SMED30024572

Overview
NameSMED30024572
Smed IDSMED30024572
Length (bp)4230
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30024572 (SMED30024572) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30024572 (SMED30024572) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30024572 (SMED30024572) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30024572 (SMED30024572) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024572

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30024572h1SMcG0008972 dd_Smed_v4_2130_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30024572h1SMcG0008972 dd_Smed_v4_2130_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30024572h1SMcG0008972 dd_Smed_v4_2130_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30024572h1SMcG0008972 dd_Smed_v4_2130_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30024572h1SMcG0008972 dd_Smed_v4_2130_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30024572 vs. Ensembl Zebrafish
Match: BX511082.1 (pep chromosome:GRCz11:9:14291932:14297132:1 gene:ENSDARG00000113678.1 transcript:ENSDART00000183119.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX511082.1)

HSP 1 Score: 75.8702 bits (185), Expect = 1.032e-26
Identity = 52/146 (35.62%), Postives = 76/146 (52.05%), Query Frame = -1
Query: 1699 DLGQAYYQVELSEESQIKTAFSTREWQFCFNRLPF*LSTAPATFQRLTH*AL---IFKGVVVYLDNILI*AQTQEEHDRIIFEVFSGIKKDGLKINTEKYQFYKSEFNFIGHTIKVYIQR*KIELVKA------PKCVSRLRSFLG 2109
            DL  AY+ V + E  + KTAF+T    F +  LPF LS APA FQ L +  L   + + + VYLD+ILI + + +EH + +  V   + ++GL +  EK  F+     F+GH + V   R   E V+A      P     L+ FLG
Sbjct:  614 DLRNAYHLVRIREGDEWKTAFNTPRGHFEYCVLPFGLSNAPAVFQALVNDVLRDMLDQFIYVYLDDILIFSHSLQEHVQHVRRVLQRLLENGLYVKAEKCVFHAQSVPFLGHIVSVEGMRMDPEKVQAVVDWPTPDSRKALQRFLG 759          

HSP 2 Score: 47.3654 bits (111), Expect = 1.032e-26
Identity = 21/58 (36.21%), Postives = 36/58 (62.07%), Query Frame = -3
Query: 2156 ISKKLTESKNYQKVSKCRSPKNSPLVIVGQKDGSIRICLDFRRLNAVTDKYSFPMPDM 2329
            + K +++S   + +    SP  +    V +KDGS+R C+D+R LNA+T K ++P+P M
Sbjct:  540 MEKYISDSLAAKIIRPSSSPAGAGFFFVKKKDGSLRPCIDYRGLNAITVKNTYPLPLM 597          

HSP 3 Score: 31.9574 bits (71), Expect = 1.032e-26
Identity = 16/45 (35.56%), Postives = 23/45 (51.11%), Query Frame = -2
Query: 1494 WNEECKNSFNSLKKVLCEAPVLEFPMSDRMFIIYTDAS---FGAI 1619
            W+   + +F+ LK     AP+L  P   R F++  DAS    GAI
Sbjct:  790 WSNAAQVAFDRLKSCFVSAPILIAPDPSRQFVVEVDASEVGVGAI 834          

HSP 4 Score: 26.5646 bits (57), Expect = 1.032e-26
Identity = 8/15 (53.33%), Postives = 12/15 (80.00%), Query Frame = -3
Query: 1661 FGLTNYYRRFIKDYS 1705
             G  N+YRRFI+++S
Sbjct:  758 LGFANFYRRFIRNFS 772          

HSP 5 Score: 69.707 bits (169), Expect = 3.221e-12
Identity = 50/187 (26.74%), Postives = 82/187 (43.85%), Query Frame = -3
Query:  395 VLVPQNYVTTLINYIHIE--LCHLGILKTLYYMKDFFYWNNLSQSVIKCINECSICAKRKIEQGRTRELLLPR--PGEKFSEQMVIDIAYMETSEWNKKYVIVIIDRFSK---LVSLTGTTEQDEITVFNVVLDNWIYRFGKPDSILTDRGKIFEGS*RREWM*KFGLRQEFNSPYQHQSNGLAERT 934
            + VP+   + +I + H     CH G+ +TLY +K  F+W  +++ +   +  CS+CA  K        LL P   P   +S   +  +  +  S  N   ++ ++DRFSK    + L       E      V+D+     G P  +++DRG  F     RE+    G     +S +  QSNG  ER 
Sbjct:  992 LFVPEELRSDVIRWGHSSKLACHPGVSRTLYLIKQRFWWPVMARDIRNFVLACSVCAVSKTSNRPPAGLLQPLSVPSRPWSHIALDFVTGLPPSNGN-TVILTVVDRFSKATHFIPLPKLPSARETAA--AVIDHVFRIHGLPTDVVSDRGPQFISKFWREFCHLMGATVSLSSGFHPQSNGQTERA 1175          

HSP 6 Score: 23.0978 bits (48), Expect = 3.221e-12
Identity = 25/126 (19.84%), Postives = 56/126 (44.44%), Query Frame = -2
Query:    6 NNWCELLPRIEFCLNAKIQSSTGFSTFD--IVYS--------RKINLISNSGNVQELKDEILKSAKVNIENAGNSMKGSDQDKRGTRILDVGEKVLVRLK--PHKRKKNGML--YEGPYEILRFIS 341
            ++W + L  +E+  N+   S+TG S F+  + Y          ++ + S    VQ  +    ++ +  ++    +   +D+ +    +  VG+KV +  K  P +   N +   + GP+ + + IS
Sbjct: 1192 SSWSQQLSWVEYAHNSLPVSATGLSPFECSLGYQPPAFPSLESEVAVPSAHAFVQRCRRTWNRARQTLLQVGLRTKAKADRHRSKPPVYVVGQKVWLSSKNIPLRTVCNKLAPKFIGPFSVTKIIS 1317          
BLAST of SMED30024572 vs. Ensembl Zebrafish
Match: BX546500.1 (pep chromosome:GRCz11:23:12926092:12931693:-1 gene:ENSDARG00000086495.3 transcript:ENSDART00000122176.3 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX546500.1)

HSP 1 Score: 74.3294 bits (181), Expect = 9.917e-26
Identity = 51/146 (34.93%), Postives = 75/146 (51.37%), Query Frame = -1
Query: 1699 DLGQAYYQVELSEESQIKTAFSTREWQFCFNRLPF*LSTAPATFQRLTH*AL---IFKGVVVYLDNILI*AQTQEEHDRIIFEVFSGIKKDGLKINTEKYQFYKSEFNFIGHTIKVYIQR*KIELVKA------PKCVSRLRSFLG 2109
            DL  AY+ V +    + KTAF+T    F +  LPF LS APA FQ L +  L   I + + VYLD+ILI + + +EH + +  V   + ++GL +  EK  F+     F+GH + V   R   E ++A      P     L+ FLG
Sbjct:  588 DLRNAYHLVRIRPGDEWKTAFNTPRGHFEYCVLPFGLSNAPAVFQALVNDVLRDMIDQFIYVYLDDILIFSHSLQEHVQHVRRVLQRLLENGLYVKAEKCVFHAQSVQFLGHIVSVEGMRMDPEKIQAVVDWPTPDSRKALQRFLG 733          

HSP 2 Score: 45.8246 bits (107), Expect = 9.917e-26
Identity = 20/58 (34.48%), Postives = 36/58 (62.07%), Query Frame = -3
Query: 2156 ISKKLTESKNYQKVSKCRSPKNSPLVIVGQKDGSIRICLDFRRLNAVTDKYSFPMPDM 2329
            + K +++S   + +    SP  +    V +KDGS+R C+D+R LN++T K ++P+P M
Sbjct:  514 MEKYISDSLAAKIIRPSSSPAGAGFFFVKKKDGSLRPCIDYRGLNSITVKNTYPLPLM 571          

HSP 3 Score: 31.5722 bits (70), Expect = 9.917e-26
Identity = 16/45 (35.56%), Postives = 23/45 (51.11%), Query Frame = -2
Query: 1494 WNEECKNSFNSLKKVLCEAPVLEFPMSDRMFIIYTDAS---FGAI 1619
            W+   + +F+ LK     AP+L  P   R F++  DAS    GAI
Sbjct:  764 WSSAAEAAFSKLKGCFVSAPILIAPDPSRQFVVEVDASEVGVGAI 808          

HSP 4 Score: 26.5646 bits (57), Expect = 9.917e-26
Identity = 8/15 (53.33%), Postives = 12/15 (80.00%), Query Frame = -3
Query: 1661 FGLTNYYRRFIKDYS 1705
             G  N+YRRFI+++S
Sbjct:  732 LGFANFYRRFIRNFS 746          

HSP 5 Score: 73.9442 bits (180), Expect = 2.517e-13
Identity = 52/187 (27.81%), Postives = 85/187 (45.45%), Query Frame = -3
Query:  395 VLVPQNYVTTLINYIHIE--LCHLGILKTLYYMKDFFYWNNLSQSVIKCINECSICAKRKIEQGRTRELLLPR--PGEKFSEQMVIDIAYMETSEWNKKYVIVIIDRFSK---LVSLTGTTEQDEITVFNVVLDNWIYRFGKPDSILTDRGKIFEGS*RREWM*KFGLRQEFNSPYQHQSNGLAERT 934
            + VP+   + ++ + H     CH G+ +TL+ +K  F+W  +++ V   +  CS+CA  K        LL P   P   +S   +  +  + +S  N   V+ ++DRFSK    +SL       E  V   V+D+     G P  +++DRG  F     RE+    G     +S +  QSNG  ER 
Sbjct:  966 LFVPEELRSDVVRWGHSSKVACHPGVSRTLFVIKQRFWWPTMARDVRDFVLACSVCAVSKSSNRPPAGLLQPLSVPSRPWSHISLDFVTGLPSSNGN-TVVLTVVDRFSKAAHFISLPKLPSARETAV--AVIDHVFRIHGLPTDVVSDRGPQFVSRFWREFCRLLGATVSLSSGFHPQSNGQTERA 1149          

HSP 6 Score: 23.0978 bits (48), Expect = 2.517e-13
Identity = 10/28 (35.71%), Postives = 16/28 (57.14%), Query Frame = -2
Query:  258 NNWCELLPRIEFCLNAKIQSSTGFSTFD 341
            ++W + L  +E+  N+   SSTG S F 
Sbjct: 1166 SSWSQQLSWVEYAHNSLPVSSTGLSPFQ 1193          
BLAST of SMED30024572 vs. Ensembl Zebrafish
Match: CR925755.2 (pep chromosome:GRCz11:17:42486740:42492668:-1 gene:ENSDARG00000116402.1 transcript:ENSDART00000183946.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR925755.2)

HSP 1 Score: 76.6406 bits (187), Expect = 1.541e-25
Identity = 52/146 (35.62%), Postives = 76/146 (52.05%), Query Frame = -1
Query: 1699 DLGQAYYQVELSEESQIKTAFSTREWQFCFNRLPF*LSTAPATFQRLTH*AL---IFKGVVVYLDNILI*AQTQEEHDRIIFEVFSGIKKDGLKINTEKYQFYKSEFNFIGHTIKVYIQR*KIELVKA------PKCVSRLRSFLG 2109
            DL  AY+ V +    + KTAF+T    F +  LPF LS APA FQ L +  L   I + + VYLD+ILI + + +EH + +  V   + ++GL +  EK  F+     F+GHT+ V   R   E ++A      P     L+ FLG
Sbjct:  587 DLRNAYHLVRIRPGDEWKTAFNTPRGHFEYCVLPFGLSNAPAVFQALVNDVLRDMIDQFIYVYLDDILIFSHSLQEHVQHVRRVLQRLLENGLYVKAEKCVFHAQSVQFLGHTVSVEGMRMDPEKIQAVVNWPTPDSRKALQRFLG 732          

HSP 2 Score: 45.8246 bits (107), Expect = 1.541e-25
Identity = 20/58 (34.48%), Postives = 36/58 (62.07%), Query Frame = -3
Query: 2156 ISKKLTESKNYQKVSKCRSPKNSPLVIVGQKDGSIRICLDFRRLNAVTDKYSFPMPDM 2329
            + K +++S   + +    SP  +    V +KDGS+R C+D+R LN++T K ++P+P M
Sbjct:  513 MEKYISDSLAAKIIRPSSSPAGAGFFFVKKKDGSLRPCIDYRGLNSITVKNTYPLPLM 570          

HSP 3 Score: 29.6462 bits (65), Expect = 1.541e-25
Identity = 15/45 (33.33%), Postives = 22/45 (48.89%), Query Frame = -2
Query: 1494 WNEECKNSFNSLKKVLCEAPVLEFPMSDRMFIIYTDAS---FGAI 1619
            W+   + +F+ LK     AP+L  P   R F++  D S    GAI
Sbjct:  763 WSNAAEAAFSKLKGCFVSAPILIAPDPSRQFVVEVDVSEVGVGAI 807          

HSP 4 Score: 25.0238 bits (53), Expect = 1.541e-25
Identity = 7/14 (50.00%), Postives = 11/14 (78.57%), Query Frame = -3
Query: 1664 FGLTNYYRRFIKDY 1705
             G  N+YRRFI+++
Sbjct:  731 LGFANFYRRFIRNF 744          

HSP 5 Score: 72.4034 bits (176), Expect = 1.118e-12
Identity = 53/187 (28.34%), Postives = 85/187 (45.45%), Query Frame = -3
Query:  395 VLVPQNYVTTLINYIHIE--LCHLGILKTLYYMKDFFYWNNLSQSVIKCINECSICAKRKIEQGRTRELLLPR--PGEKFSEQMVIDIAYMETSEWNKKYVIVIIDRFSK---LVSLTGTTEQDEITVFNVVLDNWIYRFGKPDSILTDRGKIFEGS*RREWM*KFGLRQEFNSPYQHQSNGLAERT 934
            + VP++  + +I + H     CH G+ +TL+ +K  F+W  +++ V   +  CS+CA  K        LL P   P   +S   +  +  + +S  N   V+ ++DRFSK    V L       E  V   V+D+     G P  +++DRG  F     RE+    G     +S +  QSNG  ER 
Sbjct:  965 LFVPEDLRSDVIWWGHSSKVACHPGVSRTLFVIKQRFWWPVMARDVRDFVLACSVCAASKSSNRPPAGLLQPLSVPSRPWSHISLDFVTGLPSSNGN-TVVLTVVDRFSKAAHFVPLPKLPSARETAV--AVIDHVFRIHGLPTDVVSDRGPQFVSKFWREFCRLLGATVSLSSGFHPQSNGQTERA 1148          

HSP 6 Score: 21.9422 bits (45), Expect = 1.118e-12
Identity = 9/28 (32.14%), Postives = 16/28 (57.14%), Query Frame = -2
Query:  258 NNWCELLPRIEFCLNAKIQSSTGFSTFD 341
            ++W + L  +E+  N+   S+TG S F 
Sbjct: 1165 SSWSQQLSWVEYAHNSLPVSATGLSPFQ 1192          
BLAST of SMED30024572 vs. Ensembl Zebrafish
Match: BX511224.1 (pep chromosome:GRCz11:2:18017000:18022765:1 gene:ENSDARG00000113243.1 transcript:ENSDART00000186877.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX511224.1)

HSP 1 Score: 73.1738 bits (178), Expect = 3.609e-25
Identity = 51/146 (34.93%), Postives = 75/146 (51.37%), Query Frame = -1
Query: 1699 DLGQAYYQVELSEESQIKTAFSTREWQFCFNRLPF*LSTAPATFQRLTH*AL---IFKGVVVYLDNILI*AQTQEEHDRIIFEVFSGIKKDGLKINTEKYQFYKSEFNFIGHTIKVYIQR*KIELVKA------PKCVSRLRSFLG 2109
            DL  AY+ V +    + KTAF+T    F +  LPF LS APA FQ L +  L   I + + VYLD+ILI + + +EH + +  V   + ++GL +  EK  F+     F+GH + V   R   E ++A      P     L+ FLG
Sbjct:  614 DLRNAYHLVCIRPGDEWKTAFNTPRGHFEYCVLPFGLSNAPAVFQALVNDVLRDMIDQFIYVYLDDILIFSHSLQEHIQHVRRVLQRLLENGLYVKAEKCVFHAQSVQFLGHIVSVEGMRMDPEKIQAVVNWPTPDSRKALQRFLG 759          

HSP 2 Score: 45.8246 bits (107), Expect = 3.609e-25
Identity = 20/58 (34.48%), Postives = 36/58 (62.07%), Query Frame = -3
Query: 2156 ISKKLTESKNYQKVSKCRSPKNSPLVIVGQKDGSIRICLDFRRLNAVTDKYSFPMPDM 2329
            + K +++S   + +    SP  +    V +KDGS+R C+D+R LN++T K ++P+P M
Sbjct:  540 MEKYISDSLAAKIIRPSSSPAGAGFFFVKKKDGSLRPCIDYRGLNSITVKNTYPLPLM 597          

HSP 3 Score: 31.9574 bits (71), Expect = 3.609e-25
Identity = 16/45 (35.56%), Postives = 23/45 (51.11%), Query Frame = -2
Query: 1494 WNEECKNSFNSLKKVLCEAPVLEFPMSDRMFIIYTDAS---FGAI 1619
            W+   + +F+ LK     AP+L  P   R F++  DAS    GAI
Sbjct:  790 WSSAAEAAFSKLKGCFVSAPILIAPDPSRQFVVEVDASEVGVGAI 834          

HSP 4 Score: 25.409 bits (54), Expect = 3.609e-25
Identity = 8/15 (53.33%), Postives = 11/15 (73.33%), Query Frame = -3
Query: 1661 FGLTNYYRRFIKDYS 1705
             G  N+YRRFI ++S
Sbjct:  758 LGFANFYRRFIHNFS 772          

HSP 5 Score: 73.1738 bits (178), Expect = 2.335e-13
Identity = 51/187 (27.27%), Postives = 85/187 (45.45%), Query Frame = -3
Query:  395 VLVPQNYVTTLINYIHIE--LCHLGILKTLYYMKDFFYWNNLSQSVIKCINECSICAKRKIEQGRTRELLLPR--PGEKFSEQMVIDIAYMETSEWNKKYVIVIIDRFSK---LVSLTGTTEQDEITVFNVVLDNWIYRFGKPDSILTDRGKIFEGS*RREWM*KFGLRQEFNSPYQHQSNGLAERT 934
            + VP+   + ++ + H     CH G+ +TL+ +K  F+W  +++ V   +  CS+CA  K        LL P   P   +S   +  +  + +S  N   ++ ++DRFSK    +SL       E  V   V+D+     G P  +++DRG  F     RE+    G     +S +  QSNG  ER 
Sbjct:  992 LFVPEELRSDVVRWGHSSKVACHPGVSRTLFVVKQRFWWPAMARDVRDFVLACSVCAVSKSSNRPPAGLLQPLSVPSRPWSHISLDFVTGLPSSNGN-TVILTVVDRFSKAAHFISLPKLPSARETAV--AVIDHVFRIHGLPTDVVSDRGPQFVSKFWREFCRLLGATVSLSSGFHPQSNGQTERA 1175          

HSP 6 Score: 23.8682 bits (50), Expect = 2.335e-13
Identity = 28/127 (22.05%), Postives = 54/127 (42.52%), Query Frame = -2
Query:    6 NNWCELLPRIEFCLNAKIQSSTGFSTFDIVYSRK----------INLISNSGNVQELKDEILKSAKVNIENAGNSMKG-SDQDKRGTRILDVGEKVLVRLK--PHKRKKNGML--YEGPYEILRFIS 341
            ++W + L  +E+  N+   S+TG S+F      +          + + S    VQ  +      A+  +  AG   K  +D+ +    +  VG+KV +  K  P +   N +   + GP+ + + IS
Sbjct: 1192 SSWSQQLSWVEYAHNSLPVSATGLSSFQCSLGYQPPVFPSLDSEVAVPSVHAFVQRCR-RTWNRARQTLLQAGTRTKAKADRHRSKPPVYVVGQKVWLSSKNIPLRTVCNKLAPKFIGPFIVTKIIS 1317          
BLAST of SMED30024572 vs. Ensembl Zebrafish
Match: CR855320.1 (pep chromosome:GRCz11:1:7956030:7961696:1 gene:ENSDARG00000099359.2 transcript:ENSDART00000159655.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR855320.1)

HSP 1 Score: 72.0182 bits (175), Expect = 6.034e-25
Identity = 51/146 (34.93%), Postives = 74/146 (50.68%), Query Frame = -1
Query: 1699 DLGQAYYQVELSEESQIKTAFSTREWQFCFNRLPF*LSTAPATFQRLTH*AL---IFKGVVVYLDNILI*AQTQEEHDRIIFEVFSGIKKDGLKINTEKYQFYKSEFNFIGHTIKVYIQR*KIELVKA------PKCVSRLRSFLG 2109
            DL  AY+ V +    + K+AF+T    F +  LPF LS APA FQ   +  L   I + + VYLD+ILI + + +EH + I  V   + ++GL +  EK  F+     F+GH + V   R   E +KA      P     L+ FLG
Sbjct:  616 DLRNAYHLVRIRAGDEWKSAFNTPRGHFEYCVLPFGLSNAPAVFQAFVNDVLRDMIDQFIYVYLDDILIFSHSLQEHVQHIRRVLQRLLENGLYVKAEKCVFHAQSVPFLGHIVSVEGLRMDPEKIKAVVNWPTPDSRKALQRFLG 761          

HSP 2 Score: 45.0542 bits (105), Expect = 6.034e-25
Identity = 20/58 (34.48%), Postives = 35/58 (60.34%), Query Frame = -3
Query: 2156 ISKKLTESKNYQKVSKCRSPKNSPLVIVGQKDGSIRICLDFRRLNAVTDKYSFPMPDM 2329
            + K +++S   + +    SP  +    V +KDGS+R C+D+R LN +T K ++P+P M
Sbjct:  542 MGKYISDSLAAKIIRPSSSPAGAGFFFVKKKDGSLRPCIDYRGLNNITVKNTYPLPLM 599          

HSP 3 Score: 31.9574 bits (71), Expect = 6.034e-25
Identity = 16/45 (35.56%), Postives = 23/45 (51.11%), Query Frame = -2
Query: 1494 WNEECKNSFNSLKKVLCEAPVLEFPMSDRMFIIYTDAS---FGAI 1619
            W+   + +F+ LK     AP+L  P   R F++  DAS    GAI
Sbjct:  792 WSSAAEAAFSKLKGCFVSAPILITPDPSRQFVVEVDASEVGVGAI 836          

HSP 4 Score: 26.5646 bits (57), Expect = 6.034e-25
Identity = 8/15 (53.33%), Postives = 12/15 (80.00%), Query Frame = -3
Query: 1661 FGLTNYYRRFIKDYS 1705
             G  N+YRRFI+++S
Sbjct:  760 LGFANFYRRFIRNFS 774          

HSP 5 Score: 71.2478 bits (173), Expect = 1.913e-12
Identity = 49/185 (26.49%), Postives = 81/185 (43.78%), Query Frame = -3
Query:  395 VLVPQNYVTTLINYIHIE--LCHLGILKTLYYMKDFFYWNNLSQSVIKCINECSICAKRKIEQGRTRELLLPR--PGEKFSEQMVIDIAYMETSEWNKKYVIVIIDRFSKLVSLTGTTEQDEITVFNVVLDNWIYRF-GKPDSILTDRGKIFEGS*RREWM*KFGLRQEFNSPYQHQSNGLAERT 934
            + VP+   + +I + H     CH G+ +T + +K  F+W  L++ V   +  CS+CA  K        LL P   P   +S   +  +  +  S  N   ++ ++DRFSK        +        V + N ++R  G P  +++DRG  F     RE+    G     +S +  QSNG  ER 
Sbjct:  994 LFVPEKLRSDVIRWGHSSKVACHPGVSRTSFVIKQRFWWPALARDVRDFVLACSVCAVSKTSNRPPAGLLQPLSVPSRPWSHISLDFVTGLPPSNGN-TVILTVVDRFSKAAHFVPLPKLPSARETAVAVINHVFRIHGLPTDVVSDRGPQFISKFWREFCRLLGATVSLSSGFHPQSNGQTERA 1177          

HSP 6 Score: 22.7126 bits (47), Expect = 1.913e-12
Identity = 25/126 (19.84%), Postives = 55/126 (43.65%), Query Frame = -2
Query:    6 NNWCELLPRIEFCLNAKIQSSTGFSTFD--IVYS--------RKINLISNSGNVQELKDEILKSAKVNIENAGNSMKGSDQDKRGTRILDVGEKVLVRLK--PHKRKKNGML--YEGPYEILRFIS 341
            ++W + L  +E+  N+   S+TG S F   + Y          ++ + S    VQ  +    ++ +  ++    +   +D+ +    +  VG+KV +  K  P +   N +   + GP+ + + IS
Sbjct: 1194 SSWSQQLSWVEYAHNSLPVSATGLSPFQCSLGYQPPVFPSLESEVAVPSVHAFVQRCRRTWSRARQTLLQVGVRTKAKADRHRSKPPVYVVGQKVWLSTKNIPLRTVCNKLAPKFIGPFIVTKIIS 1319          
BLAST of SMED30024572 vs. Ensembl Xenopus
Match: ENSXETT00000006041.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:6:37317867:37322724:1 gene:ENSXETG00000003070.1 transcript:ENSXETT00000006041.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 98.2117 bits (243), Expect = 1.193e-56
Identity = 58/146 (39.73%), Postives = 87/146 (59.59%), Query Frame = -1
Query: 1699 DLGQAYYQVELSEESQIKTAFSTREWQFCFNRLPF*LSTAPATFQRL---TH*ALIFKGVVVYLDNILI*AQTQEEHDRIIFEVFSGIKKDGLKINTEKYQFYKSEFNFIGHTIK---VYIQR*KIELVKA---PKCVSRLRSFLG 2109
            DL   YYQ+ +  E + KTAF      F FNR+P  L  APATFQRL   T   +    V+VYLD++++  +T EEH++ + +VF  ++K+GLK++ EK QF +   N++GH +    +     KIE V +   P+ ++ LRSFLG
Sbjct:  416 DLRSGYYQLPMHPEDKEKTAFICPLGFFEFNRMPQGLCGAPATFQRLMERTVGDMHLLEVLVYLDDLIVFGRTLEEHEQRLLKVFDRLEKEGLKLSPEKCQFCQPSVNYVGHVVSAEGIATDPSKIEAVSSWPKPRTITELRSFLG 561          

HSP 2 Score: 84.3445 bits (207), Expect = 1.193e-56
Identity = 87/412 (21.12%), Postives = 169/412 (41.02%), Query Frame = -3
Query:  398 IVYGSRHLTAREMGYYSQEKNYYSIMNLLC--ILENLYGNKFIVRTDHKALTFMNTTK--NQLAHNFRRSSQTYQ-NMILSCSIENEMIMEMQMDFHG*KMSFAHNAKQSIKMQRRKIKSEVYKQFTRKCK------------------YCGVS----------------KNQNEDIIFKEIIPLLKGEKETVYDEVKQCKYFILIEQLCIL------------SIIEDNKILVLVPQNYVTTLINYIHIELCHLGILKTLYYMKDFFYWNNLSQSVIKCINECSICAKRKIEQGRTRELLLPRPGEKFSEQMVIDIAYMETSEWNKKYVIVIIDRFSKLVSLTGTTEQDEITVFNVVLDNWIYRFGKPDSILTDRGKIFEGS*RREWM*KFGLRQEFNSPYQHQSNGLAER 1480
            + + SR L+  E  Y + +  + ++   +   + E LYG +F V+TD+  LT++ TT   +   H +  +   Y+ ++      +N     +    HG      H   + I++    +++ + +  T +C+                  YC V+                ++Q+ED + +  +  L+ ++  +          +L+++   L            S  +  K  +++PQ +  +++  +H E  HLG  KTL  ++D FYW  + Q V      C  C +RK    R   L          + + ID   +E  E     V+V+ D +++      T +Q  ITV  V+++ +   +G P  I +D+G+ FE     E M   G+ +   +PY  Q +   ER
Sbjct:  672 VAFISRSLSPSERNYPAHKLEFLALKWAVVDKLHEYLYGAEFEVQTDNNPLTYILTTAKLDATGHRWLAALAHYKFSLRYRPGRDNRDADGLSRRPHG----DLHPDDEWIEIPAPGVRT-MCQGITGRCQSGNFAEKIGMTVRGIPKLYCNVTSVGTSTMPALNKGDIKRDQSEDPLCQMAMEALRKKQVQILKTDSHPLASLLVKEWDRLRLRDGLVYRRAPSATDSEKWQLMLPQKHRDSVLMALHDEHGHLGYDKTLGLVRDRFYWPCMKQDVEDYCRSCLRCIQRKTLPSRAAPLSHMESHSPL-DLVCIDFLSIEPDEGGTSNVLVVTDHYTRYAQAFPTKDQRAITVAKVLVERFFIHYGLPKRIHSDQGRDFESKLVHELMSMLGVLKSRTTPYHPQGDPQPER 1077          

HSP 3 Score: 49.2914 bits (116), Expect = 1.193e-56
Identity = 24/56 (42.86%), Postives = 37/56 (66.07%), Query Frame = -3
Query: 2168 ISKKLTESKNYQKVSKCRSPKNSPLVIVGQKDGSIRICLDFRRLN--AVTDKYSFP 2329
            + K L E K    + + RSP  SP+V+V +K+GSIR+C+D+R LN   + D+Y+ P
Sbjct:  342 LRKHLEELKAAGIIKESRSPYASPIVVVRKKNGSIRMCVDYRTLNQRTIPDQYTTP 397          

HSP 4 Score: 38.891 bits (89), Expect = 1.193e-56
Identity = 16/45 (35.56%), Postives = 26/45 (57.78%), Query Frame = -2
Query: 1506 RNNKQIIWNEECKNSFNSLKKVLCEAPVLEFPMSDRMFIIYTDAS 1640
            R + +  W EEC  +F+ LK  L  APVL +  + + + ++ DAS
Sbjct:  609 RESIEDFWTEECDKAFDQLKYCLTHAPVLAYADATKPYTLHIDAS 653          

HSP 5 Score: 27.7202 bits (60), Expect = 1.193e-56
Identity = 23/108 (21.30%), Postives = 48/108 (44.44%), Query Frame = -2
Query:   78 KENNWCELLPRIEFCLNAKIQSSTGFSTFDIVYSRKINLI---------------SNSGNVQELKDEILKSAKVNIENAG-NSMKGSDQDKRGTRILDV--GEKVLVR 347
            K+ +W   +  +    N+    +TG+S + +++ R+  L                S+S  V  LK ++ ++ K   E  G  +M+      +  +I D+  G++VL+R
Sbjct: 1093 KKTHWSRHIATVVHAYNSTKNGATGYSPYFLMFGREARLPIDTVFGVTADDTPVKSHSSYVDRLKRDLQRAYKRAQEAVGKKNMQNKTLYDKKVKIHDLQPGDRVLLR 1200          

HSP 6 Score: 24.2534 bits (51), Expect = 1.193e-56
Identity = 8/15 (53.33%), Postives = 10/15 (66.67%), Query Frame = -3
Query: 1661 FGLTNYYRRFIKDYS 1705
             G   YYRRF+K +S
Sbjct:  560 LGFCGYYRRFVKGFS 574          

HSP 7 Score: 21.1718 bits (43), Expect = 1.193e-56
Identity = 12/49 (24.49%), Postives = 24/49 (48.98%), Query Frame = -2
Query: 2367 ILNFEKKSFFGQIISEFRNIFMASRFDLGYTKIIQHEIKTVGSPIFRTR 2513
            ++  E KS   + ++E   +F  +  D+G +   +H+I+      FR R
Sbjct:  282 VIPPEWKSRLRKHLNEHSALFSRNDLDMGCSTSTKHKIRLREDKPFRER 330          
BLAST of SMED30024572 vs. Ensembl Xenopus
Match: anxa6 (annexin A6 [Source:Xenbase;Acc:XB-GENE-989741])

HSP 1 Score: 74.3294 bits (181), Expect = 1.981e-30
Identity = 48/147 (32.65%), Postives = 80/147 (54.42%), Query Frame = -1
Query: 1699 DLGQAYYQVELSEESQIKTAFSTREWQFCFNRLPF*LSTAPATFQRLTH*ALIFKGV----VVYLDNILI*AQTQEEHDRIIFEVFSGIKKDGLKINTEKYQFYKSEFNFIGHTI---KVYIQR*KIELV---KAPKCVSRLRSFLG 2109
            DL + Y+Q+ L+  +Q K+AF T    + F  +PF +  APATFQRL +   + +G+      YLD+I + +QT EEH + +  VF+ I+  GL +  EK     +E  ++GH +   ++     K+E +     PK   ++ +FLG
Sbjct:  427 DLSRGYWQIPLAPSAQEKSAFLTPFGLYQFTVMPFGMRNAPATFQRLVN--RLLEGMQDFAQAYLDDIAVFSQTWEEHLQHLQRVFAQIQDAGLTLKPEKCHLAMAEVQYLGHRVGGGQLRPDPAKVEAICQWPIPKTQKQVLAFLG 571          

HSP 2 Score: 53.5286 bits (127), Expect = 1.981e-30
Identity = 23/56 (41.07%), Postives = 36/56 (64.29%), Query Frame = -3
Query: 2162 ISKKLTESKNYQKVSKCRSPKNSPLVIVGQKDGSIRICLDFRRLNAVTDKYSFPMP 2329
            +  ++ E   +  ++   SP  SP+V+V +KDGS R C+D+RRLN VT   ++PMP
Sbjct:  353 MKSQIDEMLAFGVITPSHSPWASPVVLVPKKDGSTRFCVDYRRLNDVTTTDAYPMP 408          

HSP 3 Score: 47.7506 bits (112), Expect = 1.981e-30
Identity = 21/48 (43.75%), Postives = 32/48 (66.67%), Query Frame = -2
Query: 1500 RNNKQIIWNEECKNSFNSLKKVLCEAPVLEFPMSDRMFIIYTDAS-FG 1640
            + ++ I+W  EC+++ N+LK+ L  +PVL  P   R FI+ TDAS FG
Sbjct:  597 QRSRTIVWTPECESAMNALKQALASSPVLAAPDFSRRFILQTDASNFG 644          

HSP 4 Score: 41.2022 bits (95), Expect = 7.963e-7
Identity = 37/140 (26.43%), Postives = 64/140 (45.71%), Query Frame = -2
Query:   21 MITTSLKGGFKENNWCELLPRIEFCLNAKIQSSTGFSTFDIVYSRKI----NLI----SNSGNVQELK------------DEILKSAKVNIENAGNSMK-GSDQDKRGTRILDVGEKVLVRLKPHKRKKNGMLYEGPYEI 377
            M+ T ++ G  E +W   LP + F      Q STGFS F+++Y R++    +L+      +   QE+             +++   A  ++  A    K   D+  R  R ++ G+KVL+ L P +  K    +EGPY +
Sbjct:   86 MLRTFVESG--EKDWERYLPHLLFAYREVPQESTGFSPFELLYGRRVRGPLDLLCEYWEGAPQSQEVPIIPYVLKFRQRLEQMTSLAHDHLSAAQQRQKVWYDRKARERRFME-GDKVLL-LVPTRHDKLQAAWEGPYVV 221          

HSP 5 Score: 33.8834 bits (76), Expect = 7.963e-7
Identity = 19/48 (39.58%), Postives = 26/48 (54.17%), Query Frame = -3
Query:  398 RFGKPDSILTDRGKIFEGS*RREWM*KFGLRQEFNSPYQHQSNGLAER 541
            R G P  IL+D+G  F     +    + G+R   +SPY  Q+NGL ER
Sbjct:   31 RVGFPSEILSDQGPQFTSQLLQCLWQRCGVRAIHSSPYHPQTNGLCER 78          
BLAST of SMED30024572 vs. Ensembl Xenopus
Match: alkbh5 (alkB homolog 5, RNA demethylase [Source:Xenbase;Acc:XB-GENE-987580])

HSP 1 Score: 78.1814 bits (191), Expect = 3.966e-22
Identity = 55/145 (37.93%), Postives = 78/145 (53.79%), Query Frame = -1
Query: 1699 DLGQAYYQVELSEESQIKTAFSTREWQFCFNRLPF*LSTAPATFQRLTH*AL-IFKG-VVVYLDNILI*AQTQEEHDRIIFEVFSGIKKDGLKINTEKYQFYKSEFNFIGHTIK---VYIQR*KIELVKA---PKCVSRLRSFLG 2109
            DL + Y+QV L+E ++ KTAFST E Q+ + RLPF L  APATFQR+    L   +G    YLD+++I +   E H   +  V   I K GL  N +K      E  ++G+ I    V  Q  KIE ++    P    ++R+FLG
Sbjct:  325 DLTKGYWQVPLTEGAKEKTAFSTPEGQWQYKRLPFGLHGAPATFQRMMDRILKPHRGYASAYLDDVVIFSPDWESHLPRVQAVLDSIWKAGLTANPKKCAMGLEEARYLGYVIGRGVVKPQVSKIEGIQQWPRPNSKKQVRAFLG 469          

HSP 2 Score: 45.8246 bits (107), Expect = 3.966e-22
Identity = 20/43 (46.51%), Postives = 30/43 (69.77%), Query Frame = -3
Query: 2162 VSKCRSPKNSPLVIVGQKDGSIRICLDFRRLNAVTDKYSFPMP 2290
            + +  S  +SP+V+V + DGSIR C DFR+LN V+   ++PMP
Sbjct:  264 IEESHSEWSSPIVLVPKPDGSIRFCNDFRKLNEVSKFDAYPMP 306          

HSP 3 Score: 22.7126 bits (47), Expect = 3.966e-22
Identity = 6/16 (37.50%), Postives = 11/16 (68.75%), Query Frame = -3
Query: 1661 IFGLTNYYRRFIKDYS 1708
              G+  YYRRF+ +++
Sbjct:  467 FLGIVGYYRRFVPNFA 482          
BLAST of SMED30024572 vs. Ensembl Xenopus
Match: ENSXETT00000034712.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:9:33567219:33572531:-1 gene:ENSXETG00000011772.1 transcript:ENSXETT00000034712.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 65.4698 bits (158), Expect = 5.189e-21
Identity = 42/114 (36.84%), Postives = 63/114 (55.26%), Query Frame = -1
Query: 1777 DLGQAYYQVELSEESQIKTAFSTREWQFCFNRLPF*LSTAPATFQRLTH*A---LIFKGVVVYLDNILI*AQTQEEHDRIIFEVFSGIKKDGLKINTEKYQFYKSEFNFIGHTI 2109
            DL  AY  + + E  + KTAF+TR+  + +  +PF L  APA FQ   +     L+ K VVVYLD+ILI +Q  E H   + E  S ++++ L    EK  F   + +F+G+ I
Sbjct:  610 DLRGAYNLIRIREGDEWKTAFNTRDGHYEYLVMPFGLCNAPAVFQEFVNDIFRDLLGKSVVVYLDDILIFSQDLETHRSQVKEALSRLRENFLFAKLEKCTFEVPKISFLGYII 723          

HSP 2 Score: 41.2022 bits (95), Expect = 5.189e-21
Identity = 19/51 (37.25%), Postives = 30/51 (58.82%), Query Frame = -3
Query: 2162 SKNYQK--VSKCRSPKNSPLVIVGQKDGSIRICLDFRRLNAVTDKYSFPMP 2308
            S+N Q+  +    SP  +    V +KDG +R C+D+R LN +T K  +P+P
Sbjct:  541 SENLQRGFIRPSTSPAGAGFFFVEKKDGGLRPCIDYRGLNKITVKNRYPLP 591          

HSP 3 Score: 28.8758 bits (63), Expect = 5.189e-21
Identity = 10/14 (71.43%), Postives = 12/14 (85.71%), Query Frame = -3
Query: 1661 GLTNYYRRFIKDYS 1702
            G  NYYR+FIKD+S
Sbjct:  755 GFANYYRQFIKDFS 768          

HSP 4 Score: 26.9498 bits (58), Expect = 5.189e-21
Identity = 14/38 (36.84%), Postives = 15/38 (39.47%), Query Frame = -2
Query: 1506 WNEECKNSFNSLKKVLCEAPVLEFPMSDRMFIIYTDAS 1619
            W      +F SLK     A VL  P     F I  DAS
Sbjct:  787 WPPVALEAFQSLKDAFISASVLRHPEPHLPFFIEVDAS 824          

HSP 5 Score: 70.0922 bits (170), Expect = 6.053e-17
Identity = 75/287 (26.13%), Postives = 117/287 (40.77%), Query Frame = -3
Query:  362 QSIKMQ--RRKIKSEVYKQFTRKCKYCGVSKNQNEDIIFKEIIP--LLKGEKETVYDEVK-------QCKYFILIEQLCILSIIEDNKI-LVLVPQNYVTTLINYIHI--ELCHLGILKTLYYMKDFFYWNNLSQSVIKCINECSICAKRKIEQGRTRELL--LPRPGEKFSEQMVIDIAYMETSEWNKKYVIVIIDRFSKLVSLTGTTEQDEITVFNVVLDNWIYRF-GKPDSILTDRGKIFEGS*RREWM*KFGLRQEFNSPYQHQSNGLAERTIDSKVI*LRHH 1171
            QS+K Q  R+   S  + +F     Y   +KN+  D + +   P   L  E+E +    +       Q    IL+ Q    S   D  I +  VP      ++   H   +  H G  KTL  ++   +W  + + V   +  C++CA  K    R   LL  LP P   ++   +  I  +  S  N   + V+IDRFSK+       +         +    I+R  G P  I++DRG  F     R      G+  +F+S Y  Q+NG AER   +    LR+H
Sbjct:  900 QSLKRQNPRQARWSLFFSRFNFVLTYRPGTKNRKADALSRSFSPEDRLPIEQEPIIPPFRIIASVLPQFAEQILLSQSAAPS---DTPIGMAFVPPELRLPILQQTHSSKQAGHPGSEKTLELLRRLVWWPTIRKDVRDFVAACTVCATTKASHSRPCGLLHPLPIPSRPWTHLGMDFIVELPPSCGNT-VIWVVIDRFSKMAHFIPLRKLPSAVELAHLFIQHIFRLHGFPVEIVSDRGSQFVSRFWRSLCKSLGVSLQFSSAYHPQTNGAAERVNQALEQFLRNH 1182          

HSP 6 Score: 39.6614 bits (91), Expect = 6.053e-17
Identity = 34/123 (27.64%), Postives = 56/123 (45.53%), Query Frame = -2
Query:   21 ENNWCELLPRIEFCLNAKIQSSTGFSTFDIVYSRK---------INLISNSGNVQELKDEILKSAKVNIENAGNSMKG-SDQDKRGTRILDVGEKVL-----VRLKPHKRKKNGMLYEGPYEI 344
            +++W +LLP  EF  N    SSTG S F  VY +          ++ +  + ++      I  + K N+E +    K  +D+ ++ +    VGEKV      +RLK     K G  + GP+ I
Sbjct: 1187 QDDWSDLLPWAEFAHNNASHSSTGRSPFLSVYGQHPLAFPQDLLLSEVPAADDLAAHMSVIWAATKSNLEKSSLVHKTFADRRRKPSPPYKVGEKVWLSSRNIRLK-VPSPKLGPKFLGPFSI 1308          
BLAST of SMED30024572 vs. Ensembl Xenopus
Match: ENSXETT00000042189.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:KV460667.1:82848:87648:1 gene:ENSXETG00000017765.1 transcript:ENSXETT00000042189.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 65.4698 bits (158), Expect = 5.278e-21
Identity = 42/114 (36.84%), Postives = 63/114 (55.26%), Query Frame = -1
Query: 1777 DLGQAYYQVELSEESQIKTAFSTREWQFCFNRLPF*LSTAPATFQRLTH*A---LIFKGVVVYLDNILI*AQTQEEHDRIIFEVFSGIKKDGLKINTEKYQFYKSEFNFIGHTI 2109
            DL  AY  + + E  + KTAF+TR+  + +  +PF L  APA FQ   +     L+ K VVVYLD+ILI +Q  E H   + E  S ++++ L    EK  F   + +F+G+ I
Sbjct:  610 DLRGAYNLIRIREGDEWKTAFNTRDGHYEYLVMPFGLCNAPAVFQEFVNDIFRDLLGKSVVVYLDDILIFSQDLETHRSQVKEALSRLRENFLFAKLEKCTFEVPKISFLGYII 723          

HSP 2 Score: 41.2022 bits (95), Expect = 5.278e-21
Identity = 19/51 (37.25%), Postives = 30/51 (58.82%), Query Frame = -3
Query: 2162 SKNYQK--VSKCRSPKNSPLVIVGQKDGSIRICLDFRRLNAVTDKYSFPMP 2308
            S+N Q+  +    SP  +    V +KDG +R C+D+R LN +T K  +P+P
Sbjct:  541 SENLQRGFIRPSTSPAGAGFFFVEKKDGGLRPCIDYRGLNKITVKNRYPLP 591          

HSP 3 Score: 28.8758 bits (63), Expect = 5.278e-21
Identity = 10/17 (58.82%), Postives = 14/17 (82.35%), Query Frame = -3
Query: 1652 GLTNYYRRFIKDYSPYM 1702
            G  NYYR+FIKD+S ++
Sbjct:  755 GFANYYRQFIKDFSSHI 771          

HSP 4 Score: 26.5646 bits (57), Expect = 5.278e-21
Identity = 14/38 (36.84%), Postives = 15/38 (39.47%), Query Frame = -2
Query: 1506 WNEECKNSFNSLKKVLCEAPVLEFPMSDRMFIIYTDAS 1619
            W      +F SLK     A VL  P     F I  DAS
Sbjct:  787 WPPVALEAFQSLKDAFISASVLRHPEPHLPFFIEVDAS 824          

HSP 5 Score: 70.0922 bits (170), Expect = 5.400e-17
Identity = 75/287 (26.13%), Postives = 117/287 (40.77%), Query Frame = -3
Query:  362 QSIKMQ--RRKIKSEVYKQFTRKCKYCGVSKNQNEDIIFKEIIP--LLKGEKETVYDEVK-------QCKYFILIEQLCILSIIEDNKI-LVLVPQNYVTTLINYIHI--ELCHLGILKTLYYMKDFFYWNNLSQSVIKCINECSICAKRKIEQGRTRELL--LPRPGEKFSEQMVIDIAYMETSEWNKKYVIVIIDRFSKLVSLTGTTEQDEITVFNVVLDNWIYRF-GKPDSILTDRGKIFEGS*RREWM*KFGLRQEFNSPYQHQSNGLAERTIDSKVI*LRHH 1171
            QS+K Q  R+   S  + +F     Y   +KN+  D + +   P   L  E+E +    +       Q    IL+ Q    S   D  I +  VP      ++   H   +  H G  KTL  ++   +W  + + V   +  C++CA  K    R   LL  LP P   ++   +  I  +  S  N   + V+IDRFSK+       +         +    I+R  G P  I++DRG  F     R      G+  +F+S Y  Q+NG AER   +    LR+H
Sbjct:  900 QSLKRQNPRQARWSLFFTRFNFVLTYRPGTKNRKADALSRSFSPKDRLPIEQEPIIPPFRIIASVLPQFAEQILLSQSAAPS---DTPIGMAFVPPELRLPILQQTHSSKQAGHPGSEKTLELLRRLVWWPTIRKDVRDFVAACTVCATTKASHSRPCGLLHPLPIPSRPWTHLGMDFIVELPPSCGNT-VIWVVIDRFSKMAHFIPLRKLPSAVELAHLFIQHIFRLHGFPVEIVSDRGSQFVSRFWRSLCKSLGVSLQFSSAYHPQTNGAAERVNQALEQFLRNH 1182          

HSP 6 Score: 39.6614 bits (91), Expect = 5.400e-17
Identity = 34/123 (27.64%), Postives = 56/123 (45.53%), Query Frame = -2
Query:   21 ENNWCELLPRIEFCLNAKIQSSTGFSTFDIVYSRK---------INLISNSGNVQELKDEILKSAKVNIENAGNSMKG-SDQDKRGTRILDVGEKVL-----VRLKPHKRKKNGMLYEGPYEI 344
            +++W +LLP  EF  N    SSTG S F  VY +          ++ +  + ++      I  + K N+E +    K  +D+ ++ +    VGEKV      +RLK     K G  + GP+ I
Sbjct: 1187 QDDWSDLLPWAEFAHNNASHSSTGRSPFLSVYGQHPLAFPQDLLLSEVPAADDLAAHMSVIWAATKSNLEKSSLVHKTFADRRRKPSPPYKVGEKVWLSSRNIRLK-VPSPKLGPKFLGPFSI 1308          
BLAST of SMED30024572 vs. UniProt/SwissProt
Match: sp|P04323|POL3_DROME (Retrovirus-related Pol polyprotein from transposon 17.6 OS=Drosophila melanogaster OX=7227 GN=pol PE=4 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 2.270e-23
Identity = 51/146 (34.93%), Postives = 83/146 (56.85%), Query Frame = -1
Query: 1699 DLGQAYYQVELSEESQIKTAFSTREWQFCFNRLPF*LSTAPATFQRLTH---*ALIFKGVVVYLDNILI*AQTQEEHDRIIFEVFSGIKKDGLKINTEKYQFYKSEFNFIGHTIK---VYIQR*KIELVKA---PKCVSRLRSFLG 2109
            DL + ++Q+E+  ES  KTAFST+   + + R+PF L  APATFQR  +     L+ K  +VYLD+I++ + + +EH + +  VF  + K  LK+  +K +F K E  F+GH +    +     KIE ++    P     +++FLG
Sbjct:  302 DLAKGFHQIEMDPESVSKTAFSTKHGHYEYLRMPFGLKNAPATFQRCMNDILRPLLNKHCLVYLDDIIVFSTSLDEHLQSLGLVFEKLAKANLKLQLDKCEFLKQETTFLGHVLTPDGIKPNPEKIEAIQKYPIPTKPKEIKAFLG 447          

HSP 2 Score: 35.8094 bits (81), Expect = 2.270e-23
Identity = 19/50 (38.00%), Postives = 29/50 (58.00%), Query Frame = -3
Query: 2156 VSKCRSPKNSPLVIVGQK-DGS----IRICLDFRRLNAVTDKYSFPMPDM 2290
            +    SP NSP+ +V +K D S     RI +D+R+LN +T     P+P+M
Sbjct:  236 IRTSNSPYNSPIWVVPKKQDASGKQKFRIVIDYRKLNEITVGDRHPIPNM 285          

HSP 3 Score: 32.7278 bits (73), Expect = 2.270e-23
Identity = 47/158 (29.75%), Postives = 68/158 (43.04%), Query Frame = -2
Query: 1191 RNNKQIIWNEECKNSFNSLKKVLCEAPVLEFPMSDRMFIIYTDAS---FGAI---DRSCDCIWIKTFDST*NGILFTRKELLLNNEFIVHFRESLWQ*IHCENRS--QSIDFHEHYKKPISPQFQT*LANLSEYDFELQYRK*DDHGNADGFSWIKNE 1640
            +N K    N E  ++F  LK ++ E P+L+ P   + F + TDAS    GA+   D        +T +          KELL        FR  L    H E  S  Q + +    K P S +       LSE+DF+++Y K  ++  AD  S IK E
Sbjct:  472 KNMKIDTTNPEYDSAFKKLKYLISEDPILKVPDFTKKFTLTTDASDVALGAVLSQDGHPLSYISRTLNEHEINYSTIEKELLAIVWATKTFRHYLLG-RHFEISSDHQPLSWLYRMKDPNS-KLTRWRVKLSEFDFDIKYIKGKENCVADALSRIKLE 627          
BLAST of SMED30024572 vs. UniProt/SwissProt
Match: sp|Q99315|YG31B_YEAST (Transposon Ty3-G Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TY3B-G PE=1 SV=3)

HSP 1 Score: 68.5514 bits (166), Expect = 6.406e-22
Identity = 47/146 (32.19%), Postives = 78/146 (53.42%), Query Frame = -1
Query: 1699 DLGQAYYQVELSEESQIKTAFSTREWQFCFNRLPF*LSTAPATFQRLTH*ALIFKG---VVVYLDNILI*AQTQEEHDRIIFEVFSGIKKDGLKINTEKYQFYKSEFNFIGHTI---KVYIQR*KIELVK---APKCVSRLRSFLG 2109
            DL   Y+Q+ +  + + KTAF T   ++ +  +PF L  AP+TF R    A  F+    V VYLD+ILI +++ EEH + +  V   +K + L +  +K +F   E  F+G++I   K+   + K   ++    PK V + + FLG
Sbjct:  686 DLHSGYHQIPMEPKDRYKTAFVTPSGKYEYTVMPFGLVNAPSTFARYM--ADTFRDLRFVNVYLDDILIFSESPEEHWKHLDTVLERLKNENLIVKKKKCKFASEETEFLGYSIGIQKIAPLQHKCAAIRDFPTPKTVKQAQRFLG 829          

HSP 2 Score: 48.9062 bits (115), Expect = 6.406e-22
Identity = 19/43 (44.19%), Postives = 30/43 (69.77%), Query Frame = -3
Query: 2162 VSKCRSPKNSPLVIVGQKDGSIRICLDFRRLNAVTDKYSFPMP 2290
            +   +SP +SP+V+V +KDG+ R+C+D+R LN  T    FP+P
Sbjct:  625 IVPSKSPCSSPVVLVPKKDGTFRLCVDYRTLNKATISDPFPLP 667          

HSP 3 Score: 30.8018 bits (68), Expect = 6.406e-22
Identity = 41/152 (26.97%), Postives = 63/152 (41.45%), Query Frame = -2
Query: 1206 WNEECKNSFNSLKKVLCEAPVLEFPMSDRM-FIIYTDAS---FGAIDRSCD---------CIWIKTFDST*NGILFTRKELLLNNEFIVHFRESLWQ*IHCENRSQSIDFHE-HYKKPISPQFQT*LANLSEYDFELQYRK*DDHGNADGFS 1619
            W E+   + + LK  LC +PVL  P +++  + + TDAS    GA+    D           + K+ +S          ELL   + + HFR  L    H   R+  I       K   + + Q  L +L+ YDF L+Y     +  AD  S
Sbjct:  858 WTEKQDKAIDKLKDALCNSPVL-VPFNNKANYRLTTDASKDGIGAVLEEVDNKNKLVGVVGYFSKSLESAQKNYPAGELELLGIIKALHHFRYMLHG-KHFTLRTDHISLLSLQNKNEPARRVQRWLDDLATYDFTLEYLAGPKNVVADAIS 1007          

HSP 4 Score: 68.5514 bits (166), Expect = 4.299e-10
Identity = 86/382 (22.51%), Postives = 156/382 (40.84%), Query Frame = -3
Query:  386 VIVYGSRHLTAREMGYYSQEKNYYSIMNLLCILE-NLYGNKFIVRTDHKALTFMNTTKNQLAHNFRRSSQTYQNMILSCSIENEMIMEMQMDFHG*KMSFAHNAKQSI----KMQRRKIKSEVYKQFTRKCKYCGVSKNQNEDIIFKEIIP-----LLKGEKETVYDEVKQCKYFILIEQLCILSIIEDNKILVLVPQNYVTTLINYIHIELCHLGILKTLYYMKDFFYWNNLSQSVIKCINECSICAKRKIEQGRTRELLLPRPGEKFSEQMVIDIAY-----METSEWNKKYVIVIIDRFSKLVSLTGTTEQDEITVFNVVLDNWIYRF-GKPDSILTDRGKIFEGS*RREWM*KFGLRQEFNSPYQHQSNGLAERTIDS 1483
            V+ Y S+ L + +  Y + E     I+  L      L+G  F +RTDH +L  +   KN+ A    R  Q + + + +     E +        G K   A    +++        R I +E +K + +    C       +++    + P         +K+    E  +  Y +  E +      +D  ++ +  QN V  L +   +   H G+  TL  +   +YW  L  S+I+ I  C  C   K  + R   LL P P    +E   +DI+      +  +  N   ++V++DRFSK      T +  + T    +L  +I+ + G P +I +DR         +E   + G++   +S    Q++G +ERTI +
Sbjct:  915 VVGYFSKSLESAQKNYPAGELELLGIIKALHHFRYMLHGKHFTLRTDHISLLSLQN-KNEPA----RRVQRWLDDLATYDFTLEYLA-------GPKNVVADAISRAVYTITPETSRPIDTESWKSYYKSDPLCSAVLIHMKELTQHNVTPEDMSAFRSYQKKLELSETFRKNYSLEDEMI----YYQDRLVVPIKQQNAVMRLYHDHTLFGGHFGVTVTLAKISPIYYWPKLQHSIIQYIRTCVQCQLIKSHRPRLHGLLQPLP---IAEGRWLDISMDFVTGLPPTSNNLNMILVVVDRFSKRAHFIATRKTLDATQLIDLLFRYIFSYHGFPRTITSDRDVRMTADKYQELTKRLGIKSTMSSANHPQTDGQSERTIQT 1277          
BLAST of SMED30024572 vs. UniProt/SwissProt
Match: sp|Q7LHG5|YI31B_YEAST (Transposon Ty3-I Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TY3B-I PE=1 SV=2)

HSP 1 Score: 68.5514 bits (166), Expect = 8.655e-22
Identity = 47/146 (32.19%), Postives = 78/146 (53.42%), Query Frame = -1
Query: 1699 DLGQAYYQVELSEESQIKTAFSTREWQFCFNRLPF*LSTAPATFQRLTH*ALIFKG---VVVYLDNILI*AQTQEEHDRIIFEVFSGIKKDGLKINTEKYQFYKSEFNFIGHTI---KVYIQR*KIELVK---APKCVSRLRSFLG 2109
            DL   Y+Q+ +  + + KTAF T   ++ +  +PF L  AP+TF R    A  F+    V VYLD+ILI +++ EEH + +  V   +K + L +  +K +F   E  F+G++I   K+   + K   ++    PK V + + FLG
Sbjct:  712 DLHSGYHQIPMEPKDRYKTAFVTPSGKYEYTVMPFGLVNAPSTFARYM--ADTFRDLRFVNVYLDDILIFSESPEEHWKHLDTVLERLKNENLIVKKKKCKFASEETEFLGYSIGIQKIAPLQHKCAAIRDFPTPKTVKQAQRFLG 855          

HSP 2 Score: 48.9062 bits (115), Expect = 8.655e-22
Identity = 19/43 (44.19%), Postives = 30/43 (69.77%), Query Frame = -3
Query: 2162 VSKCRSPKNSPLVIVGQKDGSIRICLDFRRLNAVTDKYSFPMP 2290
            +   +SP +SP+V+V +KDG+ R+C+D+R LN  T    FP+P
Sbjct:  651 IVPSKSPCSSPVVLVPKKDGTFRLCVDYRTLNKATISDPFPLP 693          

HSP 3 Score: 30.4166 bits (67), Expect = 8.655e-22
Identity = 41/152 (26.97%), Postives = 62/152 (40.79%), Query Frame = -2
Query: 1206 WNEECKNSFNSLKKVLCEAPVLEFPMSDRM-FIIYTDAS---FGAIDRSCD---------CIWIKTFDST*NGILFTRKELLLNNEFIVHFRESLWQ*IHCENRSQSIDFHE-HYKKPISPQFQT*LANLSEYDFELQYRK*DDHGNADGFS 1619
            W E+   +   LK  LC +PVL  P +++  + + TDAS    GA+    D           + K+ +S          ELL   + + HFR  L    H   R+  I       K   + + Q  L +L+ YDF L+Y     +  AD  S
Sbjct:  884 WTEKQDKAIEKLKAALCNSPVL-VPFNNKANYRLTTDASKDGIGAVLEEVDNKNKLVGVVGYFSKSLESAQKNYPAGELELLGIIKALHHFRYMLHG-KHFTLRTDHISLLSLQNKNEPARRVQRWLDDLATYDFTLEYLAGPKNVVADAIS 1033          

HSP 4 Score: 68.9366 bits (167), Expect = 3.202e-10
Identity = 87/382 (22.77%), Postives = 156/382 (40.84%), Query Frame = -3
Query:  386 VIVYGSRHLTAREMGYYSQEKNYYSIMNLLCILE-NLYGNKFIVRTDHKALTFMNTTKNQLAHNFRRSSQTYQNMILSCSIENEMIMEMQMDFHG*KMSFAHNAKQSI----KMQRRKIKSEVYKQFTRKCKYCGVSKNQNEDIIFKEIIP-----LLKGEKETVYDEVKQCKYFILIEQLCILSIIEDNKILVLVPQNYVTTLINYIHIELCHLGILKTLYYMKDFFYWNNLSQSVIKCINECSICAKRKIEQGRTRELLLPRPGEKFSEQMVIDIAY-----METSEWNKKYVIVIIDRFSKLVSLTGTTEQDEITVFNVVLDNWIYRF-GKPDSILTDRGKIFEGS*RREWM*KFGLRQEFNSPYQHQSNGLAERTIDS 1483
            V+ Y S+ L + +  Y + E     I+  L      L+G  F +RTDH +L  +   KN+ A    R  Q + + + +     E +        G K   A    ++I        R I +E +K + +    C       +++    + P         +K+    E  +  Y +  E +      +D  ++ +  QN V  L +   +   H G+  TL  +   +YW  L  S+I+ I  C  C   K  + R   LL P P    +E   +DI+      +  +  N   ++V++DRFSK      T +  + T    +L  +I+ + G P +I +DR         +E   + G++   +S    Q++G +ERTI +
Sbjct:  941 VVGYFSKSLESAQKNYPAGELELLGIIKALHHFRYMLHGKHFTLRTDHISLLSLQN-KNEPA----RRVQRWLDDLATYDFTLEYLA-------GPKNVVADAISRAIYTITPETSRPIDTESWKSYYKSDPLCSAVLIHMKELTQHNVTPEDMSAFRSYQKKLELSETFRKNYSLEDEMI----YYQDRLVVPIKQQNAVMRLYHDHTLFGGHFGVTVTLAKISPIYYWPKLQHSIIQYIRTCVQCQLIKSHRPRLHGLLQPLP---IAEGRWLDISMDFVTGLPPTSNNLNMILVVVDRFSKRAHFIATRKTLDATQLIDLLFRYIFSYHGFPRTITSDRDVRMTADKYQELTKRLGIKSTMSSANHPQTDGQSERTIQT 1303          
BLAST of SMED30024572 vs. UniProt/SwissProt
Match: sp|Q8I7P9|POL5_DROME (Retrovirus-related Pol polyprotein from transposon opus OS=Drosophila melanogaster OX=7227 GN=pol PE=4 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 1.584e-21
Identity = 47/146 (32.19%), Postives = 76/146 (52.05%), Query Frame = -1
Query: 1699 DLGQAYYQVELSEESQIKTAFSTREWQFCFNRLPF*LSTAPATFQRLTH*AL---IFKGVVVYLDNILI*AQTQEEHDRIIFEVFSGIKKDGLKINTEKYQFYKSEFNFIGHTIKVYIQR*KIELVKA------PKCVSRLRSFLG 2109
            DL   ++Q+ + E    KTAFST   ++ F RLPF L  APA FQR+    L   I K   VY+D+I++ ++  + H + +  V + + K  L++N EK  F  ++  F+G+ +     +   + V+A      P  V  L+ FLG
Sbjct:  218 DLTSGFHQIHMKESDIPKTAFSTLNGKYEFLRLPFGLKNAPAIFQRMIDDILREHIGKVCYVYIDDIIVFSEDYDTHWKNLRLVLASLSKANLQVNLEKSHFLDTQVEFLGYIVTADGIKADPKKVRAISEMPPPTSVKELKRFLG 363          

HSP 2 Score: 37.3502 bits (85), Expect = 1.584e-21
Identity = 19/46 (41.30%), Postives = 30/46 (65.22%), Query Frame = -3
Query: 2153 SPKNSPLVIVGQK-----DGSIRICLDFRRLNAVTDKYSFPMPDMH 2275
            SP NSP+ IV +K     +   R+ +DF+RLN VT   ++P+PD++
Sbjct:  157 SPYNSPIWIVPKKPKPNGEKQYRMVVDFKRLNTVTIPDTYPIPDIN 202          

HSP 3 Score: 36.1946 bits (82), Expect = 1.584e-21
Identity = 45/162 (27.78%), Postives = 67/162 (41.36%), Query Frame = -3
Query: 1310 IFGLTNYYRRFIKDYS----PYMLKHRGIISR*FGMKNVKIVLIV*RKFYVKLQYLN----FQCQTECL*F-TLMPVLVLSTEVV------------------IVYGSRHLTAREMGYYSQEKNYYSIM-NLLCILENLYGNKFI-VRTDHKALTFMNTTKN 1708
              G+T+YYR+FI+DY+    P     RG+ +     ++ K+ + +       LQ  N      C +E L F        L+T+                    I Y SR L   E  Y + EK   +I+ +L  +   LYG   I V TDH+ LTF    +N
Sbjct:  361 FLGMTSYYRKFIQDYAKVAKPLTNLTRGLYANIKSSQSSKVPITLDE---TALQSFNDLKSILCSSEILAFPCFTKPFHLTTDASNWAIGAVLSQDDQGRDRPIAYISRSLNKTEENYATIEKEMLAIIWSLDNLRAYLYGAGTIKVYTDHQPLTFALGNRN 519          
BLAST of SMED30024572 vs. UniProt/SwissProt
Match: sp|P20825|POL2_DROME (Retrovirus-related Pol polyprotein from transposon 297 OS=Drosophila melanogaster OX=7227 GN=pol PE=4 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 1.921e-21
Identity = 47/114 (41.23%), Postives = 70/114 (61.40%), Query Frame = -1
Query: 1777 DLGQAYYQVELSEESQIKTAFSTREWQFCFNRLPF*LSTAPATFQRLTH---*ALIFKGVVVYLDNILI*AQTQEEHDRIIFEVFSGIKKDGLKINTEKYQFYKSEFNFIGHTI 2109
            DL + ++Q+E+ EES  KTAFST+   + + R+PF L  APATFQR  +     L+ K  +VYLD+I+I + +  EH   I  VF+ +    LK+  +K +F K E NF+GH +
Sbjct:  301 DLAKGFHQIEMDEESISKTAFSTKSGHYEYLRMPFGLRNAPATFQRCMNNILRPLLNKHCLVYLDDIIIFSTSLTEHLNSIQLVFTKLADANLKLQLDKCEFLKKEANFLGHIV 414          

HSP 2 Score: 36.1946 bits (82), Expect = 1.921e-21
Identity = 20/63 (31.75%), Postives = 35/63 (55.56%), Query Frame = -3
Query: 2156 ISKKLTESKNYQKVSKCRSPKNSPLVIVGQK-DGS----IRICLDFRRLNAVTDKYSFPMPDM 2329
            +  ++ E  N   + +  SP NSP  +V +K D S     R+ +D+R+LN +T    +P+P+M
Sbjct:  222 VENQVQEMLNQGLIRESNSPYNSPTWVVPKKPDASGANKYRVVIDYRKLNEITIPDRYPIPNM 284          

HSP 3 Score: 23.8682 bits (50), Expect = 1.921e-21
Identity = 14/46 (30.43%), Postives = 24/46 (52.17%), Query Frame = -2
Query: 2376 LNFEKKSFFGQIISEFRNIFMASRFDLGYTKIIQHEIKTV-GSPIF 2510
            LN E+      ++++FRN+       L +T  I+H + T   SPI+
Sbjct:  163 LNQEETFKLKGLLNKFRNLEYKEGEKLTFTNTIKHVLNTTHNSPIY 208          
BLAST of SMED30024572 vs. TrEMBL
Match: A0A087T3I4 (Retrovirus-related Pol polyprotein from transposon 412 (Fragment) OS=Stegodyphus mimosarum OX=407821 GN=X975_13332 PE=4 SV=1)

HSP 1 Score: 112.464 bits (280), Expect = 4.143e-56
Identity = 123/485 (25.36%), Postives = 216/485 (44.54%), Query Frame = -3
Query:  398 FGLTNYYRRFIKDYSPYMLK-HRGIISR*---------FGMKNVKIVLIV*RKF-YVKLQYLNFQCQTECL*FTLMPVL---VLSTEVVIVYGSRHLTAREMGYYSQEKNYYSIMNLLCILEN-LYGNKFIVRTDHKALTFMNTTKNQLAHNFRRSSQTYQNMILSCSIENEMIMEMQMDFHG*KMSFAH-----NAKQSIKMQRR-KIKSEVYKQFTRKCKYCG-------VSKNQNEDIIFKEIIPLLK-GEKETVYDEVKQC-----KYFILIEQLCILSII-------EDNKIL---VLVPQNYVTTLINYIHIELC--HLGILKTLYYMKDFFYWNNLSQSVIKCINECSICAKRKIEQGRTR-ELLLPRPGEKFSEQMVIDI--AYMETSEWNKKYVIVIIDRFSKLVSLTGTTEQDEITVFNVVLDNWIYRFGKPDSILTDRGKIFEGS*RREWM*KFGLRQEFNSPYQHQSNGLAER 1705
             GL+ YYRRF+KD+S      H+   S+             KN+K  L       Y KL    F   T+    ++  VL   +   E V+ Y S+ L+  E  Y    K   +I+  +    + LYG KF++RTDH +L ++         NF+         I      + +I   +   HG   + +      N +   +++ + ++ + V +Q T              + K+Q ED   K II L++   ++  + ++        +Y+ L + L I + +       +D K     +++P++ +  ++  +H      H GI+KTL  +++ FYWNN    V K    C  CA RK  + R+R +L     G  F E++  DI      T++ NK Y++V ID F+K        +Q+ +TV  +++ +WI RFG P  + +D+G+ F  +  +E     G+ +   +P   QS+G+ ER
Sbjct:  918 LGLSTYYRRFVKDFSSIARPLHKLTESKQKFVWTKECENAFKNLKEALTSAPILTYPKLDR-PFILDTDASNESVGAVLSQEIEGQERVVAYWSKCLSKPERNYCVTRKELLAIVKAVEHFHHYLYGRKFLLRTDHASLAWL--------LNFKNPEGQIARWIQRLQEYDIIIRHRKGQSHGNADALSRRPCPENCRYCSRVEAKYQLVNPVARQITASTSADPDPWSDKEIRKDQMEDRDIKPIIELMETSNRKPTWQDISSYSPTTKQYWALWDSLHIRNGVLYRKFESDDGKTFRWQLVLPRSRIPDVLKELHSSPAGGHFGIMKTLQRVRERFYWNNAKDDVQKWCRTCDACASRKGPKKRSRGKLQRYNVGAPF-ERIAFDILGPLPRTADGNK-YILVAIDYFTKWPEAYPIPDQEAVTVAEMMIQHWISRFGVPLQLHSDQGRNFTSAVVKELCKLLGIDKTQTTPLHPQSDGMVER 1391          

HSP 2 Score: 88.5817 bits (218), Expect = 4.143e-56
Identity = 53/146 (36.30%), Postives = 83/146 (56.85%), Query Frame = -1
Query: 1699 DLGQAYYQVELSEESQIKTAFSTREWQFCFNRLPF*LSTAPATFQRLTH*---ALIFKGVVVYLDNILI*AQTQEEHDRIIFEVFSGIKKDGLKINTEKYQFYKSEFNFIGHTIKVYIQR*KIELVKA------PKCVSRLRSFLG 2109
            DL   Y+QVE+  + + KTAF+T +  + F  +PF L  APATF+RL       L ++  ++YLD+I+I  ++ EEH   + +V   +K+  LK++T K + ++ E  ++GH I     R   E V A      P+ V +LRSFLG
Sbjct:  774 DLKSGYWQVEIHPDDREKTAFTTGQGLWQFKVMPFGLCNAPATFERLMETVLKGLSYEACLIYLDDIIIVGKSFEEHLENLRKVLQKLKEANLKLSTAKCKLFRQEVTYLGHVISAEGVRTDPEKVSAVKHWRRPENVHQLRSFLG 919          

HSP 3 Score: 54.6842 bits (130), Expect = 4.143e-56
Identity = 23/38 (60.53%), Postives = 30/38 (78.95%), Query Frame = -3
Query: 2162 SPKNSPLVIVGQKDGSIRICLDFRRLNAVTDKYSFPMP 2275
            SP  SP+V+V +KDGS R C+D+RRLN VT K S+P+P
Sbjct:  718 SPWASPIVLVRKKDGSTRFCVDYRRLNEVTKKDSYPLP 755          

HSP 4 Score: 33.113 bits (74), Expect = 4.143e-56
Identity = 15/46 (32.61%), Postives = 26/46 (56.52%), Query Frame = -2
Query: 2373 LNFEKKSFFGQIISEFRNIFMASRFDLGYTKIIQHEIKTVGSPIFR 2510
            LN E+K+   ++I + +++F  S  D+G T + QH I T   P  +
Sbjct:  641 LNDEEKNAAERVIKDLQDVFSRSSSDVGRTSLTQHRIDTGDHPPIK 686          

HSP 5 Score: 23.483 bits (49), Expect = 4.143e-56
Identity = 8/38 (21.05%), Postives = 19/38 (50.00%), Query Frame = -2
Query:  231 ENNWCELLPRIEFCLNAKIQSSTGFSTFDIVYSRKINL 344
            + +W + LP       + +  +TG+S   +++ R + L
Sbjct: 1408 QQDWDKKLPLFLLAYRSAVHETTGYSPSQMLFGRDLRL 1445          

HSP 6 Score: 73.559 bits (179), Expect = 4.750e-9
Identity = 55/179 (30.73%), Postives = 83/179 (46.37%), Query Frame = -2
Query: 1206 LSTFY*RLFTLYAET*R-------NNKQIIWNEECKNSFNSLKKVLCEAPVLEFPMSDRMFIIYTDA---SFGAI-------DRSCDCIWIKTFDST*NGILFTRKELLLNNEFIVHFRESLW-Q*IHCENRSQSIDFHEHYKKPISPQFQT*LANLSEYDFELQYRK*DDHGNADGFS 1688
            LST+Y R    ++   R       + ++ +W +EC+N+F +LK+ L  AP+L +P  DR FI+ TDA   S GA+              W K           TRKELL   + + HF   L+ +         S+ +  ++K P   Q    +  L EYD  +++RK   HGNAD  S
Sbjct:  920 LSTYYRRFVKDFSSIARPLHKLTESKQKFVWTKECENAFKNLKEALTSAPILTYPKLDRPFILDTDASNESVGAVLSQEIEGQERVVAYWSKCLSKPERNYCVTRKELLAIVKAVEHFHHYLYGRKFLLRTDHASLAWLLNFKNP-EGQIARWIQRLQEYDIIIRHRKGQSHGNADALS 1097          
BLAST of SMED30024572 vs. TrEMBL
Match: A0A5S6QHB1 (Uncharacterized protein OS=Trichuris muris OX=70415 PE=4 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 4.487e-55
Identity = 117/502 (23.31%), Postives = 194/502 (38.65%), Query Frame = -3
Query:  377 FGLTNYYRRFIKDYSPYMLKHRGIISR*----------FGMKNVKIVLIV*RKFYVKLQYLNFQCQTECL*FTLMPVLVL----STEVVIVYGSRHLTAREMGYYSQEKNYYSIMNLLCILENLYGNKFIVRTDHKALTFMNTTKNQLAHNFRRSSQTYQNMILSCSIENEMIMEMQMDFHG*KMSFAHNAKQSIKMQRRKIKSEVYKQFTRKCKYCGVSKNQ------------------NEDIIFKEIIPLLKGEKETVYDEVKQC------KYFILI--EQLCILSIIEDNKIL----------VLVPQNYVTTLINYIHIELC--HLGILKTLYYMKDFFYWNNLSQSVIKCINECSICAKRKIEQGRTRELLLPRPGEKFSEQMVIDI-AYMETSEWNKKYVIVIIDRFSKLVSLTGTTEQDEITVFNVVLDNWIYRFGKPDSILTDRGKIFEGS*RREWM*KFGLRQEFNSPYQHQSNGLAER------TIDSKVI 1705
             GL +YYR+FIKD++        +  +              + ++  L+      +     +F   T+     +  VL        E  + Y SR LT  E  Y    +   +++            KF +RTDH +L ++   KN     + R  Q  Q                Q DF        H A        R   ++   +    CK CG S  +                     +  ++I P+LK +   V  +  +C      K  +++   +L I   I   K            V+VP+  +  +++  H +L   HLGI KT+  +++ FYW        K +  C  C  R    G+ R  L P    +  E++ IDI   +  SE   +Y++V ID FSK        +Q+  TV  V+++ +I R+G P++I TD+G  FE +  +    + G+R+   +PY    NG  ER      T+ SKV+
Sbjct:  785 LGLASYYRKFIKDFAAIAKPLHQLTEKRKPFQWTPECTSAFQKLRTALLSEPILRLPDFDASFILDTDASDTAIGAVLSQRDEHGREHPVAYASRTLTRAEQRYCVTRREMLAVITFTDQFRPYLQQKFTLRTDHGSLQWLRDFKNPDGQ-WARWQQKLQ----------------QYDF-----DIEHRAGS------RHANADTLSRIP--CKQCGRSGTEVMGVPVNVVALENLEEMRTSQLDDEDIAPILKAKAAGVVGQEIRCGKRSNSKNLLMLNWHRLAIQKGILVRKWFCDDQSGYRWQVVVPKRMIKPVLDQAHQQLTAGHLGIEKTIERIRERFYWPGYRSDTKKYVASCYECNTRNEPVGKGRAPLQPVVTTRRWEKLAIDILGPLVVSETGNRYILVAIDCFSKFAEAFPIPDQEAKTVTRVLVNEFICRYGVPEAIHTDQGSQFEAAIFQSMCTELGIRKTRTTPYHPSGNGQVERMNRTLGTMLSKVV 1256          

HSP 2 Score: 90.8929 bits (224), Expect = 4.487e-55
Identity = 54/146 (36.99%), Postives = 85/146 (58.22%), Query Frame = -1
Query: 1699 DLGQAYYQVELSEESQIKTAFSTREWQFCFNRLPF*LSTAPATFQRLTH*ALI---FKGVVVYLDNILI*AQTQEEHDRIIFEVFSGIKKDGLKINTEKYQFYKSEFNFIGHTI-KVYIQ-----R*KIELVKAPKCVSRLRSFLG 2109
            DL   Y+QVEL+E ++ KTAF T +  F FN +PF L+ APATFQRL    L    +   +VYLD+I++ ++T EEH   + +V + ++K GLK N  K + +  E  ++GH + +  I+       K+     P C++ ++ FLG
Sbjct:  641 DLLSGYWQVELTEAAKEKTAFITHDGLFQFNVMPFGLTGAPATFQRLMEHVLAGLKWNTCLVYLDDIIVFSRTAEEHVEHLSQVLNRLQKAGLKANASKCKLFCKEVRYLGHIVSEKGIEPDPSLTEKMRTYPVPTCLAEVKRFLG 786          

HSP 3 Score: 45.8246 bits (107), Expect = 4.487e-55
Identity = 19/41 (46.34%), Postives = 31/41 (75.61%), Query Frame = -3
Query: 2162 PKNSP----LVIVGQKDGSIRICLDFRRLNAVTDKYSFPMP 2272
            P NSP    +V V +KDGS+R+C+D+R+LN V+ + ++P+P
Sbjct:  582 PSNSPWAAGIVPVRKKDGSLRLCVDYRKLNEVSRRDAYPIP 622          

HSP 4 Score: 39.2762 bits (90), Expect = 4.487e-55
Identity = 17/46 (36.96%), Postives = 29/46 (63.04%), Query Frame = -2
Query: 2394 EKVALRILNFEKKSFFGQIISEFRNIFMASRFDLGYTKIIQHEIKT 2531
            E   + +   ++K   G ++S+FRN F AS FD+G T +++H+I T
Sbjct:  502 ETTGVPLTASQRKKLHG-MLSKFRNAFAASEFDIGRTSVLKHDIVT 546          

HSP 5 Score: 31.187 bits (69), Expect = 4.487e-55
Identity = 17/62 (27.42%), Postives = 29/62 (46.77%), Query Frame = -2
Query:  171 NNWCELLPRIEFCLNAKIQSSTGFSTFDIVYSRKINLISN-----SGNVQELKDEILKSAKV 341
              W E+LP++     A IQSST  + + +V+  +  L  +      G VQ  ++   +  KV
Sbjct: 1261 RKWDEVLPKVMMAYRASIQSSTRMAPYTMVFGEQCRLPEDIYRPAEGKVQSPEEHATQLKKV 1322          
BLAST of SMED30024572 vs. TrEMBL
Match: A0A5S6Q2I3 (Uncharacterized protein OS=Trichuris muris OX=70415 PE=4 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 3.034e-54
Identity = 116/502 (23.11%), Postives = 193/502 (38.45%), Query Frame = -3
Query:  377 FGLTNYYRRFIKDYSPYMLKHRGIISR*----------FGMKNVKIVLIV*RKFYVKLQYLNFQCQTECL*FTLMPVLVL----STEVVIVYGSRHLTAREMGYYSQEKNYYSIMNLLCILENLYGNKFIVRTDHKALTFMNTTKNQLAHNFRRSSQTYQNMILSCSIENEMIMEMQMDFHG*KMSFAHNAKQSIKMQRRKIKSEVYKQFTRKCKYCGVSKNQ------------------NEDIIFKEIIPLLKGEKETVYDEVKQC------KYFILI--EQLCILSIIEDNKIL----------VLVPQNYVTTLINYIHIELC--HLGILKTLYYMKDFFYWNNLSQSVIKCINECSICAKRKIEQGRTRELLLPRPGEKFSEQMVIDI-AYMETSEWNKKYVIVIIDRFSKLVSLTGTTEQDEITVFNVVLDNWIYRFGKPDSILTDRGKIFEGS*RREWM*KFGLRQEFNSPYQHQSNGLAER------TIDSKVI 1705
             GL +YYR+FIKD++        +  +              + ++  L+      +     +F   T+     +  VL        E  + Y SR LT  E  Y    +   +++            KF +RTDH +L ++   KN     + R  Q  Q                Q DF        H A        R   ++   +    CK CG S  +                     +  ++I P+LK +   V  +  +C      K  +++   +L I   I   K            V+VP+  +  +++  H +L   HLGI KT+  +++ FYW        K +  C  C  R     + R  L P    +  E++ IDI   +  SE   +Y++V ID FSK        +Q+  TV  V+++ +I R+G P++I TD+G  FE +  +    + G+R+   +PY    NG  ER      T+ SKV+
Sbjct:  785 LGLASYYRKFIKDFAAIAKPLHQLTEKRKPFQWTPECTSAFQKLRTALLSEPILRLPDFDASFILDTDASDTAIGAVLSQRDEHGREHPVAYASRTLTRAEQRYCVTRREMLAVITFTDQFRPYLQQKFTLRTDHGSLQWLRDFKNPDGQ-WARWQQKLQ----------------QYDF-----DIEHRAGS------RHANADTLSRIP--CKQCGRSGTEVMGVPVNVVALENLEEMRTSQLDDEDIAPILKAKAAGVVGQEIRCGKRSNSKNLLMLNWHRLAIQKGILVRKWFCDDQSGYRWQVVVPKRMIKPVLDQAHQQLTAGHLGIEKTIERIRERFYWPGYRSDTKKYVASCYECNTRNEPVEKGRAPLQPVVATRRWEKLAIDILGPLVVSETGNRYILVAIDCFSKFAEAFPIPDQEAKTVTRVLVNEFICRYGVPEAIHTDQGSQFEAAIFQSMCTELGIRKTRTTPYHPSGNGQVERMNRTLGTMLSKVV 1256          

HSP 2 Score: 90.5077 bits (223), Expect = 3.034e-54
Identity = 54/146 (36.99%), Postives = 85/146 (58.22%), Query Frame = -1
Query: 1699 DLGQAYYQVELSEESQIKTAFSTREWQFCFNRLPF*LSTAPATFQRLTH*ALI---FKGVVVYLDNILI*AQTQEEHDRIIFEVFSGIKKDGLKINTEKYQFYKSEFNFIGHTI-KVYIQ-----R*KIELVKAPKCVSRLRSFLG 2109
            DL   Y+QVEL+E ++ KTAF T +  F FN +PF L+ APATFQRL    L    +   +VYLD+I++ ++T EEH   + +V + ++K GLK N  K + +  E  ++GH + +  I+       K+     P C++ ++ FLG
Sbjct:  641 DLLSGYWQVELTEAAKEKTAFITHDGLFQFNVMPFGLTGAPATFQRLMEHVLAGLKWNTCLVYLDDIIVFSRTAEEHVEHLSQVLNRLQKAGLKPNASKCKLFCKEVRYLGHIVSEKGIEPDPSLTEKMRTYPVPTCLAEVKRFLG 786          

HSP 3 Score: 45.8246 bits (107), Expect = 3.034e-54
Identity = 19/41 (46.34%), Postives = 31/41 (75.61%), Query Frame = -3
Query: 2162 PKNSP----LVIVGQKDGSIRICLDFRRLNAVTDKYSFPMP 2272
            P NSP    +V V +KDGS+R+C+D+R+LN V+ + ++P+P
Sbjct:  582 PSNSPWAAGIVPVRKKDGSLRLCVDYRKLNEVSRRDAYPIP 622          

HSP 4 Score: 39.2762 bits (90), Expect = 3.034e-54
Identity = 17/46 (36.96%), Postives = 29/46 (63.04%), Query Frame = -2
Query: 2394 EKVALRILNFEKKSFFGQIISEFRNIFMASRFDLGYTKIIQHEIKT 2531
            E   + +   ++K   G ++S+FRN F AS FD+G T +++H+I T
Sbjct:  502 ETTGVPLTASQRKKLHG-MLSKFRNAFAASEFDIGRTSVLKHDIVT 546          

HSP 5 Score: 31.5722 bits (70), Expect = 3.034e-54
Identity = 17/62 (27.42%), Postives = 29/62 (46.77%), Query Frame = -2
Query:  171 NNWCELLPRIEFCLNAKIQSSTGFSTFDIVYSRKINLISN-----SGNVQELKDEILKSAKV 341
              W E+LP++     A IQSST  + + +V+  +  L  +      G VQ  ++   +  KV
Sbjct: 1261 RKWDEVLPKVMMAYRASIQSSTRMAPYTMVFGEQCRLPEDIYRPAEGKVQSPEEHATQLKKV 1322          
BLAST of SMED30024572 vs. TrEMBL
Match: A0A5G3IEJ4 (Uncharacterized protein OS=Xenopus tropicalis OX=8364 PE=4 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 1.093e-53
Identity = 58/146 (39.73%), Postives = 87/146 (59.59%), Query Frame = -1
Query: 1699 DLGQAYYQVELSEESQIKTAFSTREWQFCFNRLPF*LSTAPATFQRL---TH*ALIFKGVVVYLDNILI*AQTQEEHDRIIFEVFSGIKKDGLKINTEKYQFYKSEFNFIGHTIK---VYIQR*KIELVKA---PKCVSRLRSFLG 2109
            DL   YYQ+ +  E + KTAF      F FNR+P  L  APATFQRL   T   +    V+VYLD++++  +T EEH++ + +VF  ++K+GLK++ EK QF +   N++GH +    +     KIE V +   P+ ++ LRSFLG
Sbjct:  416 DLRSGYYQLPMHPEDKEKTAFICPLGFFEFNRMPQGLCGAPATFQRLMERTVGDMHLLEVLVYLDDLIVFGRTLEEHEQRLLKVFDRLEKEGLKLSPEKCQFCQPSVNYVGHVVSAEGIATDPSKIEAVSSWPKPRTITELRSFLG 561          

HSP 2 Score: 84.3445 bits (207), Expect = 1.093e-53
Identity = 87/412 (21.12%), Postives = 169/412 (41.02%), Query Frame = -3
Query:  398 IVYGSRHLTAREMGYYSQEKNYYSIMNLLC--ILENLYGNKFIVRTDHKALTFMNTTK--NQLAHNFRRSSQTYQ-NMILSCSIENEMIMEMQMDFHG*KMSFAHNAKQSIKMQRRKIKSEVYKQFTRKCK------------------YCGVS----------------KNQNEDIIFKEIIPLLKGEKETVYDEVKQCKYFILIEQLCIL------------SIIEDNKILVLVPQNYVTTLINYIHIELCHLGILKTLYYMKDFFYWNNLSQSVIKCINECSICAKRKIEQGRTRELLLPRPGEKFSEQMVIDIAYMETSEWNKKYVIVIIDRFSKLVSLTGTTEQDEITVFNVVLDNWIYRFGKPDSILTDRGKIFEGS*RREWM*KFGLRQEFNSPYQHQSNGLAER 1480
            + + SR L+  E  Y + +  + ++   +   + E LYG +F V+TD+  LT++ TT   +   H +  +   Y+ ++      +N     +    HG      H   + I++    +++ + +  T +C+                  YC V+                ++Q+ED + +  +  L+ ++  +          +L+++   L            S  +  K  +++PQ +  +++  +H E  HLG  KTL  ++D FYW  + Q V      C  C +RK    R   L          + + ID   +E  E     V+V+ D +++      T +Q  ITV  V+++ +   +G P  I +D+G+ FE     E M   G+ +   +PY  Q +   ER
Sbjct:  672 VAFISRSLSPSERNYPAHKLEFLALKWAVVDKLHEYLYGAEFEVQTDNNPLTYILTTAKLDATGHRWLAALAHYKFSLRYRPGRDNRDADGLSRRPHG----DLHPDDEWIEIPAPGVRT-MCQGITGRCQSGNFAEKIGMTVRGIPKLYCNVTSVGTSTMPALNKGDIKRDQSEDPLCQMAMEALRKKQVQILKTDSHPLASLLVKEWDRLRLRDGLVYRRAPSATDSEKWQLMLPQKHRDSVLMALHDEHGHLGYDKTLGLVRDRFYWPCMKQDVEDYCRSCLRCIQRKTLPSRAAPLSHMESHSPL-DLVCIDFLSIEPDEGGTSNVLVVTDHYTRYAQAFPTKDQRAITVAKVLVERFFIHYGLPKRIHSDQGRDFESKLVHELMSMLGVLKSRTTPYHPQGDPQPER 1077          

HSP 3 Score: 49.2914 bits (116), Expect = 1.093e-53
Identity = 24/56 (42.86%), Postives = 37/56 (66.07%), Query Frame = -3
Query: 2168 ISKKLTESKNYQKVSKCRSPKNSPLVIVGQKDGSIRICLDFRRLN--AVTDKYSFP 2329
            + K L E K    + + RSP  SP+V+V +K+GSIR+C+D+R LN   + D+Y+ P
Sbjct:  342 LRKHLEELKAAGIIKESRSPYASPIVVVRKKNGSIRMCVDYRTLNQRTIPDQYTTP 397          

HSP 4 Score: 38.891 bits (89), Expect = 1.093e-53
Identity = 16/45 (35.56%), Postives = 26/45 (57.78%), Query Frame = -2
Query: 1506 RNNKQIIWNEECKNSFNSLKKVLCEAPVLEFPMSDRMFIIYTDAS 1640
            R + +  W EEC  +F+ LK  L  APVL +  + + + ++ DAS
Sbjct:  609 RESIEDFWTEECDKAFDQLKYCLTHAPVLAYADATKPYTLHIDAS 653          

HSP 5 Score: 27.7202 bits (60), Expect = 1.093e-53
Identity = 23/108 (21.30%), Postives = 48/108 (44.44%), Query Frame = -2
Query:   78 KENNWCELLPRIEFCLNAKIQSSTGFSTFDIVYSRKINLI---------------SNSGNVQELKDEILKSAKVNIENAG-NSMKGSDQDKRGTRILDV--GEKVLVR 347
            K+ +W   +  +    N+    +TG+S + +++ R+  L                S+S  V  LK ++ ++ K   E  G  +M+      +  +I D+  G++VL+R
Sbjct: 1093 KKTHWSRHIATVVHAYNSTKNGATGYSPYFLMFGREARLPIDTVFGVTADDTPVKSHSSYVDRLKRDLQRAYKRAQEAVGKKNMQNKTLYDKKVKIHDLQPGDRVLLR 1200          

HSP 6 Score: 24.2534 bits (51), Expect = 1.093e-53
Identity = 8/15 (53.33%), Postives = 10/15 (66.67%), Query Frame = -3
Query: 1661 FGLTNYYRRFIKDYS 1705
             G   YYRRF+K +S
Sbjct:  560 LGFCGYYRRFVKGFS 574          

HSP 7 Score: 21.1718 bits (43), Expect = 1.093e-53
Identity = 12/49 (24.49%), Postives = 24/49 (48.98%), Query Frame = -2
Query: 2367 ILNFEKKSFFGQIISEFRNIFMASRFDLGYTKIIQHEIKTVGSPIFRTR 2513
            ++  E KS   + ++E   +F  +  D+G +   +H+I+      FR R
Sbjct:  282 VIPPEWKSRLRKHLNEHSALFSRNDLDMGCSTSTKHKIRLREDKPFRER 330          
BLAST of SMED30024572 vs. TrEMBL
Match: A0A087SUZ9 (Retrovirus-related Pol polyprotein from transposon 412 (Fragment) OS=Stegodyphus mimosarum OX=407821 GN=X975_16630 PE=4 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 2.326e-53
Identity = 120/484 (24.79%), Postives = 212/484 (43.80%), Query Frame = -3
Query:  398 FGLTNYYRRFIKDYSPYMLK-HRGIISR*---------FGMKNVKIVLIV*RKFYVKLQYLNFQCQTECL*FTLMPVL---VLSTEVVIVYGSRHLTAREMGYYSQEKNYYSIMNLLCILEN-LYGNKFIVRTDHKALTFMNTTKNQLAHNFRRSSQTYQNMILSCSIENEMIMEMQMDFHG*KMSFAH-----NAKQSIKMQRR-KIKSEVYKQFTRKCKYCG-------VSKNQNEDIIFKEIIPLLK-GEKETVYDEVKQC-----KYFILIEQLCILSII-------EDNKIL---VLVPQNYVTTLINYIHIELC--HLGILKTLYYMKDFFYWNNLSQSVIKCINECSICAKRKIEQGRTR-ELLLPRPGEKFSEQMVIDI--AYMETSEWNKKYVIVIIDRFSKLVSLTGTTEQDEITVFNVVLDNWIYRFGKPDSILTDRGKIFEGS*RREWM*KFGLRQEFNSPYQHQSNGLAER 1705
             GL  YYRRF+KD+S      H+   S+             KN+K  L              F   T+    ++  VL   +   E V+ Y S+ L+  E  Y    K   +I+  +    + LYG KF++RTDH +L ++   KN       R  Q  Q   ++       I   +   HG   + +      N +   +++ + ++ + V +Q T              + K+Q +D   K II L++   ++  + ++        +Y+ L + L I + +       +D K     +++P++ +  ++  +H      H GI+KTL  +++ FYWNN    V K    C  C  RK  + R+R +L     G  F E++  DI      T++ NK Y++V ID F+K        +Q+ +TV  +++ +WI RFG P  + +D+G+ F  +  +E     G+ +   +P   QS+G+ ER
Sbjct:  904 LGLCTYYRRFVKDFSSIARPLHKLTESKQKFVWTKECENAFKNLKEALTSAPILTYPQLDRPFILDTDASNESVGAVLSQEIEGQERVVAYWSKCLSKPERNYCVTRKELLAIVKAVEHFHHYLYGRKFLLRTDHASLAWLLNFKNPEGQ-IARWIQRLQEYDIT-------IRHRKGQSHGNADALSRRPCPENCRYCSRVEAKYQLVNPVARQITASTLADPDPWTDKEIRKDQLQDRDIKPIIELMETSNRKPTWQDISSYSPTTKQYWALWDSLHIRNGVLYRKFESDDGKTFRWQLVLPRSRIPDVLKELHSSPAGGHFGIMKTLQRVRERFYWNNAKDDVQKWCRTCDACVSRKGPKKRSRGKLQRYNVGAPF-ERIAFDILGPLPRTADGNK-YILVAIDYFTKWPEAYPIPDQEAVTVAEMMIQHWISRFGVPLQLHSDQGRNFTSAVVKELCKLLGIDKTQTTPLHPQSDGMVER 1377          

HSP 2 Score: 86.2705 bits (212), Expect = 2.326e-53
Identity = 52/146 (35.62%), Postives = 82/146 (56.16%), Query Frame = -1
Query: 1699 DLGQAYYQVELSEESQIKTAFSTREWQFCFNRLPF*LSTAPATFQRLTH---*ALIFKGVVVYLDNILI*AQTQEEHDRIIFEVFSGIKKDGLKINTEKYQFYKSEFNFIGHTIKVYIQR*KIELVKA------PKCVSRLRSFLG 2109
            DL   Y+QVE+  + + KTAF+T +  + F  +PF L  APATF+RL       L ++  ++YLD+I+I  ++ EEH   + +V   +K+  LK++  K + ++ E  ++GH I     R   E V A      P+ V +LRSFLG
Sbjct:  760 DLKSGYWQVEIHPDDREKTAFTTGQGLWQFKVMPFGLCNAPATFERLMETVLKGLSYEACLIYLDDIIIVGKSFEEHLENLRKVLQKLKEANLKLSPAKCKLFRQEVTYLGHVISAEGVRTDPEKVSAVKDWRRPENVHQLRSFLG 905          

HSP 3 Score: 55.0694 bits (131), Expect = 2.326e-53
Identity = 23/38 (60.53%), Postives = 30/38 (78.95%), Query Frame = -3
Query: 2162 SPKNSPLVIVGQKDGSIRICLDFRRLNAVTDKYSFPMP 2275
            SP  SP+V+V +KDGS R C+D+RRLN VT K S+P+P
Sbjct:  704 SPWASPIVLVRKKDGSTRFCVDYRRLNEVTKKDSYPLP 741          

HSP 4 Score: 32.7278 bits (73), Expect = 2.326e-53
Identity = 15/46 (32.61%), Postives = 26/46 (56.52%), Query Frame = -2
Query: 2373 LNFEKKSFFGQIISEFRNIFMASRFDLGYTKIIQHEIKTVGSPIFR 2510
            LN E+K+   ++I + +++F  S  D+G T + QH I T   P  +
Sbjct:  627 LNDEEKNAAERVIKDLQDVFSRSSSDVGRTSLTQHRIDTGDHPPIK 672          

HSP 5 Score: 23.8682 bits (50), Expect = 2.326e-53
Identity = 8/38 (21.05%), Postives = 19/38 (50.00%), Query Frame = -2
Query:  231 ENNWCELLPRIEFCLNAKIQSSTGFSTFDIVYSRKINL 344
            + +W + LP       + +  +TG+S   +++ R + L
Sbjct: 1394 QQDWDKKLPLFLLAYRSAVHETTGYSPSQMLFGRDLRL 1431          

HSP 6 Score: 73.559 bits (179), Expect = 4.256e-9
Identity = 49/155 (31.61%), Postives = 74/155 (47.74%), Query Frame = -2
Query: 1206 NNKQIIWNEECKNSFNSLKKVLCEAPVLEFPMSDRMFIIYTDA---SFGAI-------DRSCDCIWIKTFDST*NGILFTRKELLLNNEFIVHFRESLW-Q*IHCENRSQSIDFHEHYKKPISPQFQT*LANLSEYDFELQYRK*DDHGNADGFS 1637
            + ++ +W +EC+N+F +LK+ L  AP+L +P  DR FI+ TDA   S GA+              W K           TRKELL   + + HF   L+ +         S+ +  ++K P   Q    +  L EYD  +++RK   HGNAD  S
Sbjct:  930 SKQKFVWTKECENAFKNLKEALTSAPILTYPQLDRPFILDTDASNESVGAVLSQEIEGQERVVAYWSKCLSKPERNYCVTRKELLAIVKAVEHFHHYLYGRKFLLRTDHASLAWLLNFKNP-EGQIARWIQRLQEYDITIRHRKGQSHGNADALS 1083          
BLAST of SMED30024572 vs. Ensembl Cavefish
Match: ENSAMXT00000035136.1 (pep primary_assembly:Astyanax_mexicanus-2.0:19:22120237:22124307:1 gene:ENSAMXG00000032783.1 transcript:ENSAMXT00000035136.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 91.6633 bits (226), Expect = 2.536e-49
Identity = 54/146 (36.99%), Postives = 89/146 (60.96%), Query Frame = -1
Query: 1699 DLGQAYYQVELSEESQIKTAFSTREWQFCFNRLPF*LSTAPATFQRLTH*A---LIFKGVVVYLDNILI*AQTQEEHDRIIFEVFSGIKKDGLKINTEKYQFYKSEFNFIGHTIK---VYIQR*KIELVK---APKCVSRLRSFLG 2109
            DL   YYQVE+ E+ + KTAF      + +NRLP  ++ AP+TFQRL       +  K V+V+LD+++I +++ EEH+  + +V + +K+ GLK++ EK +F+++   ++GH +    V     KI  +K   +PK +  LRSFLG
Sbjct:  204 DLKSGYYQVEMEEDDKPKTAFVCPLGFWEWNRLPQGITNAPSTFQRLMERCVGEMNLKEVLVFLDDLIIFSKSLEEHEERLLKVLNCLKEYGLKLSPEKCKFFQTSVRYLGHIVSENGVKTDPDKIAALKNWPSPKNLKELRSFLG 349          

HSP 2 Score: 89.7373 bits (221), Expect = 2.536e-49
Identity = 131/547 (23.95%), Postives = 204/547 (37.29%), Query Frame = -3
Query:  413 FGLTNYYRRFIKDYS----PYMLKHRGIISR*FGMKNVKIVLIV*RKFYVKLQYLN----FQ------CQ----TECL*FTLMPVL---------VLSTEV------------------VIVYGSRHLTAREMGYYSQEKNYYSIMNLLC--ILENLYGNKFIVRTDHKALTFMNTTKNQLAHNFR---------------RSSQTYQNMILSCSIENEMI-----------MEMQMDFHG*KMSFA-------------HNAKQ--------SIKMQRRKIKSEVYKQ-------FTRKCKYCGVSKNQNEDIIFKEIIPLLK-GEKETVYDEVKQCKYFILIEQLCILSII---------EDNKIL--VLVPQNYVTTLINYIHIELCHLGILKTLYYMKDFFYWNNLSQSVIKCINECSICAKRKIEQGRTREL---LLPRPGEKFSEQMVIDIAYMETSEWNKKYVIVIIDRFSKLVSLTGTTEQDEITVFNVVLDNWIYRFGKPDSILTDRGKIFEGS*RREWM*KFGLRQEFNSPYQHQSN 1705
             G + YYRRF+KDYS    P      G   +  G K          K      YLN    FQ      CQ    T     T  PVL         +L T+                   VI + SR LT  E  Y + +  + ++   +     + LYGN F V TD   LT++ T+    A ++R               R  Q      LS     E+I           +   M +H  ++                H A Q        S+ +  R I  E+ ++          K     +++ Q  D     +I  L+ GEK       +    F+L  +   L +I         E+N+ L  +++P      ++  +H E+ H+G+ +TL  ++  FYW  ++  V K I+ C  C +RK    +   L   L  RP     E + ID   +E    N K V+VI D F+K      T  Q   TV   + D ++  +G P+ + +D+G  FE +  +E     G+R+   SPY  + N
Sbjct:  348 LGFSGYYRRFVKDYSKIAKPLNALTSGYPPQRKGAK----------KPETNKNYLNPKEPFQGRWTASCQQAFETIIEKLTTAPVLGFANPKLPYILHTDASTTGLGAALYQDQGGEKRVIAFASRGLTCSEARYPAHKLEFLALKWAVVDKFSDYLYGNTFTVVTDSNPLTYILTSAKLDATSYRWLSALSTFSFDLQYRRGKQNLDADGLSRRPHGELINDSISQKEHERIRQFMQYHQEELVDQKSDHEVVKAICERHLATQQSSIALVESLALHARAIPEELMEEPFHLGHGVPFKFSNAEIAEKQRADQTLAPVINQLETGEKPPPTLRQELPDIFLLFREWNKLEMIDGVLYRRRQEENRNLYQLVLPVELRPIVLQSLHDEMGHMGVERTLDLVRSRFYWPKMAIDVEKKIHTCGRCVRRKALPDKAAPLVNILTTRP----LELVCIDFLSIEPDSKNTKDVLVITDHFTKYAIAVPTPNQKARTVAKCLWDTFVVHYGLPERLHSDQGPDFESTLIKELCALVGVRKCRTSPYHPRGN 880          

HSP 3 Score: 47.3654 bits (111), Expect = 2.536e-49
Identity = 20/58 (34.48%), Postives = 39/58 (67.24%), Query Frame = -3
Query: 2156 ISKKLTESKNYQKVSKCRSPKNSPLVIVGQKDGSIRICLDFRRLNAVTDKYSFPMPDM 2329
            + K L E  +   + +  SP +SP+V+V +K+G +R+C+D+R+LN  T K ++ +P++
Sbjct:  130 VRKHLKELSDAGIIRESESPFSSPIVVVRKKNGDVRLCVDYRKLNLQTIKDAYALPNL 187          

HSP 4 Score: 27.335 bits (59), Expect = 2.536e-49
Identity = 24/108 (22.22%), Postives = 49/108 (45.37%), Query Frame = -2
Query:   78 KENNWCELLPRIEFCLNAKIQSSTGFSTFDIVYSRKINL---------------ISNSGNVQELKDEILKSAKVNIENAGNSMKGSDQ--DKRGTR-ILDVGEKVLVR 347
            ++++W + +  +    N      TGF+ +++++ R+  L                S+S  +  LK  + +S ++  + A      +    DKR T   L+VG++VLVR
Sbjct:  900 EKSHWSDFVKSLVHAYNCTKNEVTGFTPYELMFGRRPRLPVDIAFGLPLEKNQNQSHSQYMTVLKAHLEESYRLATQAAAKIAHKNKVKFDKRVTESTLNVGDRVLVR 1007          

HSP 5 Score: 23.0978 bits (48), Expect = 2.536e-49
Identity = 9/31 (29.03%), Postives = 15/31 (48.39%), Query Frame = -2
Query: 2364 IFMASRFDLGYTKIIQHEIKTVGSPIFRTRV 2456
            +F     D G+T+ ++H IK      F+ R 
Sbjct:   89 VFSLHDLDFGHTQAVKHYIKLHDERPFKHRA 119          
BLAST of SMED30024572 vs. Ensembl Cavefish
Match: ENSAMXT00000041345.1 (pep primary_assembly:Astyanax_mexicanus-2.0:25:32334536:32339002:1 gene:ENSAMXG00000029230.1 transcript:ENSAMXT00000041345.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.559 bits (179), Expect = 2.057e-44
Identity = 50/146 (34.25%), Postives = 77/146 (52.74%), Query Frame = -1
Query: 1699 DLGQAYYQVELSEESQIKTAFSTREWQFCFNRLPF*LSTAPATFQRLTH*ALI---FKGVVVYLDNILI*AQTQEEHDRIIFEVFSGIKKDGLKINTEKYQFYKSEFNFIGHTIK---VYIQR*KIELVKA---PKCVSRLRSFLG 2109
            DL   Y+QV L  +S  KTAF T +  + F  LPF +  A ATFQRL    L+    K   VY+++I++ + T E+H   + EVF  + + GL +N  K    +    F+GH I    +  +  K+E ++A   P+ +  L+ FLG
Sbjct:  718 DLKSGYWQVGLEPDSIPKTAFITCQGLYEFTVLPFGIKNAAATFQRLMDSVLVNLKGKSCFVYINDIVVYSSTIEQHLGHLEEVFRCLHQAGLTLNLRKCNLLQRSLIFLGHVISGEGICTEPGKVEAIQAFPEPRSIKELQRFLG 863          

HSP 2 Score: 64.3142 bits (155), Expect = 2.057e-44
Identity = 79/383 (20.63%), Postives = 149/383 (38.90%), Query Frame = -3
Query:  398 EVVIVYGSRHLTAREMGYYSQEKNYYSIMNLLCILEN----LYGNKFIVRTDHKALTFMNTTKNQLAHNFRRSSQTYQNMILSCSIENEMIMEMQMDFHG*KMSFAHNAKQSIKMQRRKIKSEVYKQFTRKCKYCGVSKNQNEDII----FKEIIPLLKGEK-ETVYDEVKQCKYFILIEQLCILSIIEDNKI----LVLVPQNYVTTLINYIHIELC--HLGILKTLYYMKDFFYWNNLSQSVIKCINECSICAKRKIE----QGRTRELLLPRPGEKFSEQMVIDIAYMETSEWNKKYVIVIIDRFSKLVSLTGTTEQDEITVFNVVLDNWIYRFGKPDSILTDRGKIFEGS*RREWM*KFGLRQEFNSPYQHQSNGLAER 1489
            E V+ Y SR L   E  Y + EK   ++   +  +E     L G  F V TDH AL+++                 + +   +  +    I     DF    + +       +     +I   + +     C+  G S     D       +E+   L+ ++ ET   E ++ +   + +   +   + + ++     V+VP  +    + Y H      HLG +KTL  + +  YW ++ + V      C IC K K       GR +   +  PG      +   +  +  S    ++++VI+D  SK V +    E     +  +++ +   R+G P  +++DRG  F          ++G+ Q+  + Y  Q+N L ER
Sbjct:  947 EHVVAYASRLLQGAERNYSTAEKECLAV---VWAVEKWRVYLEGRHFTVITDHSALSWV-----------------FNHPKPTSRLTRWAIRLQTFDF---SVQYRKGKCNIVPDTLSRIPDRMTEGVMAPCQVTGSSDGLPVDWAEIARAQEVDGTLQPQRDETGNQETRKDRIHFVTKNDILFRAVPNQQLGHTLQVVVPVQHREAFLQYAHDNPLSGHLGQMKTLLRLLNIAYWPSIRRDVWTYCKSCEICQKYKPRISKLSGRLQSTPVVEPGYMLGVDL---MGPLPKSPRQNEHLLVIVDYCSKWVEMFPLREAKTSQIVQILIKDIFTRWGTPAYLVSDRGAQFTSRLLHATCRQWGVVQKLTTAYHPQTN-LTER 1302          

HSP 3 Score: 48.1358 bits (113), Expect = 2.057e-44
Identity = 18/41 (43.90%), Postives = 30/41 (73.17%), Query Frame = -3
Query: 2153 SPKNSPLVIVGQKDGSIRICLDFRRLNAVTDKYSFPMPDMH 2275
            SP  SP+V+V +K+G +R C+D+RR+N+ T   ++PMP + 
Sbjct:  662 SPWASPVVLVPKKEGGVRFCVDYRRMNSKTHLDAYPMPQVQ 702          

HSP 4 Score: 42.3578 bits (98), Expect = 2.057e-44
Identity = 26/73 (35.62%), Postives = 36/73 (49.32%), Query Frame = -2
Query: 1494 WVDKLLSTFY*RLFTLYAET*RNNKQIIWNEECKNSFNSLKKVLCEAPVLEFPMSDRMFIIYTDAS---FGAI 1703
            W  + ++ F  R   L A   + N   IW +EC+ +F  +K+ L  APVL  P     F I TDAS    GA+
Sbjct:  867 WYHRFITHFSERAAILNALK-KKNAPWIWTQECQKAFEDIKQALITAPVLTPPNFSEPFQIQTDASDQGLGAV 938          

HSP 5 Score: 33.113 bits (74), Expect = 2.057e-44
Identity = 31/132 (23.48%), Postives = 53/132 (40.15%), Query Frame = -2
Query:    6 KENNWCELLPRIEFCLNAKIQSSTGFSTFDIVYSRKIN-----LISNSGN-------VQELKDEILKSAKVNIENAGNSMKGSDQDKRGTRILDVGEKVLVRLKPHKRKKNGML------YEGPYEILRFIS 347
            K   W + +P   F +N+  Q STGF+  ++   RK+      L+S   N       V + + ++    + N++ A          +R       G+ V V   P  R   G        ++GP +I+R IS
Sbjct: 1318 KHRLWDQWIPEFRFAINSAWQESTGFTPAEVALGRKLKGPLERLLSQPPNPDHDAYKVVQRQQDLFCQIRDNVDKAQAKQAKFYNRRRKQVNFVGGDLVWVETHPLSRADKGFAAKLAEKWKGPAKIIRKIS 1449          
BLAST of SMED30024572 vs. Ensembl Cavefish
Match: ENSAMXT00000038088.1 (pep primary_assembly:Astyanax_mexicanus-2.0:23:13869500:13874588:-1 gene:ENSAMXG00000037864.1 transcript:ENSAMXT00000038088.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 80.4925 bits (197), Expect = 6.826e-43
Identity = 49/146 (33.56%), Postives = 81/146 (55.48%), Query Frame = -1
Query: 1699 DLGQAYYQVELSEESQIKTAFSTREWQFCFNRLPF*LSTAPATFQRLTH*AL---IFKGVVVYLDNILI*AQTQEEHDRIIFEVFSGIKKDGLKINTEKYQFYKSEFNFIGHTIK---VYIQR*KIELVK---APKCVSRLRSFLG 2109
            DL   Y+QV +  + Q KTAF+T    + F R+PF L  APATFQRL    L   + + + VYLD+I+I +     H + + +VF  + + GLK+ ++K + ++ +  F+GH +    V+    K+  V+    P  +  +R+FLG
Sbjct:  427 DLASGYWQVGVHPDDQPKTAFATPLGLYHFRRMPFGLCNAPATFQRLMQHCLRGQVAEFLFVYLDDIIIHSADFSLHVQHLEQVFERLSRYGLKLRSDKCKLFRRQVKFLGHVVNKQGVHPDPEKVAAVQEWATPTTIREVRAFLG 572          

HSP 2 Score: 66.6254 bits (161), Expect = 6.826e-43
Identity = 99/480 (20.62%), Postives = 174/480 (36.25%), Query Frame = -3
Query:  398 FGLTNYYRRFIKDYSPYMLKHRGIISR*FGMKNVKIVLIV*RKFYVKLQYLNFQCQT--ECL*FTLM--PVL----------------------VLST-----EVVIVYGSRHLTAREMGYYSQEKNYYSI-MNLLCI--------LENLYGNKFIVRTDHKALTFMNTTKNQLAHNFRRSSQTYQNMILSCSIENEMIMEMQMDFHG*KMSFAHNAKQSIKMQRRKIKSEVYKQFTRKCKYCGVSKNQNEDIIFKEIIPLLKGEKETVYDEVKQCKYF----ILIEQLCILSIIEDNKILVLVPQNYVTTLINYIHIELCHLGILKTLYYMKDFFYWNNLSQSVIKCINECSICAKRKIEQGRTRELLLPRPGEKFSEQMVIDIAYMETSEWNKKYVIVIIDRFSKLVSLTGTTEQDEITVFNVVLDNWIYRFGKPDSILTDRGKIFEGS*RREWM*KFGLRQEFNSPYQHQSNGLAER 1705
             GL  YYRRFI  ++               + ++ + + V RK   +      +CQ   ECL   L+  P+L                      VLS      E VI Y SR L   E      + NY S  + LL +         + L G+KF+V TD+  +  + + K           +      +  +   E+  E  M   G     A    + I   +R + + ++ + T +                       +    TV   ++Q   F     L+ +L +     +  + ++ P+ +   +    H    H G+ KTL  +++ FYW  + + V    + C  C  +K  +G  +  L P       E + +D   +  S    + ++V ID F++      T +Q   T    +  + I  FG P    +DRG  FE +  ++    +G+ +   + Y    NG  ER
Sbjct:  571 LGLAGYYRRFIDGFAKLARP----------LNSLLVGVPVNRKSSHRGINWTPECQNAFECLKSCLLQAPILAYADFSAPFIVYTDASSQGLGAVLSQMQDGRERVIAYASRSLHPSE----KNDANYSSFKLELLALKWAVTEKFRDYLMGSKFMVMTDNNPVAHLQSAKLGATEQRFPCVRVPPGANVVTAELQEVTAEQDMAIGGVDWQQAQEQDEEICTVKRYVDAGIFPKVTER-----------------------RALPRTVQQLLRQRSRFQSKDGLLHRLILDPCTNEPHLQIVCPKRWQKEVWERYHEATGHAGVEKTLLRIRNHFYWPQMEEKVRGFHSGCVSCGLQK-GKGDPKAPLHPINVSFPLEVLALDFLSLGRSNDTYQNILVAIDMFTRYAWAIPTRDQTAQTTVKALWSHVIQTFGCPLRFHSDRGPNFESALFQQLCEVYGITRSRTTSYHPAGNGRVER 1012          

HSP 3 Score: 55.8398 bits (133), Expect = 6.826e-43
Identity = 23/43 (53.49%), Postives = 34/43 (79.07%), Query Frame = -3
Query: 2162 VSKCRSPKNSPLVIVGQKDGSIRICLDFRRLNAVTDKYSFPMP 2290
            +S+  SP  +P+V+V +KDGS R C+D+R+LNAVT K +FP+P
Sbjct:  366 ISESSSPWAAPVVMVRKKDGSWRFCVDYRKLNAVTHKDAFPLP 408          

HSP 4 Score: 27.335 bits (59), Expect = 6.826e-43
Identity = 10/38 (26.32%), Postives = 20/38 (52.63%), Query Frame = -2
Query:  234 KENNWCELLPRIEFCLNAKIQSSTGFSTFDIVYSRKIN 347
            K++ W   LP +    N  + S+TGF+   +++ R + 
Sbjct: 1028 KQDRWPAFLPELLQAYNNTVHSATGFTPSYLMFGRVVR 1065          

HSP 5 Score: 26.5646 bits (57), Expect = 6.826e-43
Identity = 12/39 (30.77%), Postives = 21/39 (53.85%), Query Frame = -2
Query: 2394 LNFEKKSFFGQIISEFRNIFMASRFDLGYTKIIQHEIKT 2510
            L   +++   Q++ ++ ++F  S  D G T  IQH I T
Sbjct:  294 LTTSQQAVLSQLLHKWSSVFSQSEEDFGCTDAIQHCIPT 332          
BLAST of SMED30024572 vs. Ensembl Cavefish
Match: ENSAMXT00000052892.1 (pep primary_assembly:Astyanax_mexicanus-2.0:15:1687614:1691096:-1 gene:ENSAMXG00000041369.1 transcript:ENSAMXT00000052892.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 89.3521 bits (220), Expect = 5.870e-38
Identity = 55/146 (37.67%), Postives = 83/146 (56.85%), Query Frame = -1
Query: 1699 DLGQAYYQVELSEESQIKTAFSTREWQFCFNRLPF*LSTAPATFQRLTH*A---LIFKGVVVYLDNILI*AQTQEEHDRIIFEVFSGIKKDGLKINTEKYQFYKSEFNFIGHTIK---VYIQR*KIELV---KAPKCVSRLRSFLG 2109
            DL   YYQ+ +SEE + KTAF      F F R+P  ++ APATFQRL   A   +    V+VYLD+I++  ++ EEH+  + +V   +++ GLKI+ +K QF + E  ++GH +    +     K+  V   K P  +  LRSFLG
Sbjct:  165 DLRSGYYQIAMSEEDKEKTAFICPLGFFQFERMPQGITGAPATFQRLMEKAVGDMHLLQVIVYLDDIIVFGKSLEEHEERLLKVLDRLEEVGLKISIDKCQFCQPEVKYVGHVVSKDGISTDPDKVSAVTQWKQPTDLKSLRSFLG 310          

HSP 2 Score: 46.595 bits (109), Expect = 5.870e-38
Identity = 19/43 (44.19%), Postives = 31/43 (72.09%), Query Frame = -3
Query: 2168 VSKCRSPKNSPLVIVGQKDGSIRICLDFRRLN--AVTDKYSFP 2290
            + + RSP  SP+VI  +K+GS+R+C+D+R LN   + D+Y+ P
Sbjct:  104 IKESRSPYASPIVIARKKNGSVRMCIDYRTLNNRTIPDQYTMP 146          

HSP 3 Score: 35.8094 bits (81), Expect = 5.870e-38
Identity = 14/42 (33.33%), Postives = 23/42 (54.76%), Query Frame = -2
Query: 1494 WNEECKNSFNSLKKVLCEAPVLEFPMSDRMFIIYTDASFGAI 1619
            W++ C  +F+ +   L  APVL F    R +I++ DAS   +
Sbjct:  364 WDKTCTEAFHRIIHCLTHAPVLAFADPSRPYILHVDASMNGL 405          

HSP 4 Score: 32.7278 bits (73), Expect = 5.870e-38
Identity = 23/86 (26.74%), Postives = 40/86 (46.51%), Query Frame = -3
Query: 1238 IVYGSRHLTAREMGYYSQEKNYYSIMNLLC--ILENLYGNKFIVRTDHKALTFMNTTK--NQLAHNFRRSSQTYQ-NMILSCSIEN 1480
            + + SR L+  E  Y   +  + ++   +     + LYG  F VRTD+  LT++ TT   N   H +  +  TY  ++   C  +N
Sbjct:  420 VAFASRKLSTSEQRYPVHQLEFLALKWAVVDKFHDYLYGACFTVRTDNNPLTYILTTAKLNATGHRWLAALATYNFSLQYRCGTQN 505          

HSP 5 Score: 28.8758 bits (63), Expect = 5.870e-38
Identity = 19/80 (23.75%), Postives = 40/80 (50.00%), Query Frame = -2
Query: 2367 IYNIDSSLLEVQHTDEEREKVALRILNFEK-------KSFFGQIISEFRNIFMASRFDLGYTKIIQHEIKTVGSPIFRTR 2585
            +Y+ D+ ++  Q +D   +K+   + +F +       K+     ++E  N+F  + +D+G  K ++H I+   S  FR R
Sbjct:    1 MYSTDTVVV-AQKSDGRPDKLDPALFDFGQSPIPEIWKNRLRNKLAERPNVFSINEWDVGLAKGVEHHIRLSDSRPFRER 79          

HSP 6 Score: 25.0238 bits (53), Expect = 5.870e-38
Identity = 9/15 (60.00%), Postives = 10/15 (66.67%), Query Frame = -3
Query: 1661 FGLTNYYRRFIKDYS 1705
             G   YYRRFI +YS
Sbjct:  309 LGFCGYYRRFIANYS 323          

HSP 7 Score: 75.0998 bits (183), Expect = 1.090e-13
Identity = 45/184 (24.46%), Postives = 83/184 (45.11%), Query Frame = -3
Query:  398 VLVPQNYVTTLINYIHIELCHLGILKTLYYMKDFFYWNNLSQSVIKCINECSICAKRKIEQGRTRELLLPRPGEKFSEQMVIDIAYM-----ETSEWNKKYVIVIIDRFSKLVSLTGTTEQDEITVFNVVLDNWIYRFGKPDSILTDRGKIFEGS*RREWM*KFGLRQEFNSPYQHQSNGLAER 934
            +++P+ +   ++  +H E  HLG+ +T   +KD FYW  +S  +   I  C  C   K    R   L       + +    +D+  M     E        V+V+ D +++      T +Q  +TV  V+ + +   +G P  I +D+G+ FE    +E +   G+R+   +PY+ Q +   ER
Sbjct:  649 LVLPKTFRNQVLKSLHDECGHLGVDRTTQLVKDRFYWPRMSVEIEHYIKTCGRCVAAKTLPQRASPL------NEITSTGPLDLVCMDFLSIEPDSKGIANVLVVTDHYTRYAQAFCTKDQKAVTVAKVLCEKYFVHYGLPARIHSDQGRDFESRLIKELLSMLGIRKSRTTPYRPQGDPQPER 826          

HSP 8 Score: 22.7126 bits (47), Expect = 1.090e-13
Identity = 7/39 (17.95%), Postives = 20/39 (51.28%), Query Frame = -2
Query:  231 KENNWCELLPRIEFCLNAKIQSSTGFSTFDIVYSRKINL 347
            ++  W + + ++    N     +TG+S + +++ R+  L
Sbjct:  842 RKQQWSQQISQLVHAYNCTKNDATGYSPYFLMFGREARL 880          
BLAST of SMED30024572 vs. Ensembl Cavefish
Match: ENSAMXT00000053730.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02002271.1:240468:243660:-1 gene:ENSAMXG00000043631.1 transcript:ENSAMXT00000053730.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 88.5817 bits (218), Expect = 8.217e-38
Identity = 53/146 (36.30%), Postives = 83/146 (56.85%), Query Frame = -1
Query: 1699 DLGQAYYQVELSEESQIKTAFSTREWQFCFNRLPF*LSTAPATFQRLTH*A---LIFKGVVVYLDNILI*AQTQEEHDRIIFEVFSGIKKDGLKINTEKYQFYKSEFNFIGHTIK---VYIQR*KIELVKA---PKCVSRLRSFLG 2109
            DL   YYQVE+ EE + KTAF T    + FNRLP  ++ AP+TFQR+       +  K V+V+LD++++ + T EEH+  +  V + +K  GLK++ EK  F++    ++GH +    V     KI  +     P+ +  L+SFLG
Sbjct:  347 DLKSGYYQVEVEEEDKHKTAFVTPMGFWEFNRLPQGVTNAPSTFQRVMEKCMGTMNLKEVLVFLDDLIVFSDTLEEHESRLMRVLTKLKDFGLKLSPEKCHFFRRSVRYLGHIVSEDGVETDPEKISALTTWPKPRNIRELKSFLG 492          

HSP 2 Score: 44.669 bits (104), Expect = 8.217e-38
Identity = 19/55 (34.55%), Postives = 37/55 (67.27%), Query Frame = -3
Query: 2156 KLTESKNYQKVSKCRSPKNSPLVIVGQKDGSIRICLDFRRLNAVTDKYSFPMPDM 2320
             L E ++   + +  S   SP+V+V +K G+IR+C+D+R+LN+ T K ++ +P++
Sbjct:  276 HLKELQDANIIRESESSFASPVVVVKKKSGAIRLCVDYRKLNSQTIKDAYALPNI 330          

HSP 3 Score: 39.6614 bits (91), Expect = 8.217e-38
Identity = 16/42 (38.10%), Postives = 26/42 (61.90%), Query Frame = -2
Query: 1494 WNEECKNSFNSLKKVLCEAPVLEFPMSDRMFIIYTDASFGAI 1619
            WNE+C  +FN+L + L  AP+L F      ++++TDAS   +
Sbjct:  545 WNEKCDEAFNTLIEKLTTAPILGFANPHLPYVLHTDASVQGL 586          

HSP 4 Score: 31.9574 bits (71), Expect = 8.217e-38
Identity = 19/67 (28.36%), Postives = 33/67 (49.25%), Query Frame = -3
Query: 1289 VIVYGSRHLTAREMGYYSQEKNYYSIMNLLC--ILENLYGNKFIVRTDHKALTFMNTTKNQLAHNFR 1483
            VI Y SR L+  E  Y + +  + ++   +     + LYG +F + TD+  LT++ T+    A   R
Sbjct:  600 VIAYASRGLSYSEKRYPTHKLEFLAVKWAVTDKFFDYLYGAEFTIMTDNNPLTYVLTSAKLDAAGHR 666          

HSP 5 Score: 31.5722 bits (70), Expect = 8.217e-38
Identity = 11/16 (68.75%), Postives = 12/16 (75.00%), Query Frame = -3
Query: 1661 IFGLTNYYRRFIKDYS 1708
              G T YYRRF+KDYS
Sbjct:  490 FLGFTGYYRRFVKDYS 505          

HSP 6 Score: 21.9422 bits (45), Expect = 8.217e-38
Identity = 8/31 (25.81%), Postives = 13/31 (41.94%), Query Frame = -2
Query: 2364 IFMASRFDLGYTKIIQHEIKTVGSPIFRTRV 2456
            +F     D G+T  + H I+      F+ R 
Sbjct:  232 VFANGDLDYGHTTAVTHRIRLSDPTPFKQRA 262          
BLAST of SMED30024572 vs. Ensembl Medaka
Match: ENSORLT00000032005.1 (pep primary_assembly:ASM223467v1:7:31190450:31194463:1 gene:ENSORLG00000029990.1 transcript:ENSORLT00000032005.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 82.8037 bits (203), Expect = 2.341e-48
Identity = 56/149 (37.58%), Postives = 83/149 (55.70%), Query Frame = -1
Query: 1699 DLGQAYYQVELSEESQIKTAFSTREWQFCFNRLPF*LSTAPATFQRLTH*ALIF-----KGVVVYLDNILI*AQTQEEH-DRIIFEVFSGIKKDGLKINTEKYQFYKSEFNFIGHTIK---VYIQR*KIELV---KAPKCVSRLRSFLG 2109
            DL   Y QV ++E  + KTAF T    F +NR+PF L  AP TFQRL     IF     + V++YLD+I++ + T +EH +R+   V   ++++ L++   K  F++ E  ++GH I    V     KIE V   + P  VS LR+FLG
Sbjct:  403 DLASGYNQVPVTEGDRAKTAFCTPFGLFEWNRMPFGLCNAPGTFQRLMQ--RIFGDQQCQSVLLYLDDIVVFSSTIDEHLERL---VLGRLQQEKLRVKLPKCAFFQQEVRYLGHVISDQGVSTDPHKIEAVAGWQPPSTVSELRTFLG 546          

HSP 2 Score: 78.9518 bits (193), Expect = 2.341e-48
Identity = 109/518 (21.04%), Postives = 192/518 (37.07%), Query Frame = -3
Query:  398 FGLTNYYRRFIKDYSPYMLKHRGIISR*FGMKNVKIVLIV*RKFYVKLQYLNFQCQTECL*FTLMPVL----------------------VLSTEV-----VIVYGSRHLTA--REMGYYSQEKNYYSIMNLLC---ILENLYGNKFIVRTDHKALTFMNTTK------------------------------NQLAHNFRRSSQTYQNMILSCSIENEMIMEMQMDFHG*KMSFAHNAKQSIKMQRRKIKSEVYKQFTRKCKYCGVSKNQNEDIIFKEIIPLLKGEKETVYDE-----------VKQCKYFILIEQLCILSIIEDNK----ILVLVPQNYVTTLINYIHIELCHLGILKTLYYMKDFFYWNNLSQSVIKCINECSICAKRKIEQGRTR-----ELLLPRPGEKFSEQMVIDIAYMETSEWNKKYVIVIIDRFSKLVSLTGTTEQDEITVFNVVLDNWIYRFGKPDSILTDRGKIFEGS*RREWM*KFGLRQEFNSPYQHQSNGLAER 1705
             G  +YYRRF++ ++        ++    G K+ +      +  +      NF    + L  T  PVL                      VLS E       I Y SR L A  R M  YS  K  +  +         E L G+  +V TD+  L++++T K                              + L+ +   SS    NM    S+  ++  ++Q+     +   AH   + +          V+ Q T       V   Q  D +   ++P  + ++   Y E           ++Q K    ++ L    ++  +       +L+P+  +  ++  +H    H GI +TL  ++   YW  +S+ V      C  C   K +  R+       L+  RP    +E + +D   +E S    + V+V+ D FSK      T +Q   TV  V++  W  +FG P  + +D+G+ FE    ++    +G+ +   +PY    NG  ER
Sbjct:  545 LGFASYYRRFVEGFARLAAPLHRLVGELDGTKSRRRKASSLQGHWTTECQQNFDALKQKL--TSAPVLAYADFTLPFILEVDASHNGLGAVLSQEQGGSVRPIAYASRGLKATERNMQNYSSMKLEFLALKWAMTEKFREYLLGHHCVVFTDNNPLSYLSTAKLGAMEQRWVAQLAAFDYEIKYRSGRVNRNADALSRHPNHSSAEVGNMAPGSSLPRDL-QQVQV-----QPVLAHCEMEQLM--------PVFPQRT----TAEVQDLQVSDPVLASVLPFWRDKRYPNYSEREGLSKVALTLLRQWKNLAEVDGLVYRRVLMPDSGQEVFQLLLPEILIPEVLEQVHQHHGHQGIERTLALLRARCYWPGMSKDVAHWCQACERCQLAK-DNSRSHSAPLGHLIASRP----NELVAMDFTILEPSRTGVENVLVLTDVFSKYTVAIPTRDQRAATVAKVLVAEWFSKFGVPARLHSDQGRSFESQLIQQLRGLYGIEKSRTTPYHPAGNGQCER 1037          

HSP 3 Score: 50.447 bits (119), Expect = 2.341e-48
Identity = 19/45 (42.22%), Postives = 34/45 (75.56%), Query Frame = -3
Query: 2156 VSKCRSPKNSPLVIVGQKDGSIRICLDFRRLNAVTDKYSFPMPDM 2290
            + +  SP  SP+V+  +KDGS+R+C+D+R+LN+ T + +FP+P +
Sbjct:  342 IRESNSPYASPIVLARKKDGSLRMCVDYRQLNSKTRRDAFPLPPI 386          

HSP 4 Score: 31.5722 bits (70), Expect = 2.341e-48
Identity = 16/58 (27.59%), Postives = 28/58 (48.28%), Query Frame = -2
Query: 2367 EEREKVALRILNFEKKSFFGQIISEFRNIFMASRFDLGYTKIIQHEIKTVGSPIFRTR 2540
            E+ + + L  L  E +     ++ ++ N+F A   DLG T ++ HEI  +     R R
Sbjct:  260 EQIDALPLETLPAEDRGKARALLQKYANVFAAHEGDLGCTTLMTHEIPLLDDAPVRQR 317          

HSP 5 Score: 31.187 bits (69), Expect = 2.341e-48
Identity = 24/107 (22.43%), Postives = 47/107 (43.93%), Query Frame = -2
Query:   78 KENNWCELLPRIEFCLNAKIQSSTGFSTFDIVYSRKINLISN----------SGNVQELKDEILKSAKVNIENAGNSM------KGSDQDKRGTRI-LDVGEKVLVR 347
            ++ +W   LP++ FC N     +TG S F +++ ++  L  +          +G + E  +E     +V  + A + +      +  + DK      LD G+ VL+R
Sbjct: 1053 RKRDWHSCLPQVTFCYNTTPHQTTGESPFFLMFGQQPRLPIDFMLGQVKEPVNGTIHEWVEEHQARLRVAFDVAKDRLAEAAARRKRNHDKHVQEAPLDEGQLVLLR 1159          
BLAST of SMED30024572 vs. Ensembl Medaka
Match: ENSORLT00000041674.1 (pep primary_assembly:ASM223467v1:5:30088905:30092924:1 gene:ENSORLG00000022054.1 transcript:ENSORLT00000041674.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 82.4185 bits (202), Expect = 2.936e-48
Identity = 54/148 (36.49%), Postives = 80/148 (54.05%), Query Frame = -1
Query: 1699 DLGQAYYQVELSEESQIKTAFSTREWQFCFNRLPF*LSTAPATFQRLTH*ALIF-----KGVVVYLDNILI*AQTQEEHDRIIFEVFSGIKKDGLKINTEKYQFYKSEFNFIGHTIK---VYIQR*KIELV---KAPKCVSRLRSFLG 2109
            DL   Y QV ++E  + KTAF      F +NR+PF L  AP TFQRL     IF     + V++YLD+I++ + T +EH   +  V   ++++ L++   K  F++ E  ++GH I    V     KIE V   + P  VS LR+FLG
Sbjct:  403 DLASGYNQVPVTEGDRAKTAFCIPFGLFEWNRMPFGLCNAPGTFQRLMQ--RIFGDQQCQSVLLYLDDIVVFSSTIDEHLERLELVLGRLQQEKLRVKLPKCAFFQQEVRYLGHVISDQGVSTDPHKIEAVAGWQPPSTVSELRTFLG 548          

HSP 2 Score: 78.9518 bits (193), Expect = 2.936e-48
Identity = 109/518 (21.04%), Postives = 192/518 (37.07%), Query Frame = -3
Query:  398 FGLTNYYRRFIKDYSPYMLKHRGIISR*FGMKNVKIVLIV*RKFYVKLQYLNFQCQTECL*FTLMPVL----------------------VLSTEV-----VIVYGSRHLTA--REMGYYSQEKNYYSIMNLLC---ILENLYGNKFIVRTDHKALTFMNTTK------------------------------NQLAHNFRRSSQTYQNMILSCSIENEMIMEMQMDFHG*KMSFAHNAKQSIKMQRRKIKSEVYKQFTRKCKYCGVSKNQNEDIIFKEIIPLLKGEKETVYDE-----------VKQCKYFILIEQLCILSIIEDNK----ILVLVPQNYVTTLINYIHIELCHLGILKTLYYMKDFFYWNNLSQSVIKCINECSICAKRKIEQGRTR-----ELLLPRPGEKFSEQMVIDIAYMETSEWNKKYVIVIIDRFSKLVSLTGTTEQDEITVFNVVLDNWIYRFGKPDSILTDRGKIFEGS*RREWM*KFGLRQEFNSPYQHQSNGLAER 1705
             G  +YYRRF++ ++        ++    G K+ +      +  +      NF    + L  T  PVL                      VLS E       I Y SR L A  R M  YS  K  +  +         E L G+  +V TD+  L++++T K                              + L+ +   SS    NM    S+  ++  ++Q+     +   AH   + +          V+ Q T       V   Q  D +   ++P  + ++   Y E           ++Q K    ++ L    ++  +       +L+P+  +  ++  +H    H GI +TL  ++   YW  +S+ V      C  C   K +  R+       L+  RP    +E + +D   +E S    + V+V+ D FSK      T +Q   TV  V++  W  +FG P  + +D+G+ FE    ++    +G+ +   +PY    NG  ER
Sbjct:  547 LGFASYYRRFVEGFARLAAPLHRLVGELDGTKSRRRKASSLQGHWTTECQQNFDALKQKL--TSAPVLAYADFTLPFILEVDASHNGLGAVLSQEQGGSVRPIAYASRGLKATERNMQNYSSMKLEFLALKWAMTEKFREYLLGHHCVVFTDNNPLSYLSTAKLGAMEQRWVAQLAAFDYEIKYRSGRVNRNADALSRHPNHSSAEVGNMAPGSSLPRDL-QQVQV-----QPVLAHCEMEQLM--------PVFPQRT----TAEVQDLQVSDPVLASVLPFWRDQRYPNYSEREGLSKVALTLLRQWKNLAEVDGLVYRRVLMPDSGQEVFQLLLPEILIPEVLEQVHQHHGHQGIERTLALLRARCYWPGMSKDVAHWCQACERCQLAK-DNSRSHSAPLGHLIASRP----NELVAMDFTILEPSRTGVENVLVLTDVFSKYTVAIPTRDQRAATVAKVLVAEWFSKFGVPARLHSDQGRSFESQLIQQLCGLYGIEKSRTTPYHPAGNGQCER 1039          

HSP 3 Score: 50.447 bits (119), Expect = 2.936e-48
Identity = 19/43 (44.19%), Postives = 33/43 (76.74%), Query Frame = -3
Query: 2162 VSKCRSPKNSPLVIVGQKDGSIRICLDFRRLNAVTDKYSFPMP 2290
            + +  SP  SP+V+  +KDGS+R+C+D+R+LN+ T + +FP+P
Sbjct:  342 IRESNSPYASPIVLARKKDGSLRMCVDYRQLNSKTRRDAFPLP 384          

HSP 4 Score: 31.9574 bits (71), Expect = 2.936e-48
Identity = 16/58 (27.59%), Postives = 28/58 (48.28%), Query Frame = -2
Query: 2367 EEREKVALRILNFEKKSFFGQIISEFRNIFMASRFDLGYTKIIQHEIKTVGSPIFRTR 2540
            E+ + + L  L  E +     ++ ++ N+F A   DLG T ++ HEI  +     R R
Sbjct:  260 EQIDALPLETLPAEDRGKAQALLQKYANVFAAHEGDLGCTTLMTHEIPLLDDAPVRQR 317          

HSP 5 Score: 31.187 bits (69), Expect = 2.936e-48
Identity = 24/107 (22.43%), Postives = 47/107 (43.93%), Query Frame = -2
Query:   78 KENNWCELLPRIEFCLNAKIQSSTGFSTFDIVYSRKINLISN----------SGNVQELKDEILKSAKVNIENAGNSM------KGSDQDKRGTRI-LDVGEKVLVR 347
            ++ +W   LP++ FC N     +TG S F +++ ++  L  +          +G + E  +E     +V  + A + +      +  + DK      LD G+ VL+R
Sbjct: 1055 RKRDWHSCLPQVTFCYNTTPHQTTGESPFFLMFGQQPRLPIDFMLGQVKEPVNGTIHEWVEEHQARLRVAFDVAKDRLAEAAARRKRNHDKHVQEAPLDEGQLVLLR 1161          
BLAST of SMED30024572 vs. Ensembl Medaka
Match: ENSORLT00000027908.1 (uncharacterized protein K02A2.6-like [Source:NCBI gene;Acc:111946802])

HSP 1 Score: 87.4261 bits (215), Expect = 3.018e-46
Identity = 88/389 (22.62%), Postives = 159/389 (40.87%), Query Frame = -3
Query:  398 TEVVIVYGSRHLTAREMGYYSQEKNYYSIMNLLCILE------NLYGNKFIVRTDHKALTFMNTTKNQLAHNFRRS-------SQTYQNMILSCSIENEMIMEMQMDFHG*KMSFAHNAKQSIKMQRRKIKSEVYKQFTRKCKYCG------VSKNQNEDIIFKEIIPLLKGEKETVYDEVKQCKYFILIEQLCILSIIEDNKILVLVPQNYVTTLINYIHIELCHLGILKTLYYMKDFFYWNNLSQSVIKCINECSICAK----RKIEQGRTRELLLPRPGEKFSEQMVIDI-AYMETSEWNKKYVIVIIDRFSKLVSLTGTTEQDEITVFNVVLDNWIYRFGKPDSILTDRGKIFEGS*RREWM*KFGLRQEFNSPYQHQSNGLAER 1492
            TE  + + SR L++ E  Y + EK       L C+         L+G KF +RTDH+ALT + TTK       R +       S TY  +  +  +        ++           +  + + +      S   K+F      C       V   Q      K + P+L+              YF +  +L +   +      ++VP +  +TL+   H    H G+++T   ++D +++  +   V+  + ECS+C +     K+ Q   + + LP   E   E++ +DI    E++ W+ K+ I + D +SK   +      +  TV  + L     R+G P+ ++TD G  F  +    ++   G++   +S Y   SNG  ER
Sbjct:  756 TERTVAFASRTLSSTERKYSTVEKEA-----LACVWAVEKWRTYLWGRKFTLRTDHQALTTLLTTKGADRAGMRIARWSACLLSFTYDVVYRAGPLNQTADCLSRLPLPAASFPPEDSEPELVALLATTPVSVTAKEFEDASSSCPELSSLRVQVQQRWPRSAKSVSPVLQ-------------PYFKIRHELSVQDSLVFRGSRLVVPISLRSTLVALAHEG--HQGVVRTKQRLRDLYWFPGMDALVLSQVTECSLCQQTDKSAKVFQAPLQPVPLP---EGPWEKLGLDIVGPFESATWDCKFAITLTDYYSKWPEVAFAPSVNSETVIQI-LSGLFSRYGNPECLVTDNGPQFTSASFSSFLRDKGIKHTRSSVYHPSSNGAVER 1120          

HSP 2 Score: 82.8037 bits (203), Expect = 3.018e-46
Identity = 54/148 (36.49%), Postives = 78/148 (52.70%), Query Frame = -1
Query: 1699 DLGQAYYQVELSEESQIKTAFSTREWQFCFNRLPF*LSTAPATFQRLTH*ALIFKGVV---VYLDNILI*AQTQEEHDRIIFEVFSGIKKDGLKINTEKYQFYKSEFNFIGHTIKV--------YIQR*KIELVKAPKCVSRLRSFLG 2109
            DL  AY+QV L  +S+  TAF T E  F F R+P+ L++AP+ FQ+L   A +  GV     YLD+I+   +T  EHD  +  V   +K  GL++N +K  F ++   F+GH +          ++Q   I    AP     LRSFLG
Sbjct:  529 DLESAYHQVLLHPDSRDLTAFITHEGLFRFCRVPYGLASAPSAFQKLM--ATVLHGVPNVQFYLDDIICYGRTAHEHDAALETVRQKLKTAGLQLNDKKCHFRQTSLKFLGHLVTAEGIKPDTEHLQ--AITQAPAPSDAVSLRSFLG 672          

HSP 3 Score: 41.2022 bits (95), Expect = 3.018e-46
Identity = 18/40 (45.00%), Postives = 25/40 (62.50%), Query Frame = -3
Query: 2156 SPKNSPLVIVGQKDGSIRICLDFRRLNAVTDKYSFPMPDM 2275
            SP  SP+V+  +K+G IR+C+D R  N      SFP+P M
Sbjct:  473 SPWVSPIVVTQRKNGKIRMCVDLREPNKAIVVDSFPLPHM 512          

HSP 4 Score: 36.965 bits (84), Expect = 3.018e-46
Identity = 19/52 (36.54%), Postives = 28/52 (53.85%), Query Frame = -2
Query: 1494 RNNKQIIWNEECKNSFNSLKKVLCEAPVLEFPMSDRMFIIYTDAS---FGAI 1640
            R   Q +W EE +  F ++K++L E+P L     +   II TDAS    GA+
Sbjct:  696 RQGTQFVWTEEAQRCFLTVKRLLLESPALALFNPELPTIISTDASDYGVGAV 747          
BLAST of SMED30024572 vs. Ensembl Medaka
Match: ENSORLT00000045836.1 (pep primary_assembly:ASM223467v1:15:13736160:13740855:-1 gene:ENSORLG00000022583.1 transcript:ENSORLT00000045836.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 85.8853 bits (211), Expect = 8.159e-46
Identity = 88/389 (22.62%), Postives = 159/389 (40.87%), Query Frame = -3
Query:  398 TEVVIVYGSRHLTAREMGYYSQEKNYYSIMNLLCILE------NLYGNKFIVRTDHKALTFMNTTKNQLAHNFRRS-------SQTYQNMILSCSIENEMIMEMQMDFHG*KMSFAHNAKQSIKMQRRKIKSEVYKQFTRKCKYCG------VSKNQNEDIIFKEIIPLLKGEKETVYDEVKQCKYFILIEQLCILSIIEDNKILVLVPQNYVTTLINYIHIELCHLGILKTLYYMKDFFYWNNLSQSVIKCINECSICAK----RKIEQGRTRELLLPRPGEKFSEQMVIDI-AYMETSEWNKKYVIVIIDRFSKLVSLTGTTEQDEITVFNVVLDNWIYRFGKPDSILTDRGKIFEGS*RREWM*KFGLRQEFNSPYQHQSNGLAER 1492
            TE  + + SR L++ E  Y + EK       L C+         L+G KF +RTDH+ALT + TTK       R +       S TY  +  +  +        ++           +  + + +      S   K+F      C       V   Q      K + P+L+              YF +  +L +   +      ++VP +  +TL+   H    H G+++T   ++D +++  +   V+  + ECS+C +     K+ Q   + + LP   E   E++ +DI    E++ W+ K+ I + D +SK   +      +  TV  + L     R+G P+ ++TD G  F  +    ++   G++   +S Y   SNG  ER
Sbjct:  756 TERTVAFASRTLSSTERKYSTVEKEA-----LACVWAVEKWRTYLWGRKFTLRTDHQALTTLLTTKGADRAGMRIARWSARLLSFTYDVVYRAGPLNQTADCLSRLPLPAASFPPEDSEPELVALLATTPVSVTAKEFEDASSSCPELSSLRVQVQQWWPRSAKSVSPVLQ-------------PYFKIRHELSVQDSLVFRGSRLVVPISLRSTLVALAHEG--HQGVVRTKQRLRDLYWFPGMDALVLSQVTECSLCQQTDKSAKVFQAPLQPVPLP---EGPWEKLGLDIVGPFESATWDCKFAITLTDYYSKWPEVAFAPSVNSETVIQI-LSGLFSRYGNPECLVTDNGPQFTSASFSSFLRDKGIKHTRSSVYHPSSNGAVER 1120          

HSP 2 Score: 82.8037 bits (203), Expect = 8.159e-46
Identity = 54/148 (36.49%), Postives = 78/148 (52.70%), Query Frame = -1
Query: 1699 DLGQAYYQVELSEESQIKTAFSTREWQFCFNRLPF*LSTAPATFQRLTH*ALIFKGVV---VYLDNILI*AQTQEEHDRIIFEVFSGIKKDGLKINTEKYQFYKSEFNFIGHTIKV--------YIQR*KIELVKAPKCVSRLRSFLG 2109
            DL  AY+QV L  +S+  TAF T E  F F R+P+ L++AP+ FQ+L   A +  GV     YLD+I+   +T  EHD  +  V   +K  GL++N +K  F ++   F+GH +          ++Q   I    AP     LRSFLG
Sbjct:  529 DLESAYHQVLLHPDSRDLTAFITHEGLFRFCRVPYGLASAPSAFQKLM--ATVLHGVPNVQFYLDDIICYGRTAHEHDAALETVRQKLKTAGLQLNDKKCHFRQTSLKFLGHLVTAEGIKPDTEHLQ--AITQAPAPSDAVSLRSFLG 672          

HSP 3 Score: 41.2022 bits (95), Expect = 8.159e-46
Identity = 18/40 (45.00%), Postives = 25/40 (62.50%), Query Frame = -3
Query: 2156 SPKNSPLVIVGQKDGSIRICLDFRRLNAVTDKYSFPMPDM 2275
            SP  SP+V+  +K+G IR+C+D R  N      SFP+P M
Sbjct:  473 SPWVSPIVVTQRKNGKIRMCVDLREPNKAIVVDSFPLPHM 512          

HSP 4 Score: 36.965 bits (84), Expect = 8.159e-46
Identity = 19/52 (36.54%), Postives = 28/52 (53.85%), Query Frame = -2
Query: 1494 RNNKQIIWNEECKNSFNSLKKVLCEAPVLEFPMSDRMFIIYTDAS---FGAI 1640
            R   Q +W EE +  F ++K++L E+P L     +   II TDAS    GA+
Sbjct:  696 RQGTQFVWTEEAQRCFLTVKRLLLESPALALFNPELPTIISTDASDYGVGAV 747          
BLAST of SMED30024572 vs. Ensembl Medaka
Match: ENSORLT00000044147.1 (uncharacterized protein K02A2.6-like [Source:NCBI gene;Acc:111947635])

HSP 1 Score: 95.9005 bits (237), Expect = 3.099e-42
Identity = 56/146 (38.36%), Postives = 82/146 (56.16%), Query Frame = -1
Query: 1699 DLGQAYYQVELSEESQIKTAFSTREWQFCFNRLPF*LSTAPATFQRLTH*ALI-FKGVVVYLDNILI*AQTQEEHDRIIFEVFSGIKKDGLKINTEKYQFYKSEFNFIGHTIKV--------YIQR*KIELVKAPKCVSRLRSFLG 2109
            DL  AY+QV L+EES+  TAF T E  F F R+P+ L +AP+ F +L    L   KGV  YLD++++  + Q+EHDR +  V + + + GL++N EK  F +    F+GH I          +++   I    AP   + LRSFLG
Sbjct:  528 DLANAYHQVLLAEESRDITAFITHEGLFRFRRVPYGLCSAPSAFSKLMSLVLKGLKGVQNYLDDVIVYGRDQQEHDRNLQAVLAALNEAGLQLNMEKCHFNQKSLQFLGHVISAKGLLPNEDHLK--AIAEAPAPGDATTLRSFLG 671          

HSP 2 Score: 80.1073 bits (196), Expect = 3.099e-42
Identity = 113/484 (23.35%), Postives = 187/484 (38.64%), Query Frame = -3
Query:  398 FGLTNYYRRFIKDYSPYMLKHRGII---------SR*FGMKNVKIVLIV*RKFYVKLQYLNFQCQTECL*FTLMPVLVL----STEVVIVYGSRHLTAREMGYYSQEKNYYSIMNLLCILEN------LYGNKFIVRTDHKALTFMNTTKN------QLAH------------NFRRSSQTYQNMILS----CSIEN-EMIMEMQMDFHG*KMSFAHNAKQSIKMQRRKIKSEVYKQFTRKCKYCGVSKNQNEDIIFKEIIPLLKGEKETVYDEVKQCK-YFILIEQLCILSIIE-DNKILVLVPQNYVTTLINYIHIELCHLGILKTLYYMKDFFYWNNLSQSVIKCINECSICAKRKIEQGRTRELLLPRPGEKFSEQMV-IDI-AYMETSEWNKKYVIVIIDRFSKL--VSLTGTTEQDEITVFNVVLDNWIYRFGKPDSILTDRGKIFEGS*RREWM*KFGLRQEFNSPYQHQSNGLAER 1705
             GLT +Y +F+K+Y+  +   R  +                 VK  +I      V    L     T+   + L  +L       TE  + + SR LT  E  Y   EK       L C+         L+G +F +RTDH+ALT +  TK       ++A              +R  +Q Y    LS     S+EN E ++E ++                + +   ++K+   K FT  C+ C       E    +E   + +G  +T        + YF + ++L +  +I        LVP      +IN  H    H G+++T   ++D ++W  +   V + I  C  C             L P P      Q V IDI    +++  + +Y I +ID ++K   V+ T +     IT F   L     RFG P  +++D G  F  +   +++    ++    S Y  Q+NG  ER
Sbjct:  670 LGLTAWYAKFVKNYASLVEPMRACLHTDTFKWTSEAQASFDAVKTRIINSPALAVFEPSLPTIVATDASDYGLGAILTQLHPDKTERTVAFASRSLTPAERKYSIVEKE-----ALACVWAVEKWRTFLWGTRFTLRTDHQALTTLLATKGLGRAGMRIARWSARLLCFTYDVEYRAGAQNYAADCLSRLPLPSVENAEPVVEPEL----------------VALLDTELKALTVKDFTAACQVC------PELTALREQ--MKQGWPKTAQSLPAMLQPYFAVRDELSVEEVIVYRGPYRRLVPVAVRKQIINLAH--ETHQGVVRTKQRLRDLYWWPYMDLCVEETIKACVTCQLNDKSAKIHPAPLHPIPFPDAPWQKVGIDIVGPFDSAAGDCRYAITLIDHYTKWPEVAFTPSITTSAITTF---LSTIFSRFGNPTELISDNGTQFTSTEFADYLAVRDIKHRKVSLYYPQANGAIER 1119          

HSP 3 Score: 38.5058 bits (88), Expect = 3.099e-42
Identity = 16/40 (40.00%), Postives = 25/40 (62.50%), Query Frame = -3
Query: 2156 SPKNSPLVIVGQKDGSIRICLDFRRLNAVTDKYSFPMPDM 2275
            SP  SP+V+  +K+G +R+C+D+R  N      S P+P M
Sbjct:  472 SPWVSPIVVTLRKNGKVRMCVDYREPNKAIVMDSHPLPHM 511          
BLAST of SMED30024572 vs. Planmine SMEST
Match: SMESG000081257.1 (SMESG000081257.1)

HSP 1 Score: 306.99 bits (785), Expect = 1.730e-156
Identity = 191/452 (42.26%), Postives = 256/452 (56.64%), Query Frame = -3
Query:  410 FGLTNYYRRFIKDYSPYMLKHRGIISR*FGMKNVKIVLIV*RKFYVKLQYLNFQCQTECL*FTLMPVLVLSTEVVIVYGSRHLTAREMGYYSQEKNYYSIMNLLCILEN-LYGNKFIVRTDHKALTFMNTTKNQLAHNFR---------------RSSQTYQNMILSCSIENEMIMEMQMDFHG*KMSFAHNAKQSIKMQRRKIKSEVYKQFTRKCKYCGVSKNQNEDIIFKEIIPLLKG-EKETVYDEVKQC--KYFILIE-QLCILSIIEDNKILVLVPQNYVTTLINYIHIELCHLGILKTLYYMKDFFYWNNLSQSVIKCINECSICAKRKIEQGRTRELLLPRPGEKFSEQMVIDIAYMETSEWNKKYVIVIIDRFSKLVSLTGTTEQDEITVFNVVLDNWIYRFGKPDSILTDRGKIFEGS*RREWM*KFGLRQEFNSPYQHQSNG 1705
             GLT YYRRFIK+YS          +   G   + +     RK ++ L+ L   C+   L +     L +           HLT  E+GY    K    +   +      LYG +F+ RTDHKALTFMNTTK  ++  F+               R    + N      + N +    QM+         H   +  K + R I S        K     + + QNED +  +II  L G E    Y  +     KY  +++ Q  +L I  D K+ V+VP +YV +L+NY HIELCHLGI KTL+Y+KDFF+  +++Q + +CIN+C ICA RKI+QGRT+E+LLPR GE+F EQ+V+DI YMET E +KKY+IVIID FSKLVSL     QDE T+ NV+L+NWIYRFG+P+SILTDR +IFEGS  R+WM KFG++QEF+SPYQHQSNG
Sbjct:  686 LGLTTYYRRFIKNYSMIAAPLYAATT---GCDKMIVWTEECRKRFINLKKL--LCEAPILEYPRADRLFIIDTDDSFEAIGHLTKHEIGYCVTRKELLVLHEFIVHFRQYLYGRRFVARTDHKALTFMNTTKKPISPQFQTWMANFSEYDFALQYRKGNEHGNAGGWSRLNNTICSHYQME---------HKDAKKAKCRTRCINSLQGSSNIMKI----IKQKQNEDKVTSQIISHLNGNEAHISYKTISSSIFKYLKILQIQDNVLMINTDGKLAVVVPDSYVKSLVNYFHIELCHLGINKTLFYLKDFFFLPSMNQIITECINKCKICASRKIDQGRTKEILLPRTGERFLEQIVVDIDYMETKE-SKKYMIVIIDCFSKLVSLP----QDEATILNVILNNWIYRFGRPESILTDRERIFEGSMFRDWMEKFGIKQEFSSPYQHQSNG 1114          

HSP 2 Score: 192.971 bits (489), Expect = 1.730e-156
Identity = 119/244 (48.77%), Postives = 151/244 (61.89%), Query Frame = -1
Query: 1699 NPRRQPMHLEIKIDELVRNLLKAKIIRKCQSVEAQRILHWS*LGRKMVLFVYVLILEGL----------MQ*QINIHSQCQICXXXXXXXXXXXXXXIDLGQAYYQVELSEESQIKTAFSTREWQFCFNRLPF*LSTAPATFQRLTH---*ALIFKGVVVYLDNILI*AQTQEEHDRIIFEVFSGIKKDGLKINTEKYQFYKSEFNFIGHTI-KVYIQR*K-----IELVKAPKCVSRLRSFLG 2373
            NPR QPMHLE K++ELV+NLL+A ++RKCQS     ++        + + +   +L  +          MQ  ++   + +I            F  IDLGQAYY VEL+E SQIKTAFST+E QFCFNRLPF LSTAPATFQ+L H     L+FKGVVVYLD+ILI  + QE HD+++FEVF+ I+  GLK+N EK  F KS  NFIGHT+ +  IQ  K     IE    PK  + LRSFLG
Sbjct:  456 NPRGQPMHLEAKVEELVQNLLEAGVVRKCQSPWNTPLVIVGKPDGSVRICLDFRLLNSVTEKFSFPMPDMQLLLDCLGKSKI------------FYSIDLGQAYYLVELNENSQIKTAFSTKEGQFCFNRLPFGLSTAPATFQKLMHQILEGLVFKGVVVYLDDILIYGENQETHDKLLFEVFTRIRDSGLKVNPEKCAFNKSVLNFIGHTVSEKGIQTNKRKISEIENATEPKSTTELRSFLG 687          

HSP 3 Score: 97.0561 bits (240), Expect = 1.730e-156
Identity = 50/102 (49.02%), Postives = 68/102 (66.67%), Query Frame = -2
Query: 2373 RN*DFVVARNISSGFIGGVDMIMLIGLIFKEIYNIDSSLLEVQHTDEEREKVALRILNFEKKSFFGQIISEFRNIFMASRFDLGYTKIIQHEIKTVGSPIFR 2678
            R  + ++ R I   FIGGVD + + G+  KE+ NI+SSL+  + TD +R K  L  L  +K S  G +IS+F NIFMASRFDLG+TK+I HE+KT G PI +
Sbjct:  354 RELNVIIVRKIHPNFIGGVDTMKIFGMELKEVNNIESSLVNKRFTDSDRLKNTLLTLKLDKNSELGTLISQFSNIFMASRFDLGHTKVITHELKTSGPPILQ 455          

HSP 4 Score: 172.555 bits (436), Expect = 3.997e-43
Identity = 101/246 (41.06%), Postives = 153/246 (62.20%), Query Frame = -2
Query: 2775 VKQELNERFSTFELKVKKMLDDIFDCGISTEKIVGSIASNHVNNDRLK*NLLSKPDMSREEMRITAKNFESRDLAGIKQIINEIQAVEKRTYSNVVQNKSQQLLDNS-PKKVFTQNNRYFNSSYQKKPLQKERQLHSSRPIVE--HPRTEIIDDGADKGYKHSVSLKKISRKLYK*CCGLPEPKDKILKRGQCFCCDENDHLRFQCPLKDKYLFCCKSDNLFRDCYLLXXXXXXXX---XRVFCIH 3494
            ++Q  +ERF TFE++VKK++D+++DCGIS E IV  +  + V NDRLK NL +K +++REE+R  AK  E+R+    K+   E+Q V K  Y+NV Q+K +Q +  S   +++   NR  + SYQ +  + ERQ    +P+ +  + RT +     ++     +S+K I+RK+Y   CGLPEP ++ LK G+CFCC +NDH+RF+CPLKDK L C K  + FR   LL  +    +   R V+CIH
Sbjct:    1 MRQNHDERFVTFEIRVKKLVDEVYDCGISKENIVKLVLCHGVRNDRLKGNLSTKDNITREEIRNLAKVHEAREGYNTKERSEEVQVVVKSIYANVTQDKQKQWIQKSFNNRIYP--NRQTDISYQNRNERNERQFDKVKPVTKQYNERTTM-----ERRPPPLISMKHITRKIYNRFCGLPEPVEERLKPGKCFCCGQNDHMRFECPLKDKCLICGKEGHSFRCFNLLVKSRSNTQRLERSVYCIH 239          

HSP 5 Score: 81.6481 bits (200), Expect = 3.412e-15
Identity = 34/46 (73.91%), Postives = 41/46 (89.13%), Query Frame = -3
Query: 2153 VSKCRSPKNSPLVIVGQKDGSIRICLDFRRLNAVTDKYSFPMPDMH 2290
            V KC+SP N+PLVIVG+ DGS+RICLDFR LN+VT+K+SFPMPDM 
Sbjct:  481 VRKCQSPWNTPLVIVGKPDGSVRICLDFRLLNSVTEKFSFPMPDMQ 526          
BLAST of SMED30024572 vs. Planmine SMEST
Match: SMESG000038955.1 (SMESG000038955.1)

HSP 1 Score: 173.326 bits (438), Expect = 5.215e-102
Identity = 103/199 (51.76%), Postives = 138/199 (69.35%), Query Frame = -1
Query: 1780 RRQPMHLEIKIDELVRNLLKAKIIRKCQSVEAQRILHWS*LGRKMVLFVYVLILEGLMQ*QINIHSQCQICXXXXXXXXXXXXXXIDLGQAYYQVELSEESQIKTAFSTREWQFCFNRLPF*LSTAPATFQRLTH---*ALIFKGVVVYLDNILI*AQTQEEHDRIIFEVFSGIKKDGLKINTEKYQFYKSEFNFIGHT 2367
            +++PMHLE K++ELV+NLL+A ++RK  S     ++    L   + + +   +L  + + + + +S   + +++      KIFS IDLGQAYYQVEL+E SQIKTAFST+E QFCFNRLPF LSTAPATFQ+L H     L+FKGVVVYLD ILI  + QE HD+++FEVF+ I+  GLK+N EK  F KS  NFIGHT
Sbjct:  147 KKKPMHLEGKVEELVQNLLEAGVVRKSISPWNTPLVIVGKLDGSIRMCLDFRLLNSVTE-KFSFYSP-DMKLLLDCLGNSKIFSSIDLGQAYYQVELNENSQIKTAFSTKEGQFCFNRLPFGLSTAPATFQKLMHQILEGLVFKGVVVYLDEILIYGENQEIHDKLLFEVFTRIRDSGLKVNPEKCAFNKSVLNFIGHT 343          

HSP 2 Score: 154.066 bits (388), Expect = 5.215e-102
Identity = 85/173 (49.13%), Postives = 110/173 (63.58%), Query Frame = -2
Query: 1176 LYAET*RNNKQIIWNEECKNSFNSLKKVLCEAPVLEFPMSDRMFIIYTDASFGAIDRSC-----DCIWI------KTFDST*NGILFTRKELLLNNEFIVHFRESLW-Q*IHCENRSQSIDFHEHYKKPISPQFQT*LANLSEYDFELQYRK*DDHGNADGFSWIKNEFCS*C 1658
            +Y  T  N+K I+W EEC+NSF +LKK+LCEAP+LE+P +DR+F+I TDASFGAI         DC  +      +       G   T KELL  +EFIVHFR+ L+ +        +++ F    KKPISPQFQT +ANLSE+DF LQYRK ++HGNADG S + N  CS C
Sbjct:  352 MYVATTGNDKMIVWTEECRNSFINLKKLLCEAPILEYPRADRLFVIDTDASFGAIGAVLSQIKEDCTEVVIAYGSRHLTKHEMGHCVTIKELLALHEFIVHFRQYLYGRRFVARTDHKALTFMNTTKKPISPQFQTWMANLSEHDFALQYRKGEEHGNADGKSRLNNTKCSHC 524          

HSP 3 Score: 73.9442 bits (180), Expect = 5.215e-102
Identity = 36/65 (55.38%), Postives = 47/65 (72.31%), Query Frame = -2
Query: 2397 KEIYNIDSSLLEVQHTDEEREKVALRILNFEKKSFFGQIISEFRNIFMASRFDLGYTKIIQHEIK 2591
            KE+ NI+S L+  + TD +R K+ L  L  +K S  G +IS+F NIFMASRFDLG+TK+I HEIK
Sbjct:   83 KEVNNIESLLVNKKFTDSDRLKITLSTLKLDKNSKLGTLISKFSNIFMASRFDLGHTKVITHEIK 147          

HSP 4 Score: 34.2686 bits (77), Expect = 5.215e-102
Identity = 17/33 (51.52%), Postives = 24/33 (72.73%), Query Frame = -1
Query: 1084 IMQNKA*RCKEEKSKVRYINSLQGNANIVESAK 1182
            +M+NK    KE K + RYINSLQG++NI++  K
Sbjct:  525 LMENKD--AKEAKCRTRYINSLQGSSNIMKIIK 555          

HSP 5 Score: 90.1225 bits (222), Expect = 1.505e-34
Identity = 46/91 (50.55%), Postives = 58/91 (63.74%), Query Frame = -2
Query:  105 MITTSLKGGFKENNWCELLPRIEFCLNAKIQSSTGFSTFDIVYSRKINLISNSGNVQELKDEILKSAKVNIENAGNSMKGSDQDKRGTRIL 377
            M+ TSL     +NNWC LLPRIEF  NA IQ+ST FS F+IVY RKINL S   ++Q+ ++EI    K N+  A  +M+  D D  GTR L
Sbjct:  667 MLATSLAEIKTKNNWCRLLPRIEFSFNATIQNSTKFSPFEIVYGRKINLYSGVEHIQKFREEIEDETKTNLVKAATTMQNRDIDNLGTRSL 757          

HSP 6 Score: 77.7962 bits (190), Expect = 1.505e-34
Identity = 38/66 (57.58%), Postives = 47/66 (71.21%), Query Frame = -3
Query:  392 QDEITVFNVVLDNWIYRFGKPDSILTDRGKIFEGS*RREWM*KFGLRQEFNSPYQHQSNGLAERTI 589
            QD++ + N      +     P+SILTDRG IFEGS  R+WM KFG++QEF+SPYQHQSN LAER I
Sbjct:  596 QDDVLMINTDGKLAVVVPDSPESILTDRGIIFEGSMFRDWMEKFGIKQEFSSPYQHQSNILAERII 661          

HSP 7 Score: 66.6254 bits (161), Expect = 1.166e-10
Identity = 31/45 (68.89%), Postives = 37/45 (82.22%), Query Frame = -3
Query: 2156 VSKCRSPKNSPLVIVGQKDGSIRICLDFRRLNAVTDKYSFPMPDM 2290
            V K  SP N+PLVIVG+ DGSIR+CLDFR LN+VT+K+SF  PDM
Sbjct:  170 VRKSISPWNTPLVIVGKLDGSIRMCLDFRLLNSVTEKFSFYSPDM 214          
BLAST of SMED30024572 vs. Planmine SMEST
Match: SMESG000057289.1 (SMESG000057289.1)

HSP 1 Score: 257.299 bits (656), Expect = 4.945e-98
Identity = 119/186 (63.98%), Postives = 153/186 (82.26%), Query Frame = -3
Query:  392 DNKILVLVPQNYVTTLINYIHIELCHLGILKTLYYMKDFFYWNNLSQSVIKCINECSICAKRKIEQGRTRELLLPRPGEKFSEQMVIDIAYMETSEWNKKYVIVIIDRFSKLVSLTGTTEQDEITVFNVVLDNWIYRFGKPDSILTDRGKIFEGS*RREWM*KFGLRQEFNSPYQHQSNGLAERTI 949
            D K+ V+VP +Y+ +L+NY +IELCHLGI KTL+Y+KDFF+W +++Q + + IN+C ICA RKI QG+T+E+LLPR GE+F EQ+V+DIAYMET E N KY+IVIID FSKLVSL+  + QDE T+ N +L+NWIYRFG+P+SILTD G+ FEGS  R+WM KF ++QEF SPYQHQSNGLAER I
Sbjct:    5 DGKLAVVVPDSYIKSLVNYFYIELCHLGIKKTLFYLKDFFFWPSMNQIIAEFINKCKICASRKIYQGQTKEILLPRTGERFLEQIVVDIAYMETKESN-KYMIVIIDSFSKLVSLSVASTQDEATILNFILNNWIYRFGRPESILTDIGRTFEGSMFRDWMEKFDIKQEFCSPYQHQSNGLAERNI 189          

HSP 2 Score: 122.479 bits (306), Expect = 4.945e-98
Identity = 61/113 (53.98%), Postives = 77/113 (68.14%), Query Frame = -2
Query:   39 MITTSLKGGFKENNWCELLPRIEFCLNAKIQSSTGFSTFDIVYSRKINLISNSGNVQELKDEILKSAKVNIENAGNSMKGSDQDKRGTRILDVGEKVLVRLKPHKRKKNGMLY 377
            M+ TSL     +NNWC LLP+IEF LNA IQ+ST FS F+IVY RKINL S  G++Q+ ++EI    K N+  A  SM+  D D  GTR+  V EKVLVRL+P +RKK G+ Y
Sbjct:  195 MLATSLTEIKTKNNWCILLPKIEFSLNATIQNSTKFSPFEIVYCRKINLYSGVGHIQKCREEIEDETKTNLVKAATSMQNRDLDSLGTRVFMVEEKVLVRLEPQRRKKEGIQY 307          
BLAST of SMED30024572 vs. Planmine SMEST
Match: SMESG000029259.1 (SMESG000029259.1)

HSP 1 Score: 152.525 bits (384), Expect = 1.065e-90
Identity = 100/234 (42.74%), Postives = 137/234 (58.55%), Query Frame = -1
Query: 1699 PRRQPMHLEIKIDELVRNLLKAKIIRKCQSV-EAQRILHWS*LGRKMVLFVYVLILEGLMQ*QINIHSQCQICXXXXXXXXXXXXXXIDLGQAYYQVELSEESQIKTAFSTREWQFCFNRLPF*LSTAPATFQRLTH*AL--IFK-GVVVYLDNILI*AQTQEEHDRIIFEVFSGIKKDGLKINTEKYQFYKSEFNFIGHTIK---VYIQR*KIELVKA---PKCVSRLRSFLG 2370
            PRRQP++LE KI+E ++NL    IIRKC S      +  W    + + L +    L  + + Q        +  I+      + FS IDLG AYYQV+L +ESQ KTAFST+E QFCFNR+PF ++ AP TFQ L    L  ++K GV+VYLD+ILI  +T+E+H  I  +V   I   GL++N EK Q ++ E  F+GH I    +     KIE +++   PKCV  LRSFLG
Sbjct: 2732 PRRQPINLEDKIEEAIKNLENNGIIRKCNSPWNTPLVCVWKKEKKDIRLCLDFRQLNKITERQA--FPMPNVDEILDILHGSRYFSSIDLGNAYYQVKLDKESQEKTAFSTKEGQFCFNRMPFGIAAAPGTFQELMTKVLKDLWKDGVMVYLDDILIFTKTEEDHYNIFGKVLGKIATAGLRLNPEKCQIFRKEVKFLGHIINKDGIQTDNTKIEAIQSFQKPKCVKNLRSFLG 2963          

HSP 2 Score: 136.346 bits (342), Expect = 1.065e-90
Identity = 141/472 (29.87%), Postives = 206/472 (43.64%), Query Frame = -3
Query:  398 FGLTNYYRRFIKDYSPYMLKHRGIIS----------------R*FG-MKNVKIVLIV*RKFYVKLQYLNFQ----CQTECL*FTLMPVLVL----STEVVIVYGSRHLTAREMGYYSQEKNYYSIMNLLCILEN--LYGNKFIVRTDHKALTFMNTTKNQLAHNFRRSSQTYQNMILSCSIENEM---IMEMQMDFHG*KMSFAHNAKQSIKMQRRKIKSEVYKQFTRKCKYCGVSKNQNEDIIFKEIIPLLKGEKETVYDEVKQCKYFILIEQLCILSIIEDNKIL-----VLVPQNYVTTLINYIHIELCHLGILKTLYYMKDFFYWNNLSQSVIKCINECSICAKRKIEQGRTRELLLPRPGEKFSEQMVIDIAYMETSEWNKK-YVIVIIDRFSKLVSLTGTTEQDEITVFNVVLDNWIYRFGKPDSILTDRGKIFEGS*RREWM*KFGLRQEFNSPYQHQSNGLAER 1705
             G+ NYYRRFIKDY+    K R + S                + FG MK   I   V       L + +F+      T+    T+  VL        E VI YGS  +++ E GY    K   +I    C   N  LYG +F++RTDHKA+TFM TTK  +   F    QT+ N + S  I+ E          D    K        Q +         ++  +        G +K QN+++  +EI   L         E K CK+           I+E+N +L     + +P +    +I  +H+ LCH G  K   Y+++     NL+  V K I  C  C K K    +T+E        +  E++ +DI       +NKK Y+  IID +SK +SLT   +QDE T+   +L+ WI +FG P  +  D GK FE    +E     G+   F+SPY H +NG+ ER
Sbjct: 2962 LGICNYYRRFIKDYAK---KARALESICGKNNEKIRWTEMCEKAFGEMKEALITAPV-------LVFPDFRKEFILDTDASFDTIGAVLSQKDEKGHEHVIAYGSHAMSSHEKGYCITRKELLAIY-YFCKHFNHYLYGKRFVLRTDHKAITFMVTTKKPITAQF----QTWINYLSSLDIKMEYRKGTSHTNADMLSRKT--CGTCVQCMMEHEDAKTGKIKTRILTVTAEGGYNKWQNDNMEVQEIKNKL---------ENKDCKF-----------IMENNTVLTKQGKIWIPSDNRQRMIKEVHVLLCHAGAQKVTKYIQNNCDMENLATEVKKVIENCERCQKMKTITTKTKEETQTIKSTEPFEKIYMDICGPLKETFNKKKYICGIIDHYSKYISLTAINKQDERTISETLLNKWILKFGAPKELHVDCGKNFEARSIKELAKTAGIELIFSSPYHHNTNGIIER 3396          

HSP 3 Score: 58.151 bits (139), Expect = 1.065e-90
Identity = 35/111 (31.53%), Postives = 58/111 (52.25%), Query Frame = -2
Query: 2376 RN*DFVVARNISSGFIGGVDMIMLIGL----IFKEIYNIDSSLLEVQH------TDEEREKVALRILNFEKKSFFGQIISEFRNIFMASRFDLGYTKIIQHEIKTVGSPIF 2678
            RN  F++ +N+    IGGV++  L G+    I +E       + E++       TDEER + A+ +L         +I    +N+FMA ++D+G T +I+H+I T G PI 
Sbjct: 2619 RNVTFIIVKNLIPEIIGGVELQRLFGIELKCILEEHEKRSDFICEIEARFGRIITDEERLRHAIDVLKVTGNKRLLEIFQANKNVFMADKWDIGCTNLIKHKIITKGEPIM 2729          

HSP 4 Score: 50.8322 bits (120), Expect = 1.065e-90
Identity = 36/122 (29.51%), Postives = 67/122 (54.92%), Query Frame = -2
Query:    9 ITTSLKGGFKENNWCELLPRIEFCLNAKIQSSTGFSTFDIVYSRKINLISNSGNVQELKDEILKSAKVNIENAGNSMKGSDQDKRGTRILDVGEKVLVRLKPHKRKKNGMLYEGPYEILRFI 374
            I  SL  G ++N W +++P I++ LNA +Q +TG S  +I++ RKI+ +    N +  ++++ K     IE+     K S    +  R  ++ + VL+  K   R K+   +EGPY++++ I
Sbjct: 3405 INASLNEGGRKN-WADIVPEIKYTLNATVQKTTGVSPAEIIFGRKIDRMKWYSNKEINREDMEK----RIEDKTLKPKIS----KTVRNFEMEDVVLI--KQEIRNKDDARWEGPYKVIKKI 3515          

HSP 5 Score: 80.8777 bits (198), Expect = 7.337e-15
Identity = 58/157 (36.94%), Postives = 77/157 (49.04%), Query Frame = -2
Query: 1206 RNNKQIIWNEECKNSFNSLKKVLCEAPVLEFPMSDRMFIIYTDASF---GAIDRSCD--------CIWIKTFDST*NGILFTRKELLLNNEFIVHFRESLW-Q*IHCENRSQSIDFHEHYKKPISPQFQT*LANLSEYDFELQYRK*DDHGNADGFS 1640
            +NN++I W E C+ +F  +K+ L  APVL FP   + FI+ TDASF   GA+    D                S   G   TRKELL    F  HF   L+ +        ++I F    KKPI+ QFQT +  LS  D +++YRK   H NAD  S
Sbjct: 2988 KNNEKIRWTEMCEKAFGEMKEALITAPVLVFPDFRKEFILDTDASFDTIGAVLSQKDEKGHEHVIAYGSHAMSSHEKGYCITRKELLAIYYFCKHFNHYLYGKRFVLRTDHKAITFMVTTKKPITAQFQTWINYLSSLDIKMEYRKGTSHTNADMLS 3144          

HSP 6 Score: 55.8398 bits (133), Expect = 2.902e-7
Identity = 24/46 (52.17%), Postives = 36/46 (78.26%), Query Frame = -3
Query: 2156 VSKCRSPKNSPLVIVGQKDG-SIRICLDFRRLNAVTDKYSFPMPDM 2290
            + KC SP N+PLV V +K+   IR+CLDFR+LN +T++ +FPMP++
Sbjct: 2756 IRKCNSPWNTPLVCVWKKEKKDIRLCLDFRQLNKITERQAFPMPNV 2801          
BLAST of SMED30024572 vs. Planmine SMEST
Match: SMESG000073986.1 (SMESG000073986.1)

HSP 1 Score: 219.935 bits (559), Expect = 1.823e-84
Identity = 144/343 (41.98%), Postives = 191/343 (55.69%), Query Frame = -3
Query:  392 YGNKFIVRTDHKALTFMNTTKNQLAHNFRRSSQTYQNMILSCSIENEMIMEMQMDFHG*K--MSFAHNAKQS-IKMQRRKIKSEVYKQFTRKCKYCGVSKN--------QNEDIIFKEIIPLLKGEKETVYDEVKQCKYF----ILIEQLCILSIIEDNKILVLVPQNYVTTLINYIHIELCHLGILKTLYYMKDFFYWNNLSQSVIKCINECSICAKRKIEQGRTRELLLPRPGEKFSEQMVIDIAYMETSEWNKKYVIVIIDRFSKLVSLTGTTEQDEITVFNVVLDNWIYRFGKPDSILTDRGKIFEGS*RREWM*KFGLRQEFNSPYQHQSNGLAERTI 1375
            YG +F+ +TDHKALTFMNTTK  +   F       Q  + + S  +  +   + + HG    MS  +N   S  +M+R+   S+  K  TR       S N        QN+D +   II  L G +  +  E      F    IL  Q  +L I  D K+ V+VP +Y  +L                                   CI +C I A RKI+QGR +E+LLPR  ++F EQ+V+DIAYMET E +K  +IVII+RFSKLVSL+  + QDE T+ NV+L+NWIYRFG+P+SILTDRG+IFEGS   +WM KFG++QEF+SPYQHQSNGLAER I
Sbjct:  166 YGRRFVAKTDHKALTFMNTTKKPINPQF-------QTWMANLSEYDFALQYRKAEEHGNADGMSRLNNTICSHCQMERKD--SKRAKCRTRYINSLQGSSNIIKIIKQKQNKDRVTSVIILHLNGNEAHISYETISSSIFKYSKILQIQDDVLMINTDGKLAVVVPDSYAKSL-----------------------------------CIKKCKIYASRKIDQGRAKEILLPRTRKRFLEQIVVDIAYMETKE-SKNCMIVIINRFSKLVSLSAASTQDEATILNVILNNWIYRFGRPESILTDRGRIFEGSMFHDWMEKFGIKQEFSSPYQHQSNGLAERII 463          

HSP 2 Score: 114.775 bits (286), Expect = 1.823e-84
Identity = 55/105 (52.38%), Postives = 73/105 (69.52%), Query Frame = -2
Query:   63 MITTSLKGGFKENNWCELLPRIEFCLNAKIQSSTGFSTFDIVYSRKINLISNSGNVQELKDEILKSAKVNIENAGNSMKGSDQDKRGTRILDVGEKVLVRLKPHK 377
            M+ TSL     +NNWC LLP+IEF LNA I+ ST FS F+I+Y RKINL S  G++Q+ ++EI    K N+  A  +MK  D D +GTR+  VG+KVLVRL+PH+
Sbjct:  469 MLATSLAKIKTKNNWCILLPKIEFSLNATIKISTKFSPFEIIYWRKINLYSGVGHIQKFREEIEDETKTNLVKAATTMKNRDLDNQGTRVFMVGKKVLVRLEPHR 573          

HSP 3 Score: 76.2554 bits (186), Expect = 9.729e-14
Identity = 34/56 (60.71%), Postives = 42/56 (75.00%), Query Frame = -2
Query: 1176 QSIDFHEHYKKPISPQFQT*LANLSEYDFELQYRK*DDHGNADGFSWIKNEFCS*C 1343
            +++ F    KKPI+PQFQT +ANLSEYDF LQYRK ++HGNADG S + N  CS C
Sbjct:  177 KALTFMNTTKKPINPQFQTWMANLSEYDFALQYRKAEEHGNADGMSRLNNTICSHC 232          

HSP 4 Score: 62.3882 bits (150), Expect = 1.762e-9
Identity = 36/83 (43.37%), Postives = 51/83 (61.45%), Query Frame = -2
Query: 2430 RN*DFVVARNISSGFIGGVDMIMLIGLIFKEIYNIDSSLLEVQHTDEEREKVALRILNFEKKSFFGQIISEFRNIFMASRFDL 2678
            R  + ++ R I   F+G V  + + G+  KE+ NI+SSL   + TD +R K+ L  L  +K S  G +IS+FRNIFMASRFD 
Sbjct:   79 REFNVIIVRKIHPDFLGVVGTMKIFGMELKEVINIESSLDNKRFTDSDRLKITLLTLKLDKNSKLGTLISQFRNIFMASRFDF 161          
The following BLAST results are available for this feature:
BLAST of SMED30024572 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30024572 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30024572 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30024572 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BX511082.11.032e-2635.62pep chromosome:GRCz11:9:14291932:14297132:1 gene:E... [more]
BX546500.19.917e-2634.93pep chromosome:GRCz11:23:12926092:12931693:-1 gene... [more]
CR925755.21.541e-2535.62pep chromosome:GRCz11:17:42486740:42492668:-1 gene... [more]
BX511224.13.609e-2534.93pep chromosome:GRCz11:2:18017000:18022765:1 gene:E... [more]
CR855320.16.034e-2534.93pep chromosome:GRCz11:1:7956030:7961696:1 gene:ENS... [more]
back to top
BLAST of SMED30024572 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000006041.11.193e-5639.73pep primary_assembly:Xenopus_tropicalis_v9.1:6:373... [more]
anxa61.981e-3032.65annexin A6 [Source:Xenbase;Acc:XB-GENE-989741][more]
alkbh53.966e-2237.93alkB homolog 5, RNA demethylase [Source:Xenbase;Ac... [more]
ENSXETT00000034712.15.189e-2136.84pep primary_assembly:Xenopus_tropicalis_v9.1:9:335... [more]
ENSXETT00000042189.15.278e-2136.84pep primary_assembly:Xenopus_tropicalis_v9.1:KV460... [more]
back to top
BLAST of SMED30024572 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30024572 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P04323|POL3_DROME2.270e-2334.93Retrovirus-related Pol polyprotein from transposon... [more]
sp|Q99315|YG31B_YEAST6.406e-2232.19Transposon Ty3-G Gag-Pol polyprotein OS=Saccharomy... [more]
sp|Q7LHG5|YI31B_YEAST8.655e-2232.19Transposon Ty3-I Gag-Pol polyprotein OS=Saccharomy... [more]
sp|Q8I7P9|POL5_DROME1.584e-2132.19Retrovirus-related Pol polyprotein from transposon... [more]
sp|P20825|POL2_DROME1.921e-2141.23Retrovirus-related Pol polyprotein from transposon... [more]
back to top
BLAST of SMED30024572 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A087T3I44.143e-5625.36Retrovirus-related Pol polyprotein from transposon... [more]
A0A5S6QHB14.487e-5523.31Uncharacterized protein OS=Trichuris muris OX=7041... [more]
A0A5S6Q2I33.034e-5423.11Uncharacterized protein OS=Trichuris muris OX=7041... [more]
A0A5G3IEJ41.093e-5339.73Uncharacterized protein OS=Xenopus tropicalis OX=8... [more]
A0A087SUZ92.326e-5324.79Retrovirus-related Pol polyprotein from transposon... [more]
back to top
BLAST of SMED30024572 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000035136.12.536e-4936.99pep primary_assembly:Astyanax_mexicanus-2.0:19:221... [more]
ENSAMXT00000041345.12.057e-4434.25pep primary_assembly:Astyanax_mexicanus-2.0:25:323... [more]
ENSAMXT00000038088.16.826e-4333.56pep primary_assembly:Astyanax_mexicanus-2.0:23:138... [more]
ENSAMXT00000052892.15.870e-3837.67pep primary_assembly:Astyanax_mexicanus-2.0:15:168... [more]
ENSAMXT00000053730.18.217e-3836.30pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of SMED30024572 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30024572 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30024572 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30024572 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000032005.12.341e-4837.58pep primary_assembly:ASM223467v1:7:31190450:311944... [more]
ENSORLT00000041674.12.936e-4836.49pep primary_assembly:ASM223467v1:5:30088905:300929... [more]
ENSORLT00000027908.13.018e-4622.62uncharacterized protein K02A2.6-like [Source:NCBI ... [more]
ENSORLT00000045836.18.159e-4622.62pep primary_assembly:ASM223467v1:15:13736160:13740... [more]
ENSORLT00000044147.13.099e-4238.36uncharacterized protein K02A2.6-like [Source:NCBI ... [more]
back to top
BLAST of SMED30024572 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000081257.11.730e-15642.26SMESG000081257.1[more]
SMESG000038955.15.215e-10251.76SMESG000038955.1[more]
SMESG000057289.14.945e-9863.98SMESG000057289.1[more]
SMESG000029259.11.065e-9042.74SMESG000029259.1[more]
SMESG000073986.11.823e-8441.98SMESG000073986.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024572 ID=SMED30024572|Name=SMED30024572|organism=Schmidtea mediterranea sexual|type=transcript|length=4230bp
CGATGAGATATAAATCGTAGAATTTCATAAGGTCCTTCATATAGCATCCC
ATTTTTCTTTCGTTTATGTGGCTTTAATCTCACCAACACTTTCTCTCCCA
CATCTAAAATTCTTGTTCCTCTTTTATCCTGGTCACTCCCTTTCATTGAG
TTTCCTGCATTCTCTATATTTACTTTAGCTGACTTTAAAATTTCATCTTT
TAATTCCTGAACATTTCCTGAATTTGAAATTAAATTTATTTTCCGGCTAT
AAACAATGTCAAAAGTCGAAAATCCAGTAGAGCTCTGTATTTTTGCATTT
AAACAAAACTCAATTCTGGGTAATAGTTCACACCAATTGTTTTCCTTAAA
CCCTCCTTTTAATGATGTCGTAATCATATAACCTTACTGTCAATGGTTCT
TTCCGCAAGCCCATTTGACTGATGCTGATATGGTGAATTAAATTCTTGTC
GCAATCCAAATTTTCACATCCATTCTCGCCTCTATGACCCTTCAAAAATC
TTTCCTCTGTCAGTTAATATGCTATCTGGTTTGCCAAAACGGTAAATCCA
GTTATCCAAGACAACATTGAAAACAGTAATCTCATCTTGTTCTGTAGTTC
CTGTCAAACTTACAAGTTTACTGAACCGATCAATAATGACTATTACATAT
TTCTTATTCCATTCAGATGTTTCCATGTATGCTATATCTATTACCATCTG
CTCTGAAAACTTTTCCCCTGGTCTTGGTAGTAAAAGTTCTCTCGTTCGTC
CTTGTTCAATTTTTCTCTTTGCACAGATTGAGCATTCATTTATACATTTA
ATTACACTTTGACTTAAATTATTCCAATAAAAGAAATCTTTCATATAATA
CAAAGTTTTTAAAATACCTAAATGACACAATTCAATGTGAATGTAATTTA
TCAATGTTGTAACGTAATTTTGGGGAACTAGTACCAATATTTTGTTATCC
TCTATAATTGATAGTATGCATAGTTGTTCTATTAGTATAAAATATTTGCA
TTGTTTTACTTCATCATACACTGTTTCTTTCTCACCCTTCAATAGCGGTA
TAATTTCTTTAAAAATAATGTCTTCATTCTGGTTTTTGCTGACTCCACAA
TATTTGCATTTCCTTGTAAACTGTTTATATACCTCACTTTTGATTTTTCT
TCTTTGCATCTTTATGCTTTGTTTTGCATTATGAGCAAAACTCATTTTTT
ATCCATGAAAATCCATCTGCATTTCCATGATCATCTCATTTTCGATACTG
CAACTCAAAATCATATTCTGATAAGTTTGCGAGCTACGTCTGAAATTGTG
GGCTAATTGGTTTTTTGTAGTGTTCATGAAAGTCAATGCTTTGTGATCTG
TTCTCACAATGAATTTATTGCCATAGAGATTCTCTAAAATGCACAATAAA
TTCATTATTGAGTAATAATTCTTTTCTTGTGAATAGTATCCCATTTCACG
TGCTGTCAAATGTCTTGATCCATATACAATCACAACTTCTGTCGATAGCA
CCAAAACTGGCATCAGTGTAAATTATAAACATTCTGTCTGACATTGGAAA
TTCAAGTACTGGAGCTTCACATAAAACTTTCTTTAAACTATTAAAACTAT
TTTTACATTCTTCATTCCAAATTATCTGCTTATTATTCCTCTATGTTTCA
GCATATAAGGTGAATAATCTTTAATAAAACGTCGATAATAATTTGTCAAC
CCAAAAATGATCTAAGCCGAGACACACATTTTGGCGCTTTGACTAATTCT
ATTTTTTATCTCTGTATGTACACCTTTATTGTATGTCCAATAAAATTAAA
TTCACTCTTATAAAATTGATACTTTTCTGTATTAATCTTCAATCCATCTT
TTTTTATCCCACTAAATACTTCAAAAATGATTCTATCGTGTTCTTCTTGA
GTTTGAGCCTATATTAATATATTGTCTAGATAAACCACAACACCTTTAAA
AATTAATGCTTAATGTGTCAATCGTTGGAAAGTAGCAGGAGCTGTTGACA
GTCAAAATGGTAACCTATTAAAACAGAATTGCCATTCTCTTGTGCTAAAG
GCTGTTTTAATCTGAGATTCTTCTGATAACTCAACTTGATAATAGGCCTG
ACCTAAATCTATTTATGAGAATATTTTTATCTTACGAGAAAATCTAATAA
TAATGCATATCTGGCATTGGGAATGAATATTTATCTGTCACTGCATTAAG
CCTTCTAAAATCAAGACATATACGAATAGAACCATCTTTCTGCCCAACTA
TGACCAATGGAGAATTCTTTGGGCTTCGACACTTTGACACTTTCTGATAA
TTTTTGCTTTCAGTAAGTTTCTTACTAATTCATCAATTTTGATTTCTAAA
TGCATTGGTTGTCTACGCGGGTTCTAAAAATTGGTGATCCAACTGTCTTT
ATTTCATGTTGAATTATTTTCGTATACCCTAAATCAAATCTGGATGCCAT
AAAGATATTTCTAAATTCAGAAATAATTTGACCAAAAAATGATTTCTTTT
CAAAATTCAAAATACGCAATGCAACTTTTTCTCTCTCTTCATCAGTATGT
TGTACTTCCAATAATGAGGAATCTATATTGTAAATTTCTTTAAAAATTAA
TCCAATTAGCATTATCATATCTACACCTCCGATAAAACCCGAAGAGATAT
TTCTAGCAACGACAAAATCTCAATTTCTGCTCTGTTAATTTTAATCTTAC
TCCAATTTTGACCATCTTCCTTCATATACATCGCATCTTCTTCAACCGCA
TTTCGTTTTATATAATTATATATCATGTATGCAAAAAACCCTTCTTTCAT
TCTTTCGTTCATTATTTCTTAACAAATAGCAGTCTCTAAATAAATTATCT
GACTTACAGCAAAAAAGGTATTTATCTTTCAGTGGGCATTGGAAACGTAA
ATGATCATTTTCATCACAACAAAAACACTGACCTCGTTTTAGTATCTTAT
CTTTAGGCTCTGGTAATCCACAGCATCACTTATACAATTTTCTGGAAATT
TTTTTAAGCGAAACAGAATGTTTATAACCTTTATCTGCTCCATCATCAAT
AATTTCCGTTCTAGGATGTTCTACTATCGGTCTGCTTGAATGCAATTGTC
TTTCCTTCTGCAATGGTTTTTTTTGGTATGAAGAATTAAAATACCTGTTG
TTTTGCGTAAACACTTTCTTTGGTGAATTATCTAACAATTGTTGGCTTTT
ATTTTGAACAACATTGGAATATGTTCGTTTTTCTACAGCTTGAATTTCAT
TTATAATTTGCTTGATTCCGGCTAAATCTCGAGATTCAAAATTTTTGGCA
GTTATCCTCATTTCTTCTCTTGACATATCTGGCTTTGACAACAAATTTTA
TTTTAAACGATCATTATTAACATGATTTGATGCGATAGATCCAACAATTT
TTTCTGTTGAGATACCACAATCAAAAATGTCATCTAACATCTTCTTTACT
TTTAATTCAAAAGTTGAAAAGCGCTCATTTAGTTCTTGTTTCACATGAGT
TAACTCGTAAATTTTATCAACAATTGATTTTTGTGACTTGAACGTGTCAA
CAAACCAGCTTCTTGCATCTTCATCAGTTAAGCCTAGCTTCTTGAAATCT
CTCCAAAGGATATTGGCTTCTTCAGTCAGTAGTAAATCAAAAAATCCAAT
TAAACTTTCCAAGCCAATTATTTCTTTCATTAAATTTTCGGATATTTAAA
TTTAAAATGTATCTAGCGTGCTTGGACAATGTATCTAAAATCAATTGTCT
TTGATGATTCCTTGTAACTGCATTAAAAGATTCGCTTTTAGTATTATAAG
ATTTTCAATCGTCATTTAAGGTTTATTAACAATTTATCATTATTTAATAA
GCATCAGTTTAATATTCATCACTTATTAACTTTTCTTATTTTAATTCAAT
TTAATAATTACACGGGTCTTTTTATCGAGTCCGATAAATTCGTGTTTATT
TAAATCTTTGAGGCATGATTGTGTGTCTTTCTACCACATTTTCAGAACTA
TTTTTTGTTCAATTTCATGCATAAAATAATAGTTTCAAGTCCATACGTAT
AATTATTAATATTATTTTATAATTATTCAATTTTGATTATAATTTATATT
TATCATATTCACCATAATTGTAAGGTAGAGGTTAGAGATAAATATATTAT
GACTAACTATTTGTATAATTCAATATATACATTATAACGTCATTAGCACT
GATGTAGTAAATTGGGCTGAGGAACCTTTC
back to top

protein sequence of SMED30024572-orf-1

>SMED30024572-orf-1 ID=SMED30024572-orf-1|Name=SMED30024572-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=111bp
MKEIIGLESLIGFFDLLLTEEANILWRDFKKLGLTDEDARSWFVDTFKSQ
KSIVDKIYELTHVKQELNERFSTFELKVKKMLDDIFDCGISTEKIVGSIA
SNHVNNDRLK*
back to top

protein sequence of SMED30024572-orf-2

>SMED30024572-orf-2 ID=SMED30024572-orf-2|Name=SMED30024572-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=105bp
MPVLVLSTEVVIVYGSRHLTAREMGYYSQEKNYYSIMNLLCILENLYGNK
FIVRTDHKALTFMNTTKNQLAHNFRRSSQTYQNMILSCSIENEMIMEMQM
DFHG*
back to top

protein sequence of SMED30024572-orf-3

>SMED30024572-orf-3 ID=SMED30024572-orf-3|Name=SMED30024572-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=125bp
MITTSLKGGFKENNWCELLPRIEFCLNAKIQSSTGFSTFDIVYSRKINLI
SNSGNVQELKDEILKSAKVNIENAGNSMKGSDQDKRGTRILDVGEKVLVR
LKPHKRKKNGMLYEGPYEILRFISH
back to top

protein sequence of SMED30024572-orf-4

>SMED30024572-orf-4 ID=SMED30024572-orf-4|Name=SMED30024572-orf-4|organism=Schmidtea mediterranea sexual|type=polypeptide|length=238bp
MSFAHNAKQSIKMQRRKIKSEVYKQFTRKCKYCGVSKNQNEDIIFKEIIP
LLKGEKETVYDEVKQCKYFILIEQLCILSIIEDNKILVLVPQNYVTTLIN
YIHIELCHLGILKTLYYMKDFFYWNNLSQSVIKCINECSICAKRKIEQGR
TRELLLPRPGEKFSEQMVIDIAYMETSEWNKKYVIVIIDRFSKLVSLTGT
TEQDEITVFNVVLDNWIYRFGKPDSILTDRGKIFEGS*
back to top

protein sequence of SMED30024572-orf-5

>SMED30024572-orf-5 ID=SMED30024572-orf-5|Name=SMED30024572-orf-5|organism=Schmidtea mediterranea sexual|type=polypeptide|length=117bp
MSREEMRITAKNFESRDLAGIKQIINEIQAVEKRTYSNVVQNKSQQLLDN
SPKKVFTQNNRYFNSSYQKKPLQKERQLHSSRPIVEHPRTEIIDDGADKG
YKHSVSLKKISRKLYK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR012337RNaseH-like_sf
IPR001584Integrase_cat-core
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
Vocabulary: biological process
TermDefinition
GO:0015074DNA integration