQKVVWVEDNDKRSFLLDLLNATGKDSLTLVFVETKKGADALEDFLYREGYACTSIHGDRSQRDREEALHQFRSGHCPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNDKNSNITKDLLDILVEAKQEVPSWLESLAYEHQHKSST------RGRKRF-SGGFGARDYRQ 658          
BLAST of Nipped-B protein vs. Planmine SMEST
Match: SMESG000051020.1 (SMESG000051020.1)

HSP 1 Score: 3416.32 bits (8857), Expect = 0.000e+0
Identity = 1848/1913 (96.60%), Postives = 1865/1913 (97.49%), Query Frame = 1
Query: 2092 SYENIDXXXXXXXXXXXXXXXXXXDGLKTWFVGSGPQKDANGEVVDLTVNQESNWDKTLGSYSQXXXXXXXXXXXXXXXXSENSAFVFENDEEYVEATNVSNNADESDSYTDVSKRTLRNNSINYVGMEDGVENSDDISQSRAKKRKKDDDEPFEVKLKDPNEIKYPHIKKSQEINHKRRERVNGLTKLSNTTKKVQLPLDMLDPSLITESTTYQHFISLVDGCLEVVEDLDLIKTMKEQTEXXXXXXXXXXXXXXREQLQAMCIEIAKLKATGSTKEVPMEKLTKILTLLMLNISSGAKVCLPVTEDGEDNRLFKELAFERIGRSLDASFITINIMTSPDISNGVFIEDVQEAVVTSVKYQLVNLIFPEYDPAYRTVNHAKDNQSSIKAKRAREKELHKSKNIVYFYNRLVDIISNLSELVVIQTLTDNVILQLSSLGVSVFFVENISELQLVSLRLITTIFSKYEKHRNLIMDDIIASLSRLPSSKKNMRNYRLNSEDSIQMLTAXXXXXXXXXXXXXKIEMNSNESEETALSVAPDKIVKETPKADSEAVIETSYNNAFATAYSFLRIFLHKSTVKGEDDYRAIFENFVSDLLVTVNKPEWPAAETMLTLLGSLLTNQFINKHSDQTTRLICIDYLGTVASTLRRDAVSSTINPSDIENLIIDLIKGSKSSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-XXARGTKKKNSDINHKSQYNKLLKNIDKVQILRDALLDYLNADKFDTTAKYAREFYFGQWYTDCVKELKSQNNQAIAISXXXXXXXXXXXXXXXXXXXXXXXXXXXXISIFQKAEDRRNHLLYKMFGTLPDESKKSKNNRINKLRIGSNPENNRYDIRLKGSLDYEDACLVCRYLASLKSSSQSFDIYLTKICRLLHDPSVALRTKAMRCLSAVVEADPTILRRDDIEKAVHLRFLDSSTSVREAAVELVGKYLLTRPELIDQYYPMIAERILDKGTSVRKRVIRIFRDICVEHTEFSKIPEICVKMIKRINDEEAIKKLVNEVFQNMWFSPVREKEGVKLLQKVMNITDVVSSCKDIGYEWFDQLLESLLKKEDSDKLRVVEKACKQIVDCLVQNIMRLEEISRDDNQRLVSCMATLHLFTKIRPELMVQYTMTLQPYLNIRNVNDNDTYILHYVARILEVTVPLIEHPAQNHINQLEVDMVNLIDKQGKMVLESCVACLAASVNKISHNYSLVKDCFDNYFDTLLKYRMEKDQTKTLPQATKRRILSRGLFTVGLLCKYFDFNCLQLGKDINIRIFETLMFYAEDNTLSCDIRTQAISGIGFLCIRYRELLICPRLLSFYHSILMNSLENTKTEDFPNLICCVLDNIYLFLVEEDDRLRHLDSSWKNNEKKESLKEMGDMSSGTGSHIAQLYLNAILENILQPWKPVRLKAVSLVVIIIRQGLINPISSVAYLISAQTDPNPSNRGKADNELAEIDKKFSGFINMKAVQGIRTSCKLQEVLEMYNIPENRLNWCSKHMLTTPVIVRGVYDHNADIPLALNHNLYTMLRSSKQFRRSFLYALLAIFGELKSRISLLIYVSENLAQFPYQSQEEPLYLVHNIDIMVSSIGPHFTQQIRDQLYPELVAHEFNSDPSSNHPATKPDTIHIDDEENPEVLYKRLMDNPKALRNMRESIRNSRGCVLLISLKQYLRELYSLTDA*FDFNYG***YXXXXXXXGFRKIQKYSPLDTGKAWERQLTRRNGIRFDPLVALNLTEETVAQENIYQKFVTDVQQTDINLDADLYPNEGYILINKFLHLRQLVMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPNRMKSSYSQNNNRPDNHHTANFXXXXXXXXXXXXXXXXXXXXXXXGNGSHPPSIVDHDAIISKSNSHHMAFIQGQNLRVEVDKL 7827
            SYENIDNLRKLKFRKNNKKRKNELDGLKTWFVGSGPQKDANGEVVDLTVNQESNWDKTLGSYSQKMTVKARKRKRTVKQTSENSAFVFENDEEYVEATNVSNNADESDSYTDVSKRTLRNNSINYVGMEDGVENSDDISQSRAKKRKKDDDEPFEVKLKDPNEIKYPHIKKSQEINHKRRERVNGLTKLSNTTKKVQLPLDMLDPSLITESTTYQHFISLVDGCLEVVEDLDLIKTMKEQTESDIPISLPPDILISREQLQAMCIEIAKLKATGSTKEVPMEKLTKILTLLMLNISSGAKVCLPVTEDGEDNRLFKELAFERIGRSLDASFITINIMTSPDISNGVFIEDVQEAVVTSVKYQLVNLIFPEYDPAYRTVNHAKDNQSSIKAKRAREKELHKSKNIVYFYNRLVDIISNLSELVVIQTLTDNVILQLSSLGVSVFFVENISELQLVSLRLITTIFSKYEKHRNLIMDDIIASLSRLPSSKKNMRNYRLNSEDSIQMLTALSLLLVQSVVNVSKIEMNSNESEETALS APDKIVKETPKADSEAVIETSYNNAFATAYSFLRIFLHKSTVKGEDDYRAIFENFVSDLLVTVNKPEWPAAETMLTLLGSLLTNQFINKHSDQTTRLICIDYLGTVASTLRRDAVSSTINPSDIENLIIDLIKGSKSSDEEDDD+DDDD+++E++ +N++ +D+ +++   + D  DDARGTKKKNSDINHKSQYNKLLKNIDKVQILRDALLDYLNADKFDTTAKYAREFYFGQWYTDCVKELKSQNNQAIAISNNVKDKMKKDTNKPTNNNNNTNNNTINDISIFQKAEDRRNHLLYKMFGTLPDESKKSKNNRINKLRIGSNPENNRYDIRLKGSLDYEDACLVCRYLASLKSSSQSFDIYLTKICRLLHDPSVALRTKAMRCLSAVVEADPTILRRDDIEKAVHLRFLDSSTSVREAAVELVGKYLLTRPELIDQYYPMIAERILDKGTSVRKRVIRIFRDICVEHTEFSKIPEICVKMIKRINDEEAIKKLVNEVFQNMWFSPVREKEGVKLLQKVMNITDVVSSCKDIGYEWFDQLLESLLKKEDSDKLRVVEKACKQIVDCLVQNIMRLEEISRDDNQRLVSCMATLHLFTKIRPELMVQYTMTLQPYLNIRNVNDNDTYILHYVARILEVTVPLIEHPAQNHINQLEVDMVNLIDKQGKMVLESCVACLAASVNKISHNYSLVKDCFDNYFDTLLKYRMEKDQTKTLPQATKRRILSRGLFTVGLLCKYFDFNCLQLGKDINIRIFETLMFYAEDNTLSCDIRTQAISGIGFLCIRYRELLICPRLLSFYHSILMNSLENTKT+DFPNLICCVLDNIYLFLVEEDDRLRHLDSSWKNNEKKESLKEMGDMSSGTGSHIAQLYLNAILENILQPWKPVRLKAVSLVVIIIRQGLINPISSVAYLISAQTDPNPSNRGKADNELAEIDKKFSGFINMKAVQGIRTSCKLQEVLEMYNIPENRLNWCSKHMLTTPVIVRGVYDHNADIPLALNHNLYTMLRSSKQFRRSFLYALLAIFGELKSRISLLIYVSENLAQFPYQSQEEPLYLVHNIDIMVSSIGPHFTQQIRDQLYPELVAHE NSDPSSNHPATKPDTIHIDDEENPEVLYKRLMDNPKALRNMRESIRNSRGCVLLISLKQYLRELYSLTDA                     KIQKYSPLDTGKAWERQLTRRNGIRFDPLVALNLTEETVAQENIYQKFVTDVQQTDINLDADLYPNEGYILINKFLHLRQLVM      +    D D     GGGGGGGGGGGGAPNRMKSSYSQNNNRPDNHHTANFHQLQHPPPSQHHHQQQPSQLLPPGNGSHPPSIVDHDAIISKSNSHHMAFIQGQNLRVEVDKL
Sbjct:  530 SYENIDNLRKLKFRKNNKKRKNELDGLKTWFVGSGPQKDANGEVVDLTVNQESNWDKTLGSYSQKMTVKARKRKRTVKQTSENSAFVFENDEEYVEATNVSNNADESDSYTDVSKRTLRNNSINYVGMEDGVENSDDISQSRAKKRKKDDDEPFEVKLKDPNEIKYPHIKKSQEINHKRRERVNGLTKLSNTTKKVQLPLDMLDPSLITESTTYQHFISLVDGCLEVVEDLDLIKTMKEQTESDIPISLPPDILISREQLQAMCIEIAKLKATGSTKEVPMEKLTKILTLLMLNISSGAKVCLPVTEDGEDNRLFKELAFERIGRSLDASFITINIMTSPDISNGVFIEDVQEAVVTSVKYQLVNLIFPEYDPAYRTVNHAKDNQSSIKAKRAREKELHKSKNIVYFYNRLVDIISNLSELVVIQTLTDNVILQLSSLGVSVFFVENISELQLVSLRLITTIFSKYEKHRNLIMDDIIASLSRLPSSKKNMRNYRLNSEDSIQMLTALSLLLVQSVVNVSKIEMNSNESEETALSAAPDKIVKETPKADSEAVIETSYNNAFATAYSFLRIFLHKSTVKGEDDYRAIFENFVSDLLVTVNKPEWPAAETMLTLLGSLLTNQFINKHSDQTTRLICIDYLGTVASTLRRDAVSSTINPSDIENLIIDLIKGSKSSDEEDDDDDDDDDEKEEQKDNNDNEDDENDEDIEILDDYDDARGTKKKNSDINHKSQYNKLLKNIDKVQILRDALLDYLNADKFDTTAKYAREFYFGQWYTDCVKELKSQNNQAIAISNNVKDKMKKDTNKPTNNNNNTNNNTINDISIFQKAEDRRNHLLYKMFGTLPDESKKSKNNRINKLRIGSNPENNRYDIRLKGSLDYEDACLVCRYLASLKSSSQSFDIYLTKICRLLHDPSVALRTKAMRCLSAVVEADPTILRRDDIEKAVHLRFLDSSTSVREAAVELVGKYLLTRPELIDQYYPMIAERILDKGTSVRKRVIRIFRDICVEHTEFSKIPEICVKMIKRINDEEAIKKLVNEVFQNMWFSPVREKEGVKLLQKVMNITDVVSSCKDIGYEWFDQLLESLLKKEDSDKLRVVEKACKQIVDCLVQNIMRLEEISRDDNQRLVSCMATLHLFTKIRPELMVQYTMTLQPYLNIRNVNDNDTYILHYVARILEVTVPLIEHPAQNHINQLEVDMVNLIDKQGKMVLESCVACLAASVNKISHNYSLVKDCFDNYFDTLLKYRMEKDQTKTLPQATKRRILSRGLFTVGLLCKYFDFNCLQLGKDINIRIFETLMFYAEDNTLSCDIRTQAISGIGFLCIRYRELLICPRLLSFYHSILMNSLENTKTDDFPNLICCVLDNIYLFLVEEDDRLRHLDSSWKNNEKKESLKEMGDMSSGTGSHIAQLYLNAILENILQPWKPVRLKAVSLVVIIIRQGLINPISSVAYLISAQTDPNPSNRGKADNELAEIDKKFSGFINMKAVQGIRTSCKLQEVLEMYNIPENRLNWCSKHMLTTPVIVRGVYDHNADIPLALNHNLYTMLRSSKQFRRSFLYALLAIFGELKSRISLLIYVSENLAQFPYQSQEEPLYLVHNIDIMVSSIGPHFTQQIRDQLYPELVAHESNSDPSSNHPATKPDTIHIDDEENPEVLYKRLMDNPKALRNMRESIRNSRGCVLLISLKQYLRELYSLTDA---------------------KIQKYSPLDTGKAWERQLTRRNGIRFDPLVALNLTEETVAQENIYQKFVTDVQQTDINLDADLYPNEGYILINKFLHLRQLVM--ALDSLDIIGDSDDDALIGGGGGGGGGGGGAPNRMKSSYSQNNNRPDNHHTANFHQLQHPPPSQHHHQQQPSQLLPPGNGSHPPSIVDHDAIISKSNSHHMAFIQGQNLRVEVDKL 2419          
BLAST of Nipped-B protein vs. Planmine SMEST
Match: SMESG000051020.1 (SMESG000051020.1)

HSP 1 Score: 3415.17 bits (8854), Expect = 0.000e+0
Identity = 1848/1913 (96.60%), Postives = 1865/1913 (97.49%), Query Frame = 1
Query: 2092 SYENIDXXXXXXXXXXXXXXXXXXDGLKTWFVGSGPQKDANGEVVDLTVNQESNWDKTLGSYSQXXXXXXXXXXXXXXXXSENSAFVFENDEEYVEATNVSNNADESDSYTDVSKRTLRNNSINYVGMEDGVENSDDISQSRAKKRKKDDDEPFEVKLKDPNEIKYPHIKKSQEINHKRRERVNGLTKLSNTTKKVQLPLDMLDPSLITESTTYQHFISLVDGCLEVVEDLDLIKTMKEQTEXXXXXXXXXXXXXXREQLQAMCIEIAKLKATGSTKEVPMEKLTKILTLLMLNISSGAKVCLPVTEDGEDNRLFKELAFERIGRSLDASFITINIMTSPDISNGVFIEDVQEAVVTSVKYQLVNLIFPEYDPAYRTVNHAKDNQSSIKAKRAREKELHKSKNIVYFYNRLVDIISNLSELVVIQTLTDNVILQLSSLGVSVFFVENISELQLVSLRLITTIFSKYEKHRNLIMDDIIASLSRLPSSKKNMRNYRLNSEDSIQMLTAXXXXXXXXXXXXXKIEMNSNESEETALSVAPDKIVKETPKADSEAVIETSYNNAFATAYSFLRIFLHKSTVKGEDDYRAIFENFVSDLLVTVNKPEWPAAETMLTLLGSLLTNQFINKHSDQTTRLICIDYLGTVASTLRRDAVSSTINPSDIENLIIDLIKGSKSSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-XXARGTKKKNSDINHKSQYNKLLKNIDKVQILRDALLDYLNADKFDTTAKYAREFYFGQWYTDCVKELKSQNNQAIAISXXXXXXXXXXXXXXXXXXXXXXXXXXXXISIFQKAEDRRNHLLYKMFGTLPDESKKSKNNRINKLRIGSNPENNRYDIRLKGSLDYEDACLVCRYLASLKSSSQSFDIYLTKICRLLHDPSVALRTKAMRCLSAVVEADPTILRRDDIEKAVHLRFLDSSTSVREAAVELVGKYLLTRPELIDQYYPMIAERILDKGTSVRKRVIRIFRDICVEHTEFSKIPEICVKMIKRINDEEAIKKLVNEVFQNMWFSPVREKEGVKLLQKVMNITDVVSSCKDIGYEWFDQLLESLLKKEDSDKLRVVEKACKQIVDCLVQNIMRLEEISRDDNQRLVSCMATLHLFTKIRPELMVQYTMTLQPYLNIRNVNDNDTYILHYVARILEVTVPLIEHPAQNHINQLEVDMVNLIDKQGKMVLESCVACLAASVNKISHNYSLVKDCFDNYFDTLLKYRMEKDQTKTLPQATKRRILSRGLFTVGLLCKYFDFNCLQLGKDINIRIFETLMFYAEDNTLSCDIRTQAISGIGFLCIRYRELLICPRLLSFYHSILMNSLENTKTEDFPNLICCVLDNIYLFLVEEDDRLRHLDSSWKNNEKKESLKEMGDMSSGTGSHIAQLYLNAILENILQPWKPVRLKAVSLVVIIIRQGLINPISSVAYLISAQTDPNPSNRGKADNELAEIDKKFSGFINMKAVQGIRTSCKLQEVLEMYNIPENRLNWCSKHMLTTPVIVRGVYDHNADIPLALNHNLYTMLRSSKQFRRSFLYALLAIFGELKSRISLLIYVSENLAQFPYQSQEEPLYLVHNIDIMVSSIGPHFTQQIRDQLYPELVAHEFNSDPSSNHPATKPDTIHIDDEENPEVLYKRLMDNPKALRNMRESIRNSRGCVLLISLKQYLRELYSLTDA*FDFNYG***YXXXXXXXGFRKIQKYSPLDTGKAWERQLTRRNGIRFDPLVALNLTEETVAQENIYQKFVTDVQQTDINLDADLYPNEGYILINKFLHLRQLVMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPNRMKSSYSQNNNRPDNHHTANFXXXXXXXXXXXXXXXXXXXXXXXGNGSHPPSIVDHDAIISKSNSHHMAFIQGQNLRVEVDKL 7827
            SYENIDNLRKLKFRKNNKKRKNELDGLKTWFVGSGPQKDANGEVVDLTVNQESNWDKTLGSYSQKMTVKARKRKRTVKQTSENSAFVFENDEEYVEATNVSNNADESDSYTDVSKRTLRNNSINYVGMEDGVENSDDISQSRAKKRKKDDDEPFEVKLKDPNEIKYPHIKKSQEINHKRRERVNGLTKLSNTTKKVQLPLDMLDPSLITESTTYQHFISLVDGCLEVVEDLDLIKTMKEQTESDIPISLPPDILISREQLQAMCIEIAKLKATGSTKEVPMEKLTKILTLLMLNISSGAKVCLPVTEDGEDNRLFKELAFERIGRSLDASFITINIMTSPDISNGVFIEDVQEAVVTSVKYQLVNLIFPEYDPAYRTVNHAKDNQSSIKAKRAREKELHKSKNIVYFYNRLVDIISNLSELVVIQTLTDNVILQLSSLGVSVFFVENISELQLVSLRLITTIFSKYEKHRNLIMDDIIASLSRLPSSKKNMRNYRLNSEDSIQMLTALSLLLVQSVVNVSKIEMNSNESEETALS APDKIVKETPKADSEAVIETSYNNAFATAYSFLRIFLHKSTVKGEDDYRAIFENFVSDLLVTVNKPEWPAAETMLTLLGSLLTNQFINKHSDQTTRLICIDYLGTVASTLRRDAVSSTINPSDIENLIIDLIKGSKSSDEEDDD+DDDD+++E++ +N++ +D+ +++   + D  DDARGTKKKNSDINHKSQYNKLLKNIDKVQILRDALLDYLNADKFDTTAKYAREFYFGQWYTDCVKELKSQNNQAIAISNNVKDKMKKDTNKPTNNNNNTNNNTINDISIFQKAEDRRNHLLYKMFGTLPDESKKSKNNRINKLRIGSNPENNRYDIRLKGSLDYEDACLVCRYLASLKSSSQSFDIYLTKICRLLHDPSVALRTKAMRCLSAVVEADPTILRRDDIEKAVHLRFLDSSTSVREAAVELVGKYLLTRPELIDQYYPMIAERILDKGTSVRKRVIRIFRDICVEHTEFSKIPEICVKMIKRINDEEAIKKLVNEVFQNMWFSPVREKEGVKLLQKVMNITDVVSSCKDIGYEWFDQLLESLLKKEDSDKLRVVEKACKQIVDCLVQNIMRLEEISRDDNQRLVSCMATLHLFTKIRPELMVQYTMTLQPYLNIRNVNDNDTYILHYVARILEVTVPLIEHPAQNHINQLEVDMVNLIDKQGKMVLESCVACLAASVNKISHNYSLVKDCFDNYFDTLLKYRMEKDQTKTLPQATKRRILSRGLFTVGLLCKYFDFNCLQLGKDINIRIFETLMFYAEDNTLSCDIRTQAISGIGFLCIRYRELLICPRLLSFYHSILMNSLENTKT+DFPNLICCVLDNIYLFLVEEDDRLRHLDSSWKNNEKKESLKEMGDMSSGTGSHIAQLYLNAILENILQPWKPVRLKAVSLVVIIIRQGLINPISSVAYLISAQTDPNPSNRGKADNELAEIDKKFSGFINMKAVQGIRTSCKLQEVLEMYNIPENRLNWCSKHMLTTPVIVRGVYDHNADIPLALNHNLYTMLRSSKQFRRSFLYALLAIFGELKSRISLLIYVSENLAQFPYQSQEEPLYLVHNIDIMVSSIGPHFTQQIRDQLYPELVAHE NSDPSSNHPATKPDTIHIDDEENPEVLYKRLMDNPKALRNMRESIRNSRGCVLLISLKQYLRELYSLTDA                     KIQKYSPLDTGKAWERQLTRRNGIRFDPLVALNLTEETVAQENIYQKFVTDVQQTDINLDADLYPNEGYILINKFLHLRQLVM      +    D D     GGGGGGGGGGGGAPNRMKSSYSQNNNRPDNHHTANFHQLQHPPPSQHHHQQQPSQLLPPGNGSHPPSIVDHDAIISKSNSHHMAFIQGQNLRVEVDKL
Sbjct:  527 SYENIDNLRKLKFRKNNKKRKNELDGLKTWFVGSGPQKDANGEVVDLTVNQESNWDKTLGSYSQKMTVKARKRKRTVKQTSENSAFVFENDEEYVEATNVSNNADESDSYTDVSKRTLRNNSINYVGMEDGVENSDDISQSRAKKRKKDDDEPFEVKLKDPNEIKYPHIKKSQEINHKRRERVNGLTKLSNTTKKVQLPLDMLDPSLITESTTYQHFISLVDGCLEVVEDLDLIKTMKEQTESDIPISLPPDILISREQLQAMCIEIAKLKATGSTKEVPMEKLTKILTLLMLNISSGAKVCLPVTEDGEDNRLFKELAFERIGRSLDASFITINIMTSPDISNGVFIEDVQEAVVTSVKYQLVNLIFPEYDPAYRTVNHAKDNQSSIKAKRAREKELHKSKNIVYFYNRLVDIISNLSELVVIQTLTDNVILQLSSLGVSVFFVENISELQLVSLRLITTIFSKYEKHRNLIMDDIIASLSRLPSSKKNMRNYRLNSEDSIQMLTALSLLLVQSVVNVSKIEMNSNESEETALSAAPDKIVKETPKADSEAVIETSYNNAFATAYSFLRIFLHKSTVKGEDDYRAIFENFVSDLLVTVNKPEWPAAETMLTLLGSLLTNQFINKHSDQTTRLICIDYLGTVASTLRRDAVSSTINPSDIENLIIDLIKGSKSSDEEDDDDDDDDDEKEEQKDNNDNEDDENDEDIEILDDYDDARGTKKKNSDINHKSQYNKLLKNIDKVQILRDALLDYLNADKFDTTAKYAREFYFGQWYTDCVKELKSQNNQAIAISNNVKDKMKKDTNKPTNNNNNTNNNTINDISIFQKAEDRRNHLLYKMFGTLPDESKKSKNNRINKLRIGSNPENNRYDIRLKGSLDYEDACLVCRYLASLKSSSQSFDIYLTKICRLLHDPSVALRTKAMRCLSAVVEADPTILRRDDIEKAVHLRFLDSSTSVREAAVELVGKYLLTRPELIDQYYPMIAERILDKGTSVRKRVIRIFRDICVEHTEFSKIPEICVKMIKRINDEEAIKKLVNEVFQNMWFSPVREKEGVKLLQKVMNITDVVSSCKDIGYEWFDQLLESLLKKEDSDKLRVVEKACKQIVDCLVQNIMRLEEISRDDNQRLVSCMATLHLFTKIRPELMVQYTMTLQPYLNIRNVNDNDTYILHYVARILEVTVPLIEHPAQNHINQLEVDMVNLIDKQGKMVLESCVACLAASVNKISHNYSLVKDCFDNYFDTLLKYRMEKDQTKTLPQATKRRILSRGLFTVGLLCKYFDFNCLQLGKDINIRIFETLMFYAEDNTLSCDIRTQAISGIGFLCIRYRELLICPRLLSFYHSILMNSLENTKTDDFPNLICCVLDNIYLFLVEEDDRLRHLDSSWKNNEKKESLKEMGDMSSGTGSHIAQLYLNAILENILQPWKPVRLKAVSLVVIIIRQGLINPISSVAYLISAQTDPNPSNRGKADNELAEIDKKFSGFINMKAVQGIRTSCKLQEVLEMYNIPENRLNWCSKHMLTTPVIVRGVYDHNADIPLALNHNLYTMLRSSKQFRRSFLYALLAIFGELKSRISLLIYVSENLAQFPYQSQEEPLYLVHNIDIMVSSIGPHFTQQIRDQLYPELVAHESNSDPSSNHPATKPDTIHIDDEENPEVLYKRLMDNPKALRNMRESIRNSRGCVLLISLKQYLRELYSLTDA---------------------KIQKYSPLDTGKAWERQLTRRNGIRFDPLVALNLTEETVAQENIYQKFVTDVQQTDINLDADLYPNEGYILINKFLHLRQLVM--ALDSLDIIGDSDDDALIGGGGGGGGGGGGAPNRMKSSYSQNNNRPDNHHTANFHQLQHPPPSQHHHQQQPSQLLPPGNGSHPPSIVDHDAIISKSNSHHMAFIQGQNLRVEVDKL 2416          
BLAST of Nipped-B protein vs. Planmine SMEST
Match: SMESG000051020.1 (SMESG000051020.1)

HSP 1 Score: 3413.62 bits (8850), Expect = 0.000e+0
Identity = 1848/1913 (96.60%), Postives = 1865/1913 (97.49%), Query Frame = 1
Query: 2092 SYENIDXXXXXXXXXXXXXXXXXXDGLKTWFVGSGPQKDANGEVVDLTVNQESNWDKTLGSYSQXXXXXXXXXXXXXXXXSENSAFVFENDEEYVEATNVSNNADESDSYTDVSKRTLRNNSINYVGMEDGVENSDDISQSRAKKRKKDDDEPFEVKLKDPNEIKYPHIKKSQEINHKRRERVNGLTKLSNTTKKVQLPLDMLDPSLITESTTYQHFISLVDGCLEVVEDLDLIKTMKEQTEXXXXXXXXXXXXXXREQLQAMCIEIAKLKATGSTKEVPMEKLTKILTLLMLNISSGAKVCLPVTEDGEDNRLFKELAFERIGRSLDASFITINIMTSPDISNGVFIEDVQEAVVTSVKYQLVNLIFPEYDPAYRTVNHAKDNQSSIKAKRAREKELHKSKNIVYFYNRLVDIISNLSELVVIQTLTDNVILQLSSLGVSVFFVENISELQLVSLRLITTIFSKYEKHRNLIMDDIIASLSRLPSSKKNMRNYRLNSEDSIQMLTAXXXXXXXXXXXXXKIEMNSNESEETALSVAPDKIVKETPKADSEAVIETSYNNAFATAYSFLRIFLHKSTVKGEDDYRAIFENFVSDLLVTVNKPEWPAAETMLTLLGSLLTNQFINKHSDQTTRLICIDYLGTVASTLRRDAVSSTINPSDIENLIIDLIKGSKSSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-XXARGTKKKNSDINHKSQYNKLLKNIDKVQILRDALLDYLNADKFDTTAKYAREFYFGQWYTDCVKELKSQNNQAIAISXXXXXXXXXXXXXXXXXXXXXXXXXXXXISIFQKAEDRRNHLLYKMFGTLPDESKKSKNNRINKLRIGSNPENNRYDIRLKGSLDYEDACLVCRYLASLKSSSQSFDIYLTKICRLLHDPSVALRTKAMRCLSAVVEADPTILRRDDIEKAVHLRFLDSSTSVREAAVELVGKYLLTRPELIDQYYPMIAERILDKGTSVRKRVIRIFRDICVEHTEFSKIPEICVKMIKRINDEEAIKKLVNEVFQNMWFSPVREKEGVKLLQKVMNITDVVSSCKDIGYEWFDQLLESLLKKEDSDKLRVVEKACKQIVDCLVQNIMRLEEISRDDNQRLVSCMATLHLFTKIRPELMVQYTMTLQPYLNIRNVNDNDTYILHYVARILEVTVPLIEHPAQNHINQLEVDMVNLIDKQGKMVLESCVACLAASVNKISHNYSLVKDCFDNYFDTLLKYRMEKDQTKTLPQATKRRILSRGLFTVGLLCKYFDFNCLQLGKDINIRIFETLMFYAEDNTLSCDIRTQAISGIGFLCIRYRELLICPRLLSFYHSILMNSLENTKTEDFPNLICCVLDNIYLFLVEEDDRLRHLDSSWKNNEKKESLKEMGDMSSGTGSHIAQLYLNAILENILQPWKPVRLKAVSLVVIIIRQGLINPISSVAYLISAQTDPNPSNRGKADNELAEIDKKFSGFINMKAVQGIRTSCKLQEVLEMYNIPENRLNWCSKHMLTTPVIVRGVYDHNADIPLALNHNLYTMLRSSKQFRRSFLYALLAIFGELKSRISLLIYVSENLAQFPYQSQEEPLYLVHNIDIMVSSIGPHFTQQIRDQLYPELVAHEFNSDPSSNHPATKPDTIHIDDEENPEVLYKRLMDNPKALRNMRESIRNSRGCVLLISLKQYLRELYSLTDA*FDFNYG***YXXXXXXXGFRKIQKYSPLDTGKAWERQLTRRNGIRFDPLVALNLTEETVAQENIYQKFVTDVQQTDINLDADLYPNEGYILINKFLHLRQLVMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPNRMKSSYSQNNNRPDNHHTANFXXXXXXXXXXXXXXXXXXXXXXXGNGSHPPSIVDHDAIISKSNSHHMAFIQGQNLRVEVDKL 7827
            SYENIDNLRKLKFRKNNKKRKNELDGLKTWFVGSGPQKDANGEVVDLTVNQESNWDKTLGSYSQKMTVKARKRKRTVKQTSENSAFVFENDEEYVEATNVSNNADESDSYTDVSKRTLRNNSINYVGMEDGVENSDDISQSRAKKRKKDDDEPFEVKLKDPNEIKYPHIKKSQEINHKRRERVNGLTKLSNTTKKVQLPLDMLDPSLITESTTYQHFISLVDGCLEVVEDLDLIKTMKEQTESDIPISLPPDILISREQLQAMCIEIAKLKATGSTKEVPMEKLTKILTLLMLNISSGAKVCLPVTEDGEDNRLFKELAFERIGRSLDASFITINIMTSPDISNGVFIEDVQEAVVTSVKYQLVNLIFPEYDPAYRTVNHAKDNQSSIKAKRAREKELHKSKNIVYFYNRLVDIISNLSELVVIQTLTDNVILQLSSLGVSVFFVENISELQLVSLRLITTIFSKYEKHRNLIMDDIIASLSRLPSSKKNMRNYRLNSEDSIQMLTALSLLLVQSVVNVSKIEMNSNESEETALS APDKIVKETPKADSEAVIETSYNNAFATAYSFLRIFLHKSTVKGEDDYRAIFENFVSDLLVTVNKPEWPAAETMLTLLGSLLTNQFINKHSDQTTRLICIDYLGTVASTLRRDAVSSTINPSDIENLIIDLIKGSKSSDEEDDD+DDDD+++E++ +N++ +D+ +++   + D  DDARGTKKKNSDINHKSQYNKLLKNIDKVQILRDALLDYLNADKFDTTAKYAREFYFGQWYTDCVKELKSQNNQAIAISNNVKDKMKKDTNKPTNNNNNTNNNTINDISIFQKAEDRRNHLLYKMFGTLPDESKKSKNNRINKLRIGSNPENNRYDIRLKGSLDYEDACLVCRYLASLKSSSQSFDIYLTKICRLLHDPSVALRTKAMRCLSAVVEADPTILRRDDIEKAVHLRFLDSSTSVREAAVELVGKYLLTRPELIDQYYPMIAERILDKGTSVRKRVIRIFRDICVEHTEFSKIPEICVKMIKRINDEEAIKKLVNEVFQNMWFSPVREKEGVKLLQKVMNITDVVSSCKDIGYEWFDQLLESLLKKEDSDKLRVVEKACKQIVDCLVQNIMRLEEISRDDNQRLVSCMATLHLFTKIRPELMVQYTMTLQPYLNIRNVNDNDTYILHYVARILEVTVPLIEHPAQNHINQLEVDMVNLIDKQGKMVLESCVACLAASVNKISHNYSLVKDCFDNYFDTLLKYRMEKDQTKTLPQATKRRILSRGLFTVGLLCKYFDFNCLQLGKDINIRIFETLMFYAEDNTLSCDIRTQAISGIGFLCIRYRELLICPRLLSFYHSILMNSLENTKT+DFPNLICCVLDNIYLFLVEEDDRLRHLDSSWKNNEKKESLKEMGDMSSGTGSHIAQLYLNAILENILQPWKPVRLKAVSLVVIIIRQGLINPISSVAYLISAQTDPNPSNRGKADNELAEIDKKFSGFINMKAVQGIRTSCKLQEVLEMYNIPENRLNWCSKHMLTTPVIVRGVYDHNADIPLALNHNLYTMLRSSKQFRRSFLYALLAIFGELKSRISLLIYVSENLAQFPYQSQEEPLYLVHNIDIMVSSIGPHFTQQIRDQLYPELVAHE NSDPSSNHPATKPDTIHIDDEENPEVLYKRLMDNPKALRNMRESIRNSRGCVLLISLKQYLRELYSLTDA                     KIQKYSPLDTGKAWERQLTRRNGIRFDPLVALNLTEETVAQENIYQKFVTDVQQTDINLDADLYPNEGYILINKFLHLRQLVM      +    D D     GGGGGGGGGGGGAPNRMKSSYSQNNNRPDNHHTANFHQLQHPPPSQHHHQQQPSQLLPPGNGSHPPSIVDHDAIISKSNSHHMAFIQGQNLRVEVDKL
Sbjct:  530 SYENIDNLRKLKFRKNNKKRKNELDGLKTWFVGSGPQKDANGEVVDLTVNQESNWDKTLGSYSQKMTVKARKRKRTVKQTSENSAFVFENDEEYVEATNVSNNADESDSYTDVSKRTLRNNSINYVGMEDGVENSDDISQSRAKKRKKDDDEPFEVKLKDPNEIKYPHIKKSQEINHKRRERVNGLTKLSNTTKKVQLPLDMLDPSLITESTTYQHFISLVDGCLEVVEDLDLIKTMKEQTESDIPISLPPDILISREQLQAMCIEIAKLKATGSTKEVPMEKLTKILTLLMLNISSGAKVCLPVTEDGEDNRLFKELAFERIGRSLDASFITINIMTSPDISNGVFIEDVQEAVVTSVKYQLVNLIFPEYDPAYRTVNHAKDNQSSIKAKRAREKELHKSKNIVYFYNRLVDIISNLSELVVIQTLTDNVILQLSSLGVSVFFVENISELQLVSLRLITTIFSKYEKHRNLIMDDIIASLSRLPSSKKNMRNYRLNSEDSIQMLTALSLLLVQSVVNVSKIEMNSNESEETALSAAPDKIVKETPKADSEAVIETSYNNAFATAYSFLRIFLHKSTVKGEDDYRAIFENFVSDLLVTVNKPEWPAAETMLTLLGSLLTNQFINKHSDQTTRLICIDYLGTVASTLRRDAVSSTINPSDIENLIIDLIKGSKSSDEEDDDDDDDDDEKEEQKDNNDNEDDENDEDIEILDDYDDARGTKKKNSDINHKSQYNKLLKNIDKVQILRDALLDYLNADKFDTTAKYAREFYFGQWYTDCVKELKSQNNQAIAISNNVKDKMKKDTNKPTNNNNNTNNNTINDISIFQKAEDRRNHLLYKMFGTLPDESKKSKNNRINKLRIGSNPENNRYDIRLKGSLDYEDACLVCRYLASLKSSSQSFDIYLTKICRLLHDPSVALRTKAMRCLSAVVEADPTILRRDDIEKAVHLRFLDSSTSVREAAVELVGKYLLTRPELIDQYYPMIAERILDKGTSVRKRVIRIFRDICVEHTEFSKIPEICVKMIKRINDEEAIKKLVNEVFQNMWFSPVREKEGVKLLQKVMNITDVVSSCKDIGYEWFDQLLESLLKKEDSDKLRVVEKACKQIVDCLVQNIMRLEEISRDDNQRLVSCMATLHLFTKIRPELMVQYTMTLQPYLNIRNVNDNDTYILHYVARILEVTVPLIEHPAQNHINQLEVDMVNLIDKQGKMVLESCVACLAASVNKISHNYSLVKDCFDNYFDTLLKYRMEKDQTKTLPQATKRRILSRGLFTVGLLCKYFDFNCLQLGKDINIRIFETLMFYAEDNTLSCDIRTQAISGIGFLCIRYRELLICPRLLSFYHSILMNSLENTKTDDFPNLICCVLDNIYLFLVEEDDRLRHLDSSWKNNEKKESLKEMGDMSSGTGSHIAQLYLNAILENILQPWKPVRLKAVSLVVIIIRQGLINPISSVAYLISAQTDPNPSNRGKADNELAEIDKKFSGFINMKAVQGIRTSCKLQEVLEMYNIPENRLNWCSKHMLTTPVIVRGVYDHNADIPLALNHNLYTMLRSSKQFRRSFLYALLAIFGELKSRISLLIYVSENLAQFPYQSQEEPLYLVHNIDIMVSSIGPHFTQQIRDQLYPELVAHESNSDPSSNHPATKPDTIHIDDEENPEVLYKRLMDNPKALRNMRESIRNSRGCVLLISLKQYLRELYSLTDA---------------------KIQKYSPLDTGKAWERQLTRRNGIRFDPLVALNLTEETVAQENIYQKFVTDVQQTDINLDADLYPNEGYILINKFLHLRQLVM--ALDSLDIIGDSDDDALIGGGGGGGGGGGGAPNRMKSSYSQNNNRPDNHHTANFHQLQHPPPSQHHHQQQPSQLLPPGNGSHPPSIVDHDAIISKSNSHHMAFIQGQNLRVEVDKL 2419          
BLAST of Nipped-B protein vs. Planmine SMEST
Match: SMESG000051020.1 (SMESG000051020.1)

HSP 1 Score: 3413.62 bits (8850), Expect = 0.000e+0
Identity = 1848/1913 (96.60%), Postives = 1865/1913 (97.49%), Query Frame = 1
Query: 2092 SYENIDXXXXXXXXXXXXXXXXXXDGLKTWFVGSGPQKDANGEVVDLTVNQESNWDKTLGSYSQXXXXXXXXXXXXXXXXSENSAFVFENDEEYVEATNVSNNADESDSYTDVSKRTLRNNSINYVGMEDGVENSDDISQSRAKKRKKDDDEPFEVKLKDPNEIKYPHIKKSQEINHKRRERVNGLTKLSNTTKKVQLPLDMLDPSLITESTTYQHFISLVDGCLEVVEDLDLIKTMKEQTEXXXXXXXXXXXXXXREQLQAMCIEIAKLKATGSTKEVPMEKLTKILTLLMLNISSGAKVCLPVTEDGEDNRLFKELAFERIGRSLDASFITINIMTSPDISNGVFIEDVQEAVVTSVKYQLVNLIFPEYDPAYRTVNHAKDNQSSIKAKRAREKELHKSKNIVYFYNRLVDIISNLSELVVIQTLTDNVILQLSSLGVSVFFVENISELQLVSLRLITTIFSKYEKHRNLIMDDIIASLSRLPSSKKNMRNYRLNSEDSIQMLTAXXXXXXXXXXXXXKIEMNSNESEETALSVAPDKIVKETPKADSEAVIETSYNNAFATAYSFLRIFLHKSTVKGEDDYRAIFENFVSDLLVTVNKPEWPAAETMLTLLGSLLTNQFINKHSDQTTRLICIDYLGTVASTLRRDAVSSTINPSDIENLIIDLIKGSKSSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-XXARGTKKKNSDINHKSQYNKLLKNIDKVQILRDALLDYLNADKFDTTAKYAREFYFGQWYTDCVKELKSQNNQAIAISXXXXXXXXXXXXXXXXXXXXXXXXXXXXISIFQKAEDRRNHLLYKMFGTLPDESKKSKNNRINKLRIGSNPENNRYDIRLKGSLDYEDACLVCRYLASLKSSSQSFDIYLTKICRLLHDPSVALRTKAMRCLSAVVEADPTILRRDDIEKAVHLRFLDSSTSVREAAVELVGKYLLTRPELIDQYYPMIAERILDKGTSVRKRVIRIFRDICVEHTEFSKIPEICVKMIKRINDEEAIKKLVNEVFQNMWFSPVREKEGVKLLQKVMNITDVVSSCKDIGYEWFDQLLESLLKKEDSDKLRVVEKACKQIVDCLVQNIMRLEEISRDDNQRLVSCMATLHLFTKIRPELMVQYTMTLQPYLNIRNVNDNDTYILHYVARILEVTVPLIEHPAQNHINQLEVDMVNLIDKQGKMVLESCVACLAASVNKISHNYSLVKDCFDNYFDTLLKYRMEKDQTKTLPQATKRRILSRGLFTVGLLCKYFDFNCLQLGKDINIRIFETLMFYAEDNTLSCDIRTQAISGIGFLCIRYRELLICPRLLSFYHSILMNSLENTKTEDFPNLICCVLDNIYLFLVEEDDRLRHLDSSWKNNEKKESLKEMGDMSSGTGSHIAQLYLNAILENILQPWKPVRLKAVSLVVIIIRQGLINPISSVAYLISAQTDPNPSNRGKADNELAEIDKKFSGFINMKAVQGIRTSCKLQEVLEMYNIPENRLNWCSKHMLTTPVIVRGVYDHNADIPLALNHNLYTMLRSSKQFRRSFLYALLAIFGELKSRISLLIYVSENLAQFPYQSQEEPLYLVHNIDIMVSSIGPHFTQQIRDQLYPELVAHEFNSDPSSNHPATKPDTIHIDDEENPEVLYKRLMDNPKALRNMRESIRNSRGCVLLISLKQYLRELYSLTDA*FDFNYG***YXXXXXXXGFRKIQKYSPLDTGKAWERQLTRRNGIRFDPLVALNLTEETVAQENIYQKFVTDVQQTDINLDADLYPNEGYILINKFLHLRQLVMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPNRMKSSYSQNNNRPDNHHTANFXXXXXXXXXXXXXXXXXXXXXXXGNGSHPPSIVDHDAIISKSNSHHMAFIQGQNLRVEVDKL 7827
            SYENIDNLRKLKFRKNNKKRKNELDGLKTWFVGSGPQKDANGEVVDLTVNQESNWDKTLGSYSQKMTVKARKRKRTVKQTSENSAFVFENDEEYVEATNVSNNADESDSYTDVSKRTLRNNSINYVGMEDGVENSDDISQSRAKKRKKDDDEPFEVKLKDPNEIKYPHIKKSQEINHKRRERVNGLTKLSNTTKKVQLPLDMLDPSLITESTTYQHFISLVDGCLEVVEDLDLIKTMKEQTESDIPISLPPDILISREQLQAMCIEIAKLKATGSTKEVPMEKLTKILTLLMLNISSGAKVCLPVTEDGEDNRLFKELAFERIGRSLDASFITINIMTSPDISNGVFIEDVQEAVVTSVKYQLVNLIFPEYDPAYRTVNHAKDNQSSIKAKRAREKELHKSKNIVYFYNRLVDIISNLSELVVIQTLTDNVILQLSSLGVSVFFVENISELQLVSLRLITTIFSKYEKHRNLIMDDIIASLSRLPSSKKNMRNYRLNSEDSIQMLTALSLLLVQSVVNVSKIEMNSNESEETALS APDKIVKETPKADSEAVIETSYNNAFATAYSFLRIFLHKSTVKGEDDYRAIFENFVSDLLVTVNKPEWPAAETMLTLLGSLLTNQFINKHSDQTTRLICIDYLGTVASTLRRDAVSSTINPSDIENLIIDLIKGSKSSDEEDDD+DDDD+++E++ +N++ +D+ +++   + D  DDARGTKKKNSDINHKSQYNKLLKNIDKVQILRDALLDYLNADKFDTTAKYAREFYFGQWYTDCVKELKSQNNQAIAISNNVKDKMKKDTNKPTNNNNNTNNNTINDISIFQKAEDRRNHLLYKMFGTLPDESKKSKNNRINKLRIGSNPENNRYDIRLKGSLDYEDACLVCRYLASLKSSSQSFDIYLTKICRLLHDPSVALRTKAMRCLSAVVEADPTILRRDDIEKAVHLRFLDSSTSVREAAVELVGKYLLTRPELIDQYYPMIAERILDKGTSVRKRVIRIFRDICVEHTEFSKIPEICVKMIKRINDEEAIKKLVNEVFQNMWFSPVREKEGVKLLQKVMNITDVVSSCKDIGYEWFDQLLESLLKKEDSDKLRVVEKACKQIVDCLVQNIMRLEEISRDDNQRLVSCMATLHLFTKIRPELMVQYTMTLQPYLNIRNVNDNDTYILHYVARILEVTVPLIEHPAQNHINQLEVDMVNLIDKQGKMVLESCVACLAASVNKISHNYSLVKDCFDNYFDTLLKYRMEKDQTKTLPQATKRRILSRGLFTVGLLCKYFDFNCLQLGKDINIRIFETLMFYAEDNTLSCDIRTQAISGIGFLCIRYRELLICPRLLSFYHSILMNSLENTKT+DFPNLICCVLDNIYLFLVEEDDRLRHLDSSWKNNEKKESLKEMGDMSSGTGSHIAQLYLNAILENILQPWKPVRLKAVSLVVIIIRQGLINPISSVAYLISAQTDPNPSNRGKADNELAEIDKKFSGFINMKAVQGIRTSCKLQEVLEMYNIPENRLNWCSKHMLTTPVIVRGVYDHNADIPLALNHNLYTMLRSSKQFRRSFLYALLAIFGELKSRISLLIYVSENLAQFPYQSQEEPLYLVHNIDIMVSSIGPHFTQQIRDQLYPELVAHE NSDPSSNHPATKPDTIHIDDEENPEVLYKRLMDNPKALRNMRESIRNSRGCVLLISLKQYLRELYSLTDA                     KIQKYSPLDTGKAWERQLTRRNGIRFDPLVALNLTEETVAQENIYQKFVTDVQQTDINLDADLYPNEGYILINKFLHLRQLVM      +    D D     GGGGGGGGGGGGAPNRMKSSYSQNNNRPDNHHTANFHQLQHPPPSQHHHQQQPSQLLPPGNGSHPPSIVDHDAIISKSNSHHMAFIQGQNLRVEVDKL
Sbjct:  527 SYENIDNLRKLKFRKNNKKRKNELDGLKTWFVGSGPQKDANGEVVDLTVNQESNWDKTLGSYSQKMTVKARKRKRTVKQTSENSAFVFENDEEYVEATNVSNNADESDSYTDVSKRTLRNNSINYVGMEDGVENSDDISQSRAKKRKKDDDEPFEVKLKDPNEIKYPHIKKSQEINHKRRERVNGLTKLSNTTKKVQLPLDMLDPSLITESTTYQHFISLVDGCLEVVEDLDLIKTMKEQTESDIPISLPPDILISREQLQAMCIEIAKLKATGSTKEVPMEKLTKILTLLMLNISSGAKVCLPVTEDGEDNRLFKELAFERIGRSLDASFITINIMTSPDISNGVFIEDVQEAVVTSVKYQLVNLIFPEYDPAYRTVNHAKDNQSSIKAKRAREKELHKSKNIVYFYNRLVDIISNLSELVVIQTLTDNVILQLSSLGVSVFFVENISELQLVSLRLITTIFSKYEKHRNLIMDDIIASLSRLPSSKKNMRNYRLNSEDSIQMLTALSLLLVQSVVNVSKIEMNSNESEETALSAAPDKIVKETPKADSEAVIETSYNNAFATAYSFLRIFLHKSTVKGEDDYRAIFENFVSDLLVTVNKPEWPAAETMLTLLGSLLTNQFINKHSDQTTRLICIDYLGTVASTLRRDAVSSTINPSDIENLIIDLIKGSKSSDEEDDDDDDDDDEKEEQKDNNDNEDDENDEDIEILDDYDDARGTKKKNSDINHKSQYNKLLKNIDKVQILRDALLDYLNADKFDTTAKYAREFYFGQWYTDCVKELKSQNNQAIAISNNVKDKMKKDTNKPTNNNNNTNNNTINDISIFQKAEDRRNHLLYKMFGTLPDESKKSKNNRINKLRIGSNPENNRYDIRLKGSLDYEDACLVCRYLASLKSSSQSFDIYLTKICRLLHDPSVALRTKAMRCLSAVVEADPTILRRDDIEKAVHLRFLDSSTSVREAAVELVGKYLLTRPELIDQYYPMIAERILDKGTSVRKRVIRIFRDICVEHTEFSKIPEICVKMIKRINDEEAIKKLVNEVFQNMWFSPVREKEGVKLLQKVMNITDVVSSCKDIGYEWFDQLLESLLKKEDSDKLRVVEKACKQIVDCLVQNIMRLEEISRDDNQRLVSCMATLHLFTKIRPELMVQYTMTLQPYLNIRNVNDNDTYILHYVARILEVTVPLIEHPAQNHINQLEVDMVNLIDKQGKMVLESCVACLAASVNKISHNYSLVKDCFDNYFDTLLKYRMEKDQTKTLPQATKRRILSRGLFTVGLLCKYFDFNCLQLGKDINIRIFETLMFYAEDNTLSCDIRTQAISGIGFLCIRYRELLICPRLLSFYHSILMNSLENTKTDDFPNLICCVLDNIYLFLVEEDDRLRHLDSSWKNNEKKESLKEMGDMSSGTGSHIAQLYLNAILENILQPWKPVRLKAVSLVVIIIRQGLINPISSVAYLISAQTDPNPSNRGKADNELAEIDKKFSGFINMKAVQGIRTSCKLQEVLEMYNIPENRLNWCSKHMLTTPVIVRGVYDHNADIPLALNHNLYTMLRSSKQFRRSFLYALLAIFGELKSRISLLIYVSENLAQFPYQSQEEPLYLVHNIDIMVSSIGPHFTQQIRDQLYPELVAHESNSDPSSNHPATKPDTIHIDDEENPEVLYKRLMDNPKALRNMRESIRNSRGCVLLISLKQYLRELYSLTDA---------------------KIQKYSPLDTGKAWERQLTRRNGIRFDPLVALNLTEETVAQENIYQKFVTDVQQTDINLDADLYPNEGYILINKFLHLRQLVM--ALDSLDIIGDSDDDALIGGGGGGGGGGGGAPNRMKSSYSQNNNRPDNHHTANFHQLQHPPPSQHHHQQQPSQLLPPGNGSHPPSIVDHDAIISKSNSHHMAFIQGQNLRVEVDKL 2416          
BLAST of Nipped-B protein vs. Planmine SMEST
Match: SMESG000013025.1 (SMESG000013025.1)

HSP 1 Score: 795.808 bits (2054), Expect = 0.000e+0
Identity = 386/386 (100.00%), Postives = 386/386 (100.00%), Query Frame = 3
Query:   33 MAGNVENSINVITDQMGNLDVKLNENINQNQNSSMTPDLNLLTQNKYLENMLMMNTYGVNYDPVFLSQYLAAQQLSNNFMANRNQINAAYSSQQFPNQSIPLKNLYDQSHLKYSQNSNSWRPAMNNPNLYDGVKQNPLSLHYLQNGMDMYTNLDNNSLTSAINFDKYDAIPVSVTGPDYSAINVENFDELKLNPIIRNNILLASYQRPTPIQKNAIPAILEHRDIMACAQTGSGKTAAFLIPIINHLISQDLSPQRYTKTAYPKCLILAPTRELAIQILSESQKFSLNTQMRSCVVYGGADTHSQIREVQIGCHLLVATPGRLVDFIEKNKISLEMCKYIVLDEADRMLDMGFEPQIRKIIEESNMPSGINRQTLMFSATFPKEIQ 1190
            MAGNVENSINVITDQMGNLDVKLNENINQNQNSSMTPDLNLLTQNKYLENMLMMNTYGVNYDPVFLSQYLAAQQLSNNFMANRNQINAAYSSQQFPNQSIPLKNLYDQSHLKYSQNSNSWRPAMNNPNLYDGVKQNPLSLHYLQNGMDMYTNLDNNSLTSAINFDKYDAIPVSVTGPDYSAINVENFDELKLNPIIRNNILLASYQRPTPIQKNAIPAILEHRDIMACAQTGSGKTAAFLIPIINHLISQDLSPQRYTKTAYPKCLILAPTRELAIQILSESQKFSLNTQMRSCVVYGGADTHSQIREVQIGCHLLVATPGRLVDFIEKNKISLEMCKYIVLDEADRMLDMGFEPQIRKIIEESNMPSGINRQTLMFSATFPKEIQ
Sbjct:    1 MAGNVENSINVITDQMGNLDVKLNENINQNQNSSMTPDLNLLTQNKYLENMLMMNTYGVNYDPVFLSQYLAAQQLSNNFMANRNQINAAYSSQQFPNQSIPLKNLYDQSHLKYSQNSNSWRPAMNNPNLYDGVKQNPLSLHYLQNGMDMYTNLDNNSLTSAINFDKYDAIPVSVTGPDYSAINVENFDELKLNPIIRNNILLASYQRPTPIQKNAIPAILEHRDIMACAQTGSGKTAAFLIPIINHLISQDLSPQRYTKTAYPKCLILAPTRELAIQILSESQKFSLNTQMRSCVVYGGADTHSQIREVQIGCHLLVATPGRLVDFIEKNKISLEMCKYIVLDEADRMLDMGFEPQIRKIIEESNMPSGINRQTLMFSATFPKEIQ 386          

HSP 2 Score: 548.125 bits (1411), Expect = 0.000e+0
Identity = 263/263 (100.00%), Postives = 263/263 (100.00%), Query Frame = 2
Query: 1256 KLAADFLYNYIFMTVGRVGSTSDSIKQEIIYMTDVEKLNYLKNIFNTTAPNTLILIFVETKKGADSLARFLLSKGYPVSSIHGDRNQGEREHALNMFRNGQCPILVATAVAARGLDIPNVKHVINYDLPSDIEEYVHRIGRTGRLGNHGRATSFYVDKNNNIAIDLVDLLKEANQIVPQWLSALADELKRNSVIGSNNKRHNQRRFKNGNFGGRDYRQGTTSVNMNSNVNQDYFISGSVAPRHAKLNNGNYFSRSNEMHDQHA 2044
            KLAADFLYNYIFMTVGRVGSTSDSIKQEIIYMTDVEKLNYLKNIFNTTAPNTLILIFVETKKGADSLARFLLSKGYPVSSIHGDRNQGEREHALNMFRNGQCPILVATAVAARGLDIPNVKHVINYDLPSDIEEYVHRIGRTGRLGNHGRATSFYVDKNNNIAIDLVDLLKEANQIVPQWLSALADELKRNSVIGSNNKRHNQRRFKNGNFGGRDYRQGTTSVNMNSNVNQDYFISGSVAPRHAKLNNGNYFSRSNEMHDQHA
Sbjct:  387 KLAADFLYNYIFMTVGRVGSTSDSIKQEIIYMTDVEKLNYLKNIFNTTAPNTLILIFVETKKGADSLARFLLSKGYPVSSIHGDRNQGEREHALNMFRNGQCPILVATAVAARGLDIPNVKHVINYDLPSDIEEYVHRIGRTGRLGNHGRATSFYVDKNNNIAIDLVDLLKEANQIVPQWLSALADELKRNSVIGSNNKRHNQRRFKNGNFGGRDYRQGTTSVNMNSNVNQDYFISGSVAPRHAKLNNGNYFSRSNEMHDQHA 649          
The following BLAST results are available for this feature:
BLAST of Nipped-B protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NIPBL2.311e-9438.18NIPBL cohesin loading factor [Source:HGNC Symbol;A... [more]
NIPBL2.771e-9438.18NIPBL cohesin loading factor [Source:HGNC Symbol;A... [more]
NIPBL1.972e-9441.17NIPBL cohesin loading factor [Source:HGNC Symbol;A... [more]
DDX3Y3.277e-14757.38DEAD-box helicase 3 Y-linked [Source:HGNC Symbol;A... [more]
DDX3Y3.277e-14757.38DEAD-box helicase 3 Y-linked [Source:HGNC Symbol;A... [more]
back to top
BLAST of Nipped-B protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
laf-11.081e-13151.69ATP-dependent RNA helicase laf-1 [Source:UniProtK... [more]
laf-11.288e-13151.69ATP-dependent RNA helicase laf-1 [Source:UniProtK... [more]
vbh-14.183e-12752.34Vasa-and Belle-like Helicase [Source:UniProtKB/Tr... [more]
vbh-14.183e-12752.34Vasa-and Belle-like Helicase [Source:UniProtKB/Tr... [more]
vbh-14.471e-12752.34Vasa-and Belle-like Helicase [Source:UniProtKB/Tr... [more]
back to top
BLAST of Nipped-B protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nipped-B0.000e+032.59gene:FBgn0026401 transcript:FBtr0301455[more]
Nipped-B0.000e+032.59gene:FBgn0026401 transcript:FBtr0301456[more]
Nipped-B0.000e+032.59gene:FBgn0026401 transcript:FBtr0301454[more]
Nipped-B0.000e+032.59gene:FBgn0026401 transcript:FBtr0334994[more]
Nipped-B0.000e+032.59gene:FBgn0026401 transcript:FBtr0111119[more]
back to top
BLAST of Nipped-B protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nipbla2.080e-8340.58NIPBL cohesin loading factor a [Source:NCBI gene;A... [more]
nipblb1.456e-9240.58NIPBL cohesin loading factor b [Source:NCBI gene;A... [more]
nipblb1.629e-9240.58NIPBL cohesin loading factor b [Source:NCBI gene;A... [more]
ddx3xa2.897e-14955.79DEAD-box helicase 3 X-linked a [Source:ZFIN;Acc:ZD... [more]
ddx3xb5.211e-14755.14DEAD-box helicase 3 X-linked b [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of Nipped-B protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NIPBL7.419e-9238.84NIPBL, cohesin loading factor [Source:NCBI gene;Ac... [more]
NIPBL8.608e-9238.84NIPBL, cohesin loading factor [Source:NCBI gene;Ac... [more]
NIPBL9.621e-9238.84NIPBL, cohesin loading factor [Source:NCBI gene;Ac... [more]
NIPBL9.935e-9238.84NIPBL, cohesin loading factor [Source:NCBI gene;Ac... [more]
NIPBL1.254e-9138.84NIPBL, cohesin loading factor [Source:NCBI gene;Ac... [more]
back to top
BLAST of Nipped-B protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nipbl2.074e-9437.99NIPBL cohesin loading factor [Source:MGI Symbol;Ac... [more]
D1Pas11.226e-14656.96DNA segment, Chr 1, Pasteur Institute 1 [Source:MG... [more]
Ddx3x1.913e-14456.96DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 3, X-... [more]
Ddx45.116e-11752.42DEAD (Asp-Glu-Ala-Asp) box polypeptide 4 [Source:M... [more]
Ddx45.246e-11752.42DEAD (Asp-Glu-Ala-Asp) box polypeptide 4 [Source:M... [more]
back to top
BLAST of Nipped-B protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7PLI2|NIPB_DROME0.000e+032.59Nipped-B protein OS=Drosophila melanogaster OX=722... [more]
sp|Q6KCD5|NIPBL_MOUSE1.451e-9337.99Nipped-B-like protein OS=Mus musculus OX=10090 GN=... [more]
sp|Q6KC79|NIPBL_HUMAN1.110e-9338.18Nipped-B-like protein OS=Homo sapiens OX=9606 GN=N... [more]
sp|F5HSE3|NIPLA_DANRE1.569e-8240.58Nipped-B-like protein A OS=Danio rerio OX=7955 GN=... [more]
sp|F1QBY1|NIPLB_DANRE1.099e-9140.58Nipped-B-like protein B OS=Danio rerio OX=7955 GN=... [more]
back to top
BLAST of Nipped-B protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A087VXD20.000e+041.47Nipped-B protein OS=Echinococcus multilocularis OX... [more]
W6UEK80.000e+040.74Nipped-B protein OS=Echinococcus granulosus OX=621... [more]
A0A0R3X6L10.000e+041.82Nipped-B protein OS=Hydatigena taeniaeformis OX=62... [more]
A0A068WWI61.223e-1143.17Nipped-B protein OS=Echinococcus granulosus OX=621... [more]
A0A0R3VW004.321e-3343.97Nipped-B protein OS=Taenia asiatica OX=60517 GN=TA... [more]
back to top
BLAST of Nipped-B protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nipblb2.383e-9238.91NIPBL cohesin loading factor [Source:NCBI gene;Acc... [more]
ddx3xb8.554e-15056.60DEAD-box helicase 3 X-linked b [Source:ZFIN;Acc:ZD... [more]
ddx3xa2.634e-14856.43DEAD-box helicase 3 X-linked [Source:NCBI gene;Acc... [more]
ddx3xa2.724e-14856.43DEAD-box helicase 3 X-linked [Source:NCBI gene;Acc... [more]
ddx3xa2.543e-14556.43DEAD-box helicase 3 X-linked [Source:NCBI gene;Acc... [more]
back to top
BLAST of Nipped-B protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000003898.12.186e-15157.92pep scaffold:Pmarinus_7.0:GL481305:13824:21767:-1 ... [more]
ddx461.085e-7244.62DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 [Source:... [more]
ddx421.680e-6942.64DEAD (Asp-Glu-Ala-Asp) box helicase 42 [Source:ZFI... [more]
ddx233.003e-6941.78DEAD (Asp-Glu-Ala-Asp) box polypeptide 23 [Source:... [more]
ddx495.482e-4839.22DEAD (Asp-Glu-Ala-Asp) box polypeptide 49 [Source:... [more]
back to top
BLAST of Nipped-B protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
DBP19.344e-12955.13Putative ATP-dependent RNA helicase of the DEAD-bo... [more]
DED19.523e-12751.88ATP-dependent DEAD (Asp-Glu-Ala-Asp)-box RNA helic... [more]
DBP21.342e-8644.33ATP-dependent RNA helicase of the DEAD-box protein... [more]
DBP35.936e-6940.80RNA-Dependent ATPase, member of DExD/H-box family;... [more]
PRP287.008e-6341.86RNA binding protein; involved in RNA isomerization... [more]
back to top
BLAST of Nipped-B protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
PL101.366e-14050.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
VAS11.910e-9754.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO277088.325e-9452.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
VAS29.577e-8654.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO380611.547e-7944.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Nipped-B protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000009536.21.302e-8541.73nipped-B-like protein [Source:NCBI gene;Acc:101156... [more]
nipbla1.395e-7937.62NIPBL cohesin loading factor [Source:NCBI gene;Acc... [more]
ddx3xa2.833e-14857.02DEAD-box helicase 3 X-linked [Source:NCBI gene;Acc... [more]
ddx3xa7.816e-14855.60DEAD-box helicase 3 X-linked [Source:NCBI gene;Acc... [more]
ddx3xa9.702e-14855.60DEAD-box helicase 3 X-linked [Source:NCBI gene;Acc... [more]
back to top
BLAST of Nipped-B protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000051020.10.000e+096.60SMESG000051020.1[more]
SMESG000051020.10.000e+096.60SMESG000051020.1[more]
SMESG000051020.10.000e+096.60SMESG000051020.1[more]
SMESG000051020.10.000e+096.60SMESG000051020.1[more]
SMESG000013025.10.000e+0100.00SMESG000013025.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024574 ID=SMED30024574|Name=Nipped-B protein|organism=Schmidtea mediterranea sexual|type=transcript|length=7827bp
TATCAAGCAAATTTGATTTAAATTTTAATAACATGGCTGGTAACGTAGAA
AACAGTATCAATGTAATTACTGATCAGATGGGAAATCTTGATGTTAAATT
AAATGAAAATATTAATCAAAATCAGAACTCTAGTATGACACCGGATTTAA
ATTTATTGACACAAAATAAGTATTTAGAAAATATGTTAATGATGAATACA
TATGGAGTTAATTACGATCCTGTATTTCTATCTCAATATTTAGCTGCTCA
GCAGCTTTCTAATAATTTTATGGCTAATAGAAATCAGATTAATGCTGCTT
ATTCGTCTCAGCAATTTCCTAATCAATCAATACCACTTAAAAATTTATAT
GACCAAAGTCATTTAAAATATTCACAAAACTCTAATTCTTGGAGACCAGC
TATGAATAATCCTAATTTATATGATGGTGTTAAACAGAATCCACTGAGTT
TACATTATTTACAAAATGGAATGGATATGTATACAAACTTAGATAATAAT
TCTCTAACCAGTGCAATTAATTTTGATAAGTATGATGCAATACCAGTCAG
TGTAACTGGACCCGACTATTCAGCGATAAATGTAGAAAATTTTGACGAAT
TAAAATTGAATCCGATAATAAGAAATAATATACTTTTGGCATCTTATCAG
CGTCCTACTCCAATTCAAAAAAATGCAATACCAGCAATTTTGGAACATAG
AGACATTATGGCATGTGCTCAGACTGGTTCAGGAAAAACTGCTGCATTTT
TAATTCCAATTATAAACCATCTGATAAGTCAAGATTTGAGTCCACAAAGA
TATACTAAAACGGCTTATCCAAAATGCCTAATTCTCGCGCCTACTAGAGA
GTTAGCTATACAAATATTATCCGAGTCTCAAAAGTTTTCATTAAATACAC
AAATGAGATCCTGCGTAGTTTATGGCGGTGCTGACACCCATTCACAAATC
AGAGAAGTGCAAATCGGGTGCCACTTACTCGTTGCCACTCCCGGAAGGCT
GGTTGACTTTATTGAGAAAAATAAAATCTCTTTGGAAATGTGCAAATATA
TTGTCCTTGATGAAGCCGATAGGATGCTAGACATGGGATTTGAACCTCAA
ATCAGGAAAATTATTGAAGAATCAAATATGCCATCTGGTATCAACAGACA
GACATTAATGTTCTCAGCTACTTTTCCAAAAGAAATACAAGTATATTTTA
ATCTTTTTTTGCTTTGATAATTTATCCAAATCCGTTATGAAAATATTTTT
TGTAGAAATTAGCTGCAGATTTTCTTTATAATTATATTTTCATGACTGTT
GGTAGAGTCGGTAGTACCAGTGATAGTATTAAACAAGAAATCATTTATAT
GACTGACGTTGAAAAATTAAATTATCTGAAAAATATTTTCAACACAACTG
CTCCAAATACATTGATATTGATTTTCGTCGAAACTAAAAAAGGTGCTGAT
AGTTTAGCAAGATTTCTCTTGAGTAAAGGTTATCCTGTGTCTAGTATACA
TGGGGATAGAAATCAGGGAGAAAGGGAACATGCTTTAAACATGTTTCGAA
ATGGACAGTGTCCAATTTTAGTTGCAACAGCTGTTGCTGCGAGAGGCTTA
GACATACCAAATGTTAAACATGTGATTAATTATGATTTACCGTCTGATAT
TGAAGAATATGTTCACCGAATCGGTAGAACTGGTAGGTTAGGTAATCACG
GCAGAGCTACATCATTCTATGTTGACAAAAATAACAATATCGCTATTGAT
TTGGTCGATTTATTAAAAGAAGCCAATCAAATAGTTCCTCAGTGGTTAAG
TGCCTTAGCAGATGAATTGAAACGCAATTCAGTGATCGGTTCTAATAATA
AGCGTCATAATCAAAGAAGATTTAAAAACGGAAATTTCGGCGGTCGAGAT
TACCGGCAAGGAACAACGAGCGTTAACATGAATTCTAATGTCAACCAAGA
TTACTTTATATCTGGATCTGTGGCACCTCGACACGCCAAATTGAATAACG
GAAACTATTTCTCACGGTCTAATGAAATGCACGATCAGCACGCAAACCAA
AACAACAACAACAACAACATCACCAACACCAGAAACAGCAATCATATGAG
AATATTGATAATTTAAGGAAATTGAAATTTCGTAAAAATAACAAAAAACG
GAAGAATGAACTCGATGGTTTAAAGACTTGGTTTGTTGGATCTGGTCCTC
AAAAGGACGCCAATGGTGAAGTTGTAGATCTCACAGTCAATCAGGAATCG
AATTGGGACAAAACGTTGGGGAGTTACAGTCAGAAAATGACTGTAAAAGC
TCGTAAACGGAAACGAACTGTAAAACAAACCTCAGAAAACTCGGCATTTG
TGTTCGAAAATGATGAAGAATACGTAGAGGCTACAAATGTTTCCAATAAT
GCAGACGAGTCGGACTCGTACACAGATGTGTCGAAAAGAACTCTAAGAAA
CAACAGTATTAACTATGTTGGCATGGAAGATGGAGTAGAGAATTCTGATG
ACATTTCACAGTCGCGTGCAAAGAAACGAAAAAAAGATGACGATGAGCCG
TTTGAAGTGAAATTGAAAGATCCAAATGAGATCAAATATCCGCACATCAA
GAAATCACAGGAAATCAATCACAAACGCCGGGAAAGGGTCAACGGATTGA
CAAAGTTATCGAACACCACTAAGAAAGTCCAATTGCCTCTGGACATGCTC
GATCCTAGCCTGATTACTGAATCTACCACTTATCAGCACTTCATATCACT
GGTGGATGGCTGTCTAGAGGTCGTCGAAGATCTTGATCTCATTAAAACTA
TGAAAGAACAAACCGAATCTGACATTCCGATATCCTTGCCGCCAGATATT
CTCATCTCCAGGGAGCAATTGCAGGCAATGTGCATTGAAATCGCGAAACT
TAAAGCTACTGGATCAACGAAAGAAGTTCCGATGGAAAAATTGACAAAAA
TCCTCACGTTACTCATGCTAAACATCAGTAGCGGAGCAAAAGTTTGCTTG
CCAGTCACTGAAGATGGCGAAGACAACCGACTATTTAAAGAGCTGGCATT
CGAACGAATCGGTAGGAGCCTTGATGCCAGTTTCATTACTATTAACATAA
TGACTTCTCCCGACATCTCGAATGGAGTATTCATTGAAGACGTACAAGAA
GCCGTTGTAACTAGTGTCAAATATCAGCTAGTCAATCTCATTTTCCCGGA
ATATGATCCCGCCTATAGAACGGTTAATCACGCTAAAGATAATCAGTCCA
GCATCAAAGCCAAGCGTGCCAGAGAAAAAGAACTGCATAAATCGAAGAAC
ATCGTGTATTTCTATAATCGCCTGGTGGATATAATTTCCAATCTTTCCGA
ACTCGTCGTCATCCAAACTCTCACGGACAATGTCATTTTACAGTTGTCGA
GTCTCGGTGTCAGTGTGTTCTTTGTGGAAAATATCAGTGAACTGCAATTG
GTTTCCTTGCGGTTAATAACTACCATCTTTTCCAAATATGAGAAGCATCG
GAATTTAATTATGGATGATATTATTGCTTCTCTATCTCGTCTTCCGTCAA
GCAAGAAAAACATGAGAAATTATCGCCTGAATTCAGAAGATAGTATTCAA
ATGTTAACAGCTCTTTCATTGCTTCTTGTCCAGTCTGTAGTAAATGTGAG
TAAAATCGAAATGAACTCCAACGAGTCCGAGGAGACTGCTCTGTCAGTCG
CCCCTGATAAAATTGTAAAAGAAACCCCTAAAGCTGACAGTGAAGCTGTT
ATTGAAACCTCTTATAATAACGCCTTTGCAACTGCTTACTCGTTTCTTAG
AATATTTCTACACAAATCGACTGTCAAAGGTGAAGATGATTATCGGGCTA
TCTTTGAAAACTTTGTCAGTGATTTATTAGTGACAGTCAATAAGCCGGAA
TGGCCAGCTGCAGAGACTATGTTGACATTATTAGGGTCATTGCTCACTAA
TCAATTTATCAATAAACACTCTGATCAGACGACACGGCTGATTTGTATTG
ATTATCTCGGTACTGTTGCATCGACTTTGCGTCGAGATGCTGTTAGCAGC
ACCATCAATCCCAGTGATATCGAAAACCTCATTATTGATCTGATAAAGGG
CTCGAAATCATCAGATGAAGAAGATGATGATGAGGATGATGATGATGAAA
AGGAAGAACAAAAAGATAACAACGATAATGAGGATGATGAAAATGATGAA
GATATTGAAATCTTGGATGATTATGATGATGCAAGGGGAACGAAGAAAAA
GAATTCCGATATCAATCACAAATCACAATATAATAAATTATTAAAAAATA
TTGATAAAGTTCAAATTCTCAGAGATGCGCTTTTGGATTATTTGAATGCT
GACAAATTTGACACAACTGCCAAGTATGCAAGAGAGTTTTATTTCGGCCA
ATGGTACACTGATTGCGTTAAAGAACTGAAATCTCAAAACAACCAAGCTA
TAGCTATCAGTAATAATGTGAAAGATAAAATGAAAAAAGACACAAACAAG
CCAACCAATAATAATAACAATACTAATAATAATACTATCAACGATATTTC
TATCTTTCAAAAAGCCGAAGACCGGAGGAATCATTTGCTTTATAAAATGT
TTGGCACGTTACCGGATGAGAGTAAAAAATCGAAAAACAATCGAATAAAT
AAATTACGAATTGGTTCAAACCCCGAAAATAACCGATATGATATCCGATT
AAAAGGATCCCTCGATTACGAAGACGCTTGTCTTGTCTGTCGGTATTTGG
CGAGTTTAAAATCCTCTTCTCAGAGTTTCGACATTTACCTGACGAAAATA
TGCCGGTTACTACACGATCCATCGGTTGCACTAAGAACGAAAGCAATGCG
ATGTCTGTCTGCAGTTGTCGAGGCAGATCCGACAATTCTCCGACGAGATG
ACATAGAGAAAGCTGTCCATTTGAGATTTCTCGACTCTTCCACTTCCGTT
CGAGAAGCAGCGGTTGAATTGGTCGGGAAATATCTGCTAACTCGACCGGA
ATTGATCGATCAGTACTATCCAATGATCGCGGAACGCATTCTCGACAAAG
GCACCAGTGTTAGGAAGCGGGTCATTCGGATATTCCGAGACATCTGTGTC
GAGCATACTGAGTTTTCTAAAATCCCGGAAATCTGCGTGAAAATGATAAA
ACGAATCAATGACGAAGAAGCAATAAAGAAACTGGTGAATGAGGTGTTCC
AGAACATGTGGTTTAGTCCGGTCCGGGAAAAGGAAGGCGTCAAACTCCTC
CAGAAAGTAATGAATATCACAGACGTTGTCAGCTCATGCAAGGATATCGG
ATATGAATGGTTCGATCAACTGTTGGAAAGTCTGCTGAAAAAAGAAGATT
CCGACAAATTGCGAGTTGTCGAGAAGGCTTGCAAACAAATAGTTGATTGT
CTAGTGCAAAACATCATGAGACTGGAAGAGATTTCCAGGGACGACAATCA
GAGATTGGTTTCGTGCATGGCAACGTTGCACCTGTTCACGAAAATCCGAC
CGGAACTAATGGTGCAATACACAATGACTTTGCAGCCGTATTTGAATATC
AGGAATGTCAACGATAACGACACGTATATTTTGCATTATGTAGCGAGAAT
TCTCGAAGTCACAGTGCCATTGATTGAGCACCCGGCACAAAATCATATAA
ACCAATTGGAAGTCGACATGGTGAATTTAATCGATAAGCAAGGCAAAATG
GTGCTGGAATCCTGTGTGGCTTGTTTAGCGGCATCTGTCAACAAAATCTC
TCACAACTACTCTCTGGTGAAGGATTGTTTCGATAACTATTTCGACACCC
TGCTGAAATACCGGATGGAAAAGGATCAGACGAAAACACTGCCCCAGGCG
ACAAAGCGAAGAATATTGTCTCGAGGCCTTTTCACTGTAGGACTATTGTG
CAAATATTTCGATTTCAACTGCCTACAATTGGGAAAAGATATCAATATCC
GTATTTTCGAAACGCTGATGTTCTATGCAGAAGACAACACTCTCAGTTGT
GATATTCGCACTCAGGCGATTTCCGGAATTGGGTTCCTGTGTATCCGGTA
CCGAGAGCTTTTGATTTGTCCCCGGTTGTTGAGTTTCTATCACAGCATCC
TGATGAACTCGTTGGAAAATACGAAAACCGAGGACTTTCCGAACTTAATC
TGCTGCGTACTGGACAATATCTATCTGTTTCTTGTCGAAGAAGATGATCG
GCTCAGGCATCTCGATTCATCATGGAAAAATAACGAAAAGAAGGAAAGCC
TAAAAGAAATGGGAGATATGTCATCGGGAACTGGCAGCCATATTGCTCAA
TTGTATTTGAATGCCATTCTCGAGAACATTTTACAGCCTTGGAAACCCGT
CCGGTTGAAGGCGGTTTCATTGGTCGTTATTATCATCCGACAAGGCCTAA
TCAATCCAATTAGTTCTGTCGCATATTTGATTAGTGCCCAAACCGATCCC
AATCCGTCCAATAGAGGGAAAGCTGATAATGAATTGGCGGAAATCGATAA
AAAGTTTTCAGGATTTATAAATATGAAAGCTGTACAAGGAATCAGGACTT
CGTGTAAACTCCAAGAGGTATTAGAAATGTATAACATTCCGGAAAATCGG
CTGAACTGGTGTTCCAAACATATGTTGACCACTCCTGTCATTGTCAGAGG
GGTTTATGACCACAATGCCGACATTCCTTTGGCATTGAATCATAATCTCT
ACACAATGCTGCGATCCAGTAAACAGTTTCGGCGCTCATTTCTTTACGCT
CTATTGGCTATTTTCGGTGAACTCAAATCTAGAATTTCGTTATTGATCTA
CGTCAGCGAAAATCTAGCTCAGTTTCCATATCAGTCTCAGGAAGAACCGC
TTTACCTTGTTCACAATATCGACATCATGGTGTCGAGTATCGGGCCGCAT
TTTACCCAGCAAATCAGAGACCAATTGTACCCGGAACTCGTTGCGCATGA
ATTCAATTCCGATCCATCATCAAACCACCCAGCAACTAAACCGGACACCA
TCCACATCGACGACGAGGAGAATCCCGAAGTATTATACAAACGACTGATG
GATAATCCAAAGGCTTTGCGAAACATGCGGGAAAGCATCCGGAACAGTCG
GGGCTGTGTGTTGCTCATATCACTGAAACAGTATCTAAGGGAATTGTATT
CGCTAACCGACGCGTAATTTGATTTCAATTACGGATAATAATGATATGTG
TGTGTGTGTGTTTGTGTTGGGTTTAGGAAAATCCAGAAATACTCTCCATT
GGATACCGGGAAAGCATGGGAGCGCCAGTTGACCCGCCGTAACGGAATTC
GTTTCGATCCGTTGGTAGCGCTGAATCTCACCGAGGAAACGGTTGCTCAG
GAGAACATCTATCAGAAATTCGTGACCGATGTCCAACAAACCGATATCAA
TCTTGATGCCGATCTCTACCCGAATGAGGGTTACATTTTGATCAATAAGT
TCCTTCATTTGCGCCAATTGGTGATGGCGCTGGATTCCCTGGATATTATT
GGTGATTCAGATGACGATGCATTGATTGGAGGCGGAGGCGGTGGCGGGGG
AGGAGGAGGTGGAGGTGGAGCTCCCAATCGGATGAAATCATCATATTCCC
AGAATAATAATAGACCAGATAATCATCACACTGCGAATTTCCACCAGTTG
CAGCATCCGCCGCCATCCCAACACCATCACCAACAGCAACCGTCACAGTT
ACTGCCGCCTGGAAACGGCTCCCATCCACCGTCAATTGTAGATCACGACG
CAATCATATCAAAATCCAATTCACATCACATGGCATTCATTCAGGGACAA
AACCTCCGGGTGGAAGTCGACAAGTTG
back to top

protein sequence of SMED30024574-orf-1

>SMED30024574-orf-1 ID=SMED30024574-orf-1|Name=SMED30024574-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=405bp
SSKFDLNFNNMAGNVENSINVITDQMGNLDVKLNENINQNQNSSMTPDLN
LLTQNKYLENMLMMNTYGVNYDPVFLSQYLAAQQLSNNFMANRNQINAAY
SSQQFPNQSIPLKNLYDQSHLKYSQNSNSWRPAMNNPNLYDGVKQNPLSL
HYLQNGMDMYTNLDNNSLTSAINFDKYDAIPVSVTGPDYSAINVENFDEL
KLNPIIRNNILLASYQRPTPIQKNAIPAILEHRDIMACAQTGSGKTAAFL
IPIINHLISQDLSPQRYTKTAYPKCLILAPTRELAIQILSESQKFSLNTQ
MRSCVVYGGADTHSQIREVQIGCHLLVATPGRLVDFIEKNKISLEMCKYI
VLDEADRMLDMGFEPQIRKIIEESNMPSGINRQTLMFSATFPKEIQVYFN
LFLL*
back to top

protein sequence of SMED30024574-orf-2

>SMED30024574-orf-2 ID=SMED30024574-orf-2|Name=SMED30024574-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=275bp
MTVGRVGSTSDSIKQEIIYMTDVEKLNYLKNIFNTTAPNTLILIFVETKK
GADSLARFLLSKGYPVSSIHGDRNQGEREHALNMFRNGQCPILVATAVAA
RGLDIPNVKHVINYDLPSDIEEYVHRIGRTGRLGNHGRATSFYVDKNNNI
AIDLVDLLKEANQIVPQWLSALADELKRNSVIGSNNKRHNQRRFKNGNFG
GRDYRQGTTSVNMNSNVNQDYFISGSVAPRHAKLNNGNYFSRSNEMHDQH
ANQNNNNNNITNTRNSNHMRILII*
back to top

protein sequence of SMED30024574-orf-3

>SMED30024574-orf-3 ID=SMED30024574-orf-3|Name=SMED30024574-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=118bp
MALDSLDIIGDSDDDALIGGGGGGGGGGGGGGAPNRMKSSYSQNNNRPDN
HHTANFHQLQHPPPSQHHHQQQPSQLLPPGNGSHPPSIVDHDAIISKSNS
HHMAFIQGQNLRVEVDKL
back to top

protein sequence of SMED30024574-orf-4

>SMED30024574-orf-4 ID=SMED30024574-orf-4|Name=SMED30024574-orf-4|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1627bp
MTVKARKRKRTVKQTSENSAFVFENDEEYVEATNVSNNADESDSYTDVSK
RTLRNNSINYVGMEDGVENSDDISQSRAKKRKKDDDEPFEVKLKDPNEIK
YPHIKKSQEINHKRRERVNGLTKLSNTTKKVQLPLDMLDPSLITESTTYQ
HFISLVDGCLEVVEDLDLIKTMKEQTESDIPISLPPDILISREQLQAMCI
EIAKLKATGSTKEVPMEKLTKILTLLMLNISSGAKVCLPVTEDGEDNRLF
KELAFERIGRSLDASFITINIMTSPDISNGVFIEDVQEAVVTSVKYQLVN
LIFPEYDPAYRTVNHAKDNQSSIKAKRAREKELHKSKNIVYFYNRLVDII
SNLSELVVIQTLTDNVILQLSSLGVSVFFVENISELQLVSLRLITTIFSK
YEKHRNLIMDDIIASLSRLPSSKKNMRNYRLNSEDSIQMLTALSLLLVQS
VVNVSKIEMNSNESEETALSVAPDKIVKETPKADSEAVIETSYNNAFATA
YSFLRIFLHKSTVKGEDDYRAIFENFVSDLLVTVNKPEWPAAETMLTLLG
SLLTNQFINKHSDQTTRLICIDYLGTVASTLRRDAVSSTINPSDIENLII
DLIKGSKSSDEEDDDEDDDDEKEEQKDNNDNEDDENDEDIEILDDYDDAR
GTKKKNSDINHKSQYNKLLKNIDKVQILRDALLDYLNADKFDTTAKYARE
FYFGQWYTDCVKELKSQNNQAIAISNNVKDKMKKDTNKPTNNNNNTNNNT
INDISIFQKAEDRRNHLLYKMFGTLPDESKKSKNNRINKLRIGSNPENNR
YDIRLKGSLDYEDACLVCRYLASLKSSSQSFDIYLTKICRLLHDPSVALR
TKAMRCLSAVVEADPTILRRDDIEKAVHLRFLDSSTSVREAAVELVGKYL
LTRPELIDQYYPMIAERILDKGTSVRKRVIRIFRDICVEHTEFSKIPEIC
VKMIKRINDEEAIKKLVNEVFQNMWFSPVREKEGVKLLQKVMNITDVVSS
CKDIGYEWFDQLLESLLKKEDSDKLRVVEKACKQIVDCLVQNIMRLEEIS
RDDNQRLVSCMATLHLFTKIRPELMVQYTMTLQPYLNIRNVNDNDTYILH
YVARILEVTVPLIEHPAQNHINQLEVDMVNLIDKQGKMVLESCVACLAAS
VNKISHNYSLVKDCFDNYFDTLLKYRMEKDQTKTLPQATKRRILSRGLFT
VGLLCKYFDFNCLQLGKDINIRIFETLMFYAEDNTLSCDIRTQAISGIGF
LCIRYRELLICPRLLSFYHSILMNSLENTKTEDFPNLICCVLDNIYLFLV
EEDDRLRHLDSSWKNNEKKESLKEMGDMSSGTGSHIAQLYLNAILENILQ
PWKPVRLKAVSLVVIIIRQGLINPISSVAYLISAQTDPNPSNRGKADNEL
AEIDKKFSGFINMKAVQGIRTSCKLQEVLEMYNIPENRLNWCSKHMLTTP
VIVRGVYDHNADIPLALNHNLYTMLRSSKQFRRSFLYALLAIFGELKSRI
SLLIYVSENLAQFPYQSQEEPLYLVHNIDIMVSSIGPHFTQQIRDQLYPE
LVAHEFNSDPSSNHPATKPDTIHIDDEENPEVLYKRLMDNPKALRNMRES
IRNSRGCVLLISLKQYLRELYSLTDA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003682chromatin binding
GO:0005488binding
GO:0003676nucleic acid binding
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0003723RNA binding
GO:0003743translation initiation factor activity
GO:0004004ATP-dependent RNA helicase activity
GO:0004386helicase activity
GO:0016787hydrolase activity
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005829cytosol
GO:0071014post-mRNA release spliceosomal complex
Vocabulary: biological process
TermDefinition
GO:0007049cell cycle
GO:0010468regulation of gene expression
GO:0002183cytoplasmic translational initiation
GO:0006412translation
GO:0006413translational initiation
GO:0010501RNA secondary structure unwinding
GO:0031047gene silencing by RNA
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000136whole organism
PLANA:0000463cholinergic neuron
Vocabulary: INTERPRO
TermDefinition
IPR033031SCC2/Nipped-B
IPR024986Nipped-B_C
IPR026003Cohesin_HEAT
IPR011989ARM-like
IPR016024ARM-type_fold
IPR014001Helicase_ATP-bd
IPR011545DEAD/DEAH_box_helicase_dom
IPR027417P-loop_NTPase
IPR000629RNA-helicase_DEAD-box_CS
IPR014014RNA_helicase_DEAD_Q_motif
IPR001650Helicase_C
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR024986Sister chromatid cohesion C-terminal domainPFAMPF12830Nipped-B_Ccoord: 1417..1614
e-value: 4.8E-53
score: 180.0
IPR026003HEAT repeat associated with sister chromatid cohesion proteinPFAMPF12765Cohesin_HEATcoord: 938..979
e-value: 3.6E-12
score: 46.3
IPR011989Armadillo-like helicalGENE3DG3DSA:1.25.10.10coord: 890..1258
e-value: 3.0E-7
score: 31.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 145..171
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1637..1658
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 688..741
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 692..728
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..15
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 152..171
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..24
NoneNo IPR availablePANTHERPTHR21704:SF18NIPPED-B-LIKE PROTEINcoord: 5..1709
IPR033031SCC2/Nipped-B familyPANTHERPTHR21704NIPPED-B-LIKE PROTEIN DELANGIN SCC2-RELATEDcoord: 5..1709
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 1301..1637
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 422..1296