Receptor type tyrosine protein phosphatase zeta

Overview
NameReceptor type tyrosine protein phosphatase zeta
Smed IDSMED30024560
Length (bp)2361
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Receptor type tyrosine protein phosphatase zeta (SMED30024560) t-SNE clustered cells

Violin plots show distribution of expression levels for Receptor type tyrosine protein phosphatase zeta (SMED30024560) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Receptor type tyrosine protein phosphatase zeta (SMED30024560) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Receptor type tyrosine protein phosphatase zeta (SMED30024560) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024560

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
muscle cellSMED30024560SMESG000041505.1 dd_Smed_v4_6997_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
anterior region of the whole animalSMED30024560SMESG000041505.1 dd_Smed_v4_6997_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30024560SMESG000041505.1 dd_Smed_v4_6997_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
medial muscle cellSMED30024560SMESG000041505.1 dd_Smed_v4_6997_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30024560SMESG000041505.1 dd_Smed_v4_6997_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Receptor type tyrosine protein phosphatase zeta vs. Ensembl Human
Match: PTPRZ1 (protein tyrosine phosphatase receptor type Z1 [Source:HGNC Symbol;Acc:HGNC:9685])

HSP 1 Score: 372.474 bits (955), Expect = 1.166e-111
Identity = 204/493 (41.38%), Postives = 293/493 (59.43%), Query Frame = 3
Query:   96 GFKRPYAYIATQGPLTETVADFWQMVWEQNSEIIVMISNFVERGRSKCEIYWSPNKTLNCGNISVHQIYQKEMAFYTERAFRIRNIRLKKNIKD-----RTVYHYQYTDWRDFDXXXXXXXXXXFVRATTKHWSESSGPIIVHCSAGVGRTGTYICIESQIRQLDQEHHINVRGFLEHIRQQRMKLVQTESQYTFIHDALYEYYLYPDREIHKLELSIYISKLKEFDASGCMKLDTQFKKCINFEPSDYDYMESKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSN-ENMHQ----FWPGPDNNALTFRWFKV-------HCNSEKTEFSVQYSFLISSSREDYALDCTMHCLKYWPNTVSECSELLRLLFDINSKKYS--GPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELL 1517
            G+ RP AYIA QGPL  T  DFW+M+WE N E+IVMI+N VE+GR KC+ YW  + +   GN  V Q   + +A+YT R F +RN ++KK  +      R V  Y YT W D  VP  SLPVL FVR        + GP++VHCSAGVGRTGTYI ++S ++Q+  E  +N+ GFL+HIR QR  LVQTE QY FIHD L E  L  + E+    +  Y++ L     +G  KL+ QF+          DY  + K+ N  KNR+ +I+P+E  R+ +S   G EG++YINAS I GY+Q  EFIITQHPL  T +DFW+M+WD N  L++++ + +NM +    +WP  D   +    FKV        C S + +  +Q  F++ ++++DY L+        WPN  S  S+   L+  I  +  +  GP++V DE+G   AG F A+++L+HQL K++ V+VY V KMI++ RP  F+      F+Y+++
Sbjct:  923 GYNRPKAYIAAQGPLKSTAEDFWRMIWEHNVEVIVMITNLVEKGRRKCDQYWPADGSEEYGNFLVTQKSVQVLAYYTVRNFTLRNTKIKKGSQKGRPSGRVVTQYHYTQWPDMGVPEYSLPVLTFVRKAAYAKRHAVGPVVVHCSAGVGRTGTYIVLDSMLQQIQHEGTVNIFGFLKHIRSQRNYLVQTEEQYVFIHDTLVEAILSKETEVLDSHIHAYVNALLIPGPAGKTKLEKQFQLLSQSNIQQSDYSAALKQCNREKNRTSSIIPVERSRVGISSLSG-EGTDYINASYIMGYYQSNEFIITQHPLLHTIKDFWRMIWDHNAQLVVMIPDGQNMAEDEFVYWPNKD-EPINCESFKVTLMAEEHKCLSNEEKLIIQ-DFILEATQDDYVLEVRHFQCPKWPNPDSPISKTFELISVIKEEAANRDGPMIVHDEHGGVTAGTFCALTTLMHQLEKENSVDVYQVAKMINLMRPGVFADIEQYQFLYKVI 1412          

HSP 2 Score: 90.8929 bits (224), Expect = 5.935e-18
Identity = 66/258 (25.58%), Postives = 123/258 (47.67%), Query Frame = 3
Query:  864 KNRSDTIMPIESRRINLS--CEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSN------ENMHQFWPGP-----DNNALTFRWFKVHCNSEKTEFSVQYSFLISSSREDYALD--CTMHCLKYWPNT-VSECSELLRLLFDINSKKYS-----GPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELL-------EFVILNQHLYTF 1553
            KNR   I+  +  R+ L+   E   + ++YINA+ + GY + K +I  Q PL  T +DFW+M+W+ N  +I++++N          Q+WP        N  +T +  +V        F+++ + +   S++        T +    WP+  V E S  L +L  +    Y+     GP+VV    G  R G ++ + S+L Q++ +  VN++  +K I  +R Y   +    +FI++ L       E  +L+ H++ +
Sbjct:  886 KNRYINIVAYDHSRVKLAQLAEKDGKLTDYINANYVDGYNRPKAYIAAQGPLKSTAEDFWRMIWEHNVEVIVMITNLVEKGRRKCDQYWPADGSEEYGNFLVTQKSVQVLAYYTVRNFTLRNTKIKKGSQKGRPSGRVVTQYHYTQWPDMGVPEYS--LPVLTFVRKAAYAKRHAVGPVVVHCSAGVGRTGTYIVLDSMLQQIQHEGTVNIFGFLKHIRSQRNYLVQTEEQYVFIHDTLVEAILSKETEVLDSHIHAY 1141          
BLAST of Receptor type tyrosine protein phosphatase zeta vs. Ensembl Human
Match: PTPRZ1 (protein tyrosine phosphatase receptor type Z1 [Source:HGNC Symbol;Acc:HGNC:9685])

HSP 1 Score: 373.244 bits (957), Expect = 1.342e-111
Identity = 204/493 (41.38%), Postives = 293/493 (59.43%), Query Frame = 3
Query:   96 GFKRPYAYIATQGPLTETVADFWQMVWEQNSEIIVMISNFVERGRSKCEIYWSPNKTLNCGNISVHQIYQKEMAFYTERAFRIRNIRLKKNIKD-----RTVYHYQYTDWRDFDXXXXXXXXXXFVRATTKHWSESSGPIIVHCSAGVGRTGTYICIESQIRQLDQEHHINVRGFLEHIRQQRMKLVQTESQYTFIHDALYEYYLYPDREIHKLELSIYISKLKEFDASGCMKLDTQFKKCINFEPSDYDYMESKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSN-ENMHQ----FWPGPDNNALTFRWFKV-------HCNSEKTEFSVQYSFLISSSREDYALDCTMHCLKYWPNTVSECSELLRLLFDINSKKYS--GPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELL 1517
            G+ RP AYIA QGPL  T  DFW+M+WE N E+IVMI+N VE+GR KC+ YW  + +   GN  V Q   + +A+YT R F +RN ++KK  +      R V  Y YT W D  VP  SLPVL FVR        + GP++VHCSAGVGRTGTYI ++S ++Q+  E  +N+ GFL+HIR QR  LVQTE QY FIHD L E  L  + E+    +  Y++ L     +G  KL+ QF+          DY  + K+ N  KNR+ +I+P+E  R+ +S   G EG++YINAS I GY+Q  EFIITQHPL  T +DFW+M+WD N  L++++ + +NM +    +WP  D   +    FKV        C S + +  +Q  F++ ++++DY L+        WPN  S  S+   L+  I  +  +  GP++V DE+G   AG F A+++L+HQL K++ V+VY V KMI++ RP  F+      F+Y+++
Sbjct:  988 GYNRPKAYIAAQGPLKSTAEDFWRMIWEHNVEVIVMITNLVEKGRRKCDQYWPADGSEEYGNFLVTQKSVQVLAYYTVRNFTLRNTKIKKGSQKGRPSGRVVTQYHYTQWPDMGVPEYSLPVLTFVRKAAYAKRHAVGPVVVHCSAGVGRTGTYIVLDSMLQQIQHEGTVNIFGFLKHIRSQRNYLVQTEEQYVFIHDTLVEAILSKETEVLDSHIHAYVNALLIPGPAGKTKLEKQFQLLSQSNIQQSDYSAALKQCNREKNRTSSIIPVERSRVGISSLSG-EGTDYINASYIMGYYQSNEFIITQHPLLHTIKDFWRMIWDHNAQLVVMIPDGQNMAEDEFVYWPNKD-EPINCESFKVTLMAEEHKCLSNEEKLIIQ-DFILEATQDDYVLEVRHFQCPKWPNPDSPISKTFELISVIKEEAANRDGPMIVHDEHGGVTAGTFCALTTLMHQLEKENSVDVYQVAKMINLMRPGVFADIEQYQFLYKVI 1477          

HSP 2 Score: 90.8929 bits (224), Expect = 6.396e-18
Identity = 66/258 (25.58%), Postives = 123/258 (47.67%), Query Frame = 3
Query:  864 KNRSDTIMPIESRRINLS--CEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSN------ENMHQFWPGP-----DNNALTFRWFKVHCNSEKTEFSVQYSFLISSSREDYALD--CTMHCLKYWPNT-VSECSELLRLLFDINSKKYS-----GPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELL-------EFVILNQHLYTF 1553
            KNR   I+  +  R+ L+   E   + ++YINA+ + GY + K +I  Q PL  T +DFW+M+W+ N  +I++++N          Q+WP        N  +T +  +V        F+++ + +   S++        T +    WP+  V E S  L +L  +    Y+     GP+VV    G  R G ++ + S+L Q++ +  VN++  +K I  +R Y   +    +FI++ L       E  +L+ H++ +
Sbjct:  951 KNRYINIVAYDHSRVKLAQLAEKDGKLTDYINANYVDGYNRPKAYIAAQGPLKSTAEDFWRMIWEHNVEVIVMITNLVEKGRRKCDQYWPADGSEEYGNFLVTQKSVQVLAYYTVRNFTLRNTKIKKGSQKGRPSGRVVTQYHYTQWPDMGVPEYS--LPVLTFVRKAAYAKRHAVGPVVVHCSAGVGRTGTYIVLDSMLQQIQHEGTVNIFGFLKHIRSQRNYLVQTEEQYVFIHDTLVEAILSKETEVLDSHIHAY 1206          
BLAST of Receptor type tyrosine protein phosphatase zeta vs. Ensembl Human
Match: PTPRZ1 (protein tyrosine phosphatase receptor type Z1 [Source:HGNC Symbol;Acc:HGNC:9685])

HSP 1 Score: 375.941 bits (964), Expect = 1.519e-111
Identity = 204/493 (41.38%), Postives = 293/493 (59.43%), Query Frame = 3
Query:   96 GFKRPYAYIATQGPLTETVADFWQMVWEQNSEIIVMISNFVERGRSKCEIYWSPNKTLNCGNISVHQIYQKEMAFYTERAFRIRNIRLKKNIKD-----RTVYHYQYTDWRDFDXXXXXXXXXXFVRATTKHWSESSGPIIVHCSAGVGRTGTYICIESQIRQLDQEHHINVRGFLEHIRQQRMKLVQTESQYTFIHDALYEYYLYPDREIHKLELSIYISKLKEFDASGCMKLDTQFKKCINFEPSDYDYMESKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSN-ENMHQ----FWPGPDNNALTFRWFKV-------HCNSEKTEFSVQYSFLISSSREDYALDCTMHCLKYWPNTVSECSELLRLLFDINSKKYS--GPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELL 1517
            G+ RP AYIA QGPL  T  DFW+M+WE N E+IVMI+N VE+GR KC+ YW  + +   GN  V Q   + +A+YT R F +RN ++KK  +      R V  Y YT W D  VP  SLPVL FVR        + GP++VHCSAGVGRTGTYI ++S ++Q+  E  +N+ GFL+HIR QR  LVQTE QY FIHD L E  L  + E+    +  Y++ L     +G  KL+ QF+          DY  + K+ N  KNR+ +I+P+E  R+ +S   G EG++YINAS I GY+Q  EFIITQHPL  T +DFW+M+WD N  L++++ + +NM +    +WP  D   +    FKV        C S + +  +Q  F++ ++++DY L+        WPN  S  S+   L+  I  +  +  GP++V DE+G   AG F A+++L+HQL K++ V+VY V KMI++ RP  F+      F+Y+++
Sbjct: 1783 GYNRPKAYIAAQGPLKSTAEDFWRMIWEHNVEVIVMITNLVEKGRRKCDQYWPADGSEEYGNFLVTQKSVQVLAYYTVRNFTLRNTKIKKGSQKGRPSGRVVTQYHYTQWPDMGVPEYSLPVLTFVRKAAYAKRHAVGPVVVHCSAGVGRTGTYIVLDSMLQQIQHEGTVNIFGFLKHIRSQRNYLVQTEEQYVFIHDTLVEAILSKETEVLDSHIHAYVNALLIPGPAGKTKLEKQFQLLSQSNIQQSDYSAALKQCNREKNRTSSIIPVERSRVGISSLSG-EGTDYINASYIMGYYQSNEFIITQHPLLHTIKDFWRMIWDHNAQLVVMIPDGQNMAEDEFVYWPNKD-EPINCESFKVTLMAEEHKCLSNEEKLIIQ-DFILEATQDDYVLEVRHFQCPKWPNPDSPISKTFELISVIKEEAANRDGPMIVHDEHGGVTAGTFCALTTLMHQLEKENSVDVYQVAKMINLMRPGVFADIEQYQFLYKVI 2272          

HSP 2 Score: 89.7373 bits (221), Expect = 1.373e-17
Identity = 66/258 (25.58%), Postives = 123/258 (47.67%), Query Frame = 3
Query:  864 KNRSDTIMPIESRRINLS--CEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSN------ENMHQFWPGP-----DNNALTFRWFKVHCNSEKTEFSVQYSFLISSSREDYALD--CTMHCLKYWPNT-VSECSELLRLLFDINSKKYS-----GPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELL-------EFVILNQHLYTF 1553
            KNR   I+  +  R+ L+   E   + ++YINA+ + GY + K +I  Q PL  T +DFW+M+W+ N  +I++++N          Q+WP        N  +T +  +V        F+++ + +   S++        T +    WP+  V E S  L +L  +    Y+     GP+VV    G  R G ++ + S+L Q++ +  VN++  +K I  +R Y   +    +FI++ L       E  +L+ H++ +
Sbjct: 1746 KNRYINIVAYDHSRVKLAQLAEKDGKLTDYINANYVDGYNRPKAYIAAQGPLKSTAEDFWRMIWEHNVEVIVMITNLVEKGRRKCDQYWPADGSEEYGNFLVTQKSVQVLAYYTVRNFTLRNTKIKKGSQKGRPSGRVVTQYHYTQWPDMGVPEYS--LPVLTFVRKAAYAKRHAVGPVVVHCSAGVGRTGTYIVLDSMLQQIQHEGTVNIFGFLKHIRSQRNYLVQTEEQYVFIHDTLVEAILSKETEVLDSHIHAY 2001          
BLAST of Receptor type tyrosine protein phosphatase zeta vs. Ensembl Human
Match: PTPRZ1 (protein tyrosine phosphatase receptor type Z1 [Source:HGNC Symbol;Acc:HGNC:9685])

HSP 1 Score: 375.941 bits (964), Expect = 1.536e-111
Identity = 204/493 (41.38%), Postives = 293/493 (59.43%), Query Frame = 3
Query:   96 GFKRPYAYIATQGPLTETVADFWQMVWEQNSEIIVMISNFVERGRSKCEIYWSPNKTLNCGNISVHQIYQKEMAFYTERAFRIRNIRLKKNIKD-----RTVYHYQYTDWRDFDXXXXXXXXXXFVRATTKHWSESSGPIIVHCSAGVGRTGTYICIESQIRQLDQEHHINVRGFLEHIRQQRMKLVQTESQYTFIHDALYEYYLYPDREIHKLELSIYISKLKEFDASGCMKLDTQFKKCINFEPSDYDYMESKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSN-ENMHQ----FWPGPDNNALTFRWFKV-------HCNSEKTEFSVQYSFLISSSREDYALDCTMHCLKYWPNTVSECSELLRLLFDINSKKYS--GPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELL 1517
            G+ RP AYIA QGPL  T  DFW+M+WE N E+IVMI+N VE+GR KC+ YW  + +   GN  V Q   + +A+YT R F +RN ++KK  +      R V  Y YT W D  VP  SLPVL FVR        + GP++VHCSAGVGRTGTYI ++S ++Q+  E  +N+ GFL+HIR QR  LVQTE QY FIHD L E  L  + E+    +  Y++ L     +G  KL+ QF+          DY  + K+ N  KNR+ +I+P+E  R+ +S   G EG++YINAS I GY+Q  EFIITQHPL  T +DFW+M+WD N  L++++ + +NM +    +WP  D   +    FKV        C S + +  +Q  F++ ++++DY L+        WPN  S  S+   L+  I  +  +  GP++V DE+G   AG F A+++L+HQL K++ V+VY V KMI++ RP  F+      F+Y+++
Sbjct: 1790 GYNRPKAYIAAQGPLKSTAEDFWRMIWEHNVEVIVMITNLVEKGRRKCDQYWPADGSEEYGNFLVTQKSVQVLAYYTVRNFTLRNTKIKKGSQKGRPSGRVVTQYHYTQWPDMGVPEYSLPVLTFVRKAAYAKRHAVGPVVVHCSAGVGRTGTYIVLDSMLQQIQHEGTVNIFGFLKHIRSQRNYLVQTEEQYVFIHDTLVEAILSKETEVLDSHIHAYVNALLIPGPAGKTKLEKQFQLLSQSNIQQSDYSAALKQCNREKNRTSSIIPVERSRVGISSLSG-EGTDYINASYIMGYYQSNEFIITQHPLLHTIKDFWRMIWDHNAQLVVMIPDGQNMAEDEFVYWPNKD-EPINCESFKVTLMAEEHKCLSNEEKLIIQ-DFILEATQDDYVLEVRHFQCPKWPNPDSPISKTFELISVIKEEAANRDGPMIVHDEHGGVTAGTFCALTTLMHQLEKENSVDVYQVAKMINLMRPGVFADIEQYQFLYKVI 2279          

HSP 2 Score: 90.1225 bits (222), Expect = 1.262e-17
Identity = 66/258 (25.58%), Postives = 123/258 (47.67%), Query Frame = 3
Query:  864 KNRSDTIMPIESRRINLS--CEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSN------ENMHQFWPGP-----DNNALTFRWFKVHCNSEKTEFSVQYSFLISSSREDYALD--CTMHCLKYWPNT-VSECSELLRLLFDINSKKYS-----GPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELL-------EFVILNQHLYTF 1553
            KNR   I+  +  R+ L+   E   + ++YINA+ + GY + K +I  Q PL  T +DFW+M+W+ N  +I++++N          Q+WP        N  +T +  +V        F+++ + +   S++        T +    WP+  V E S  L +L  +    Y+     GP+VV    G  R G ++ + S+L Q++ +  VN++  +K I  +R Y   +    +FI++ L       E  +L+ H++ +
Sbjct: 1753 KNRYINIVAYDHSRVKLAQLAEKDGKLTDYINANYVDGYNRPKAYIAAQGPLKSTAEDFWRMIWEHNVEVIVMITNLVEKGRRKCDQYWPADGSEEYGNFLVTQKSVQVLAYYTVRNFTLRNTKIKKGSQKGRPSGRVVTQYHYTQWPDMGVPEYS--LPVLTFVRKAAYAKRHAVGPVVVHCSAGVGRTGTYIVLDSMLQQIQHEGTVNIFGFLKHIRSQRNYLVQTEEQYVFIHDTLVEAILSKETEVLDSHIHAY 2008          
BLAST of Receptor type tyrosine protein phosphatase zeta vs. Ensembl Human
Match: PTPRZ1 (protein tyrosine phosphatase receptor type Z1 [Source:HGNC Symbol;Acc:HGNC:9685])

HSP 1 Score: 375.17 bits (962), Expect = 2.300e-111
Identity = 204/493 (41.38%), Postives = 293/493 (59.43%), Query Frame = 3
Query:   96 GFKRPYAYIATQGPLTETVADFWQMVWEQNSEIIVMISNFVERGRSKCEIYWSPNKTLNCGNISVHQIYQKEMAFYTERAFRIRNIRLKKNIKD-----RTVYHYQYTDWRDFDXXXXXXXXXXFVRATTKHWSESSGPIIVHCSAGVGRTGTYICIESQIRQLDQEHHINVRGFLEHIRQQRMKLVQTESQYTFIHDALYEYYLYPDREIHKLELSIYISKLKEFDASGCMKLDTQFKKCINFEPSDYDYMESKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSN-ENMHQ----FWPGPDNNALTFRWFKV-------HCNSEKTEFSVQYSFLISSSREDYALDCTMHCLKYWPNTVSECSELLRLLFDINSKKYS--GPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELL 1517
            G+ RP AYIA QGPL  T  DFW+M+WE N E+IVMI+N VE+GR KC+ YW  + +   GN  V Q   + +A+YT R F +RN ++KK  +      R V  Y YT W D  VP  SLPVL FVR        + GP++VHCSAGVGRTGTYI ++S ++Q+  E  +N+ GFL+HIR QR  LVQTE QY FIHD L E  L  + E+    +  Y++ L     +G  KL+ QF+          DY  + K+ N  KNR+ +I+P+E  R+ +S   G EG++YINAS I GY+Q  EFIITQHPL  T +DFW+M+WD N  L++++ + +NM +    +WP  D   +    FKV        C S + +  +Q  F++ ++++DY L+        WPN  S  S+   L+  I  +  +  GP++V DE+G   AG F A+++L+HQL K++ V+VY V KMI++ RP  F+      F+Y+++
Sbjct: 1534 GYNRPKAYIAAQGPLKSTAEDFWRMIWEHNVEVIVMITNLVEKGRRKCDQYWPADGSEEYGNFLVTQKSVQVLAYYTVRNFTLRNTKIKKGSQKGRPSGRVVTQYHYTQWPDMGVPEYSLPVLTFVRKAAYAKRHAVGPVVVHCSAGVGRTGTYIVLDSMLQQIQHEGTVNIFGFLKHIRSQRNYLVQTEEQYVFIHDTLVEAILSKETEVLDSHIHAYVNALLIPGPAGKTKLEKQFQLLSQSNIQQSDYSAALKQCNREKNRTSSIIPVERSRVGISSLSG-EGTDYINASYIMGYYQSNEFIITQHPLLHTIKDFWRMIWDHNAQLVVMIPDGQNMAEDEFVYWPNKD-EPINCESFKVTLMAEEHKCLSNEEKLIIQ-DFILEATQDDYVLEVRHFQCPKWPNPDSPISKTFELISVIKEEAANRDGPMIVHDEHGGVTAGTFCALTTLMHQLEKENSVDVYQVAKMINLMRPGVFADIEQYQFLYKVI 2023          

HSP 2 Score: 90.5077 bits (223), Expect = 9.700e-18
Identity = 66/258 (25.58%), Postives = 123/258 (47.67%), Query Frame = 3
Query:  864 KNRSDTIMPIESRRINLS--CEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSN------ENMHQFWPGP-----DNNALTFRWFKVHCNSEKTEFSVQYSFLISSSREDYALD--CTMHCLKYWPNT-VSECSELLRLLFDINSKKYS-----GPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELL-------EFVILNQHLYTF 1553
            KNR   I+  +  R+ L+   E   + ++YINA+ + GY + K +I  Q PL  T +DFW+M+W+ N  +I++++N          Q+WP        N  +T +  +V        F+++ + +   S++        T +    WP+  V E S  L +L  +    Y+     GP+VV    G  R G ++ + S+L Q++ +  VN++  +K I  +R Y   +    +FI++ L       E  +L+ H++ +
Sbjct: 1497 KNRYINIVAYDHSRVKLAQLAEKDGKLTDYINANYVDGYNRPKAYIAAQGPLKSTAEDFWRMIWEHNVEVIVMITNLVEKGRRKCDQYWPADGSEEYGNFLVTQKSVQVLAYYTVRNFTLRNTKIKKGSQKGRPSGRVVTQYHYTQWPDMGVPEYS--LPVLTFVRKAAYAKRHAVGPVVVHCSAGVGRTGTYIVLDSMLQQIQHEGTVNIFGFLKHIRSQRNYLVQTEEQYVFIHDTLVEAILSKETEVLDSHIHAY 1752          
BLAST of Receptor type tyrosine protein phosphatase zeta vs. Ensembl Celegans
Match: ptp-3 (Tyrosine-protein phosphatase Lar-like [Source:UniProtKB/Swiss-Prot;Acc:Q9BMN8])

HSP 1 Score: 246.514 bits (628), Expect = 8.172e-69
Identity = 149/483 (30.85%), Postives = 237/483 (49.07%), Query Frame = 3
Query:   96 GFKRPYAYIATQGPLTETVADFWQMVWEQNSEIIVMISNFVERGRSKCEIYWSPNKTLNCGNISVHQIYQKEMAFYTERAFRIRNIRLKKNIKDRTVYHYQYTDWRDFDXXXXXXXXXXFVRATTKHWSESSGPIIVHCSAGVGRTGTYICIESQIRQLDQEHHINVRGFLEHIRQQRMKLVQTESQYTFIHDALYEYYLYPDREIHKLELSIYISKLKEFDASGCMKLDTQFKKCINFEPSDYDYMESKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILL------SNENMHQFWPGPDNNALTFRWFKVHCNSEKTEFSVQYSFLISSSREDYALDCTMHCLKYWPNTVSE--CSELLRLLFDINSK----KYSGPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIY 1508
            G+ +P +YIATQGPL ET +DFW+MVWE+ S  IVM++N  ER R KC+ YW    T   G+I V  +    +A YT R  R++ +      + R + H QYT W D  VP    P L+F++         +GPII HCSAG+GRTG +I I+  + +L  ++ +++ G +  +R QR  +VQTE QY FIHDA+ +       E+    L  ++  L +  A     +D +F+     + +      +    N  KNR  + +P +S R+ +   PG +GS+YINAS I GY +   +I TQ P +ET  DFW+ +W+ N  +I +L        E    +WP      +     +     +   + ++  F IS                 WP+          L  +  +++       +GPI V    G+ R  +F+A+S +L ++R + VV+V+  +K++  ER           F+Y
Sbjct:  591 GYDKPRSYIATQGPLPETFSDFWRMVWEEQSVTIVMLTNLEERSRVKCDQYWPSRGTATYGDIEVTLLESVHLAHYTMRTMRLKMV---GEPEVREIKHLQYTAWPDHGVPDHPTPFLIFLKRVKTLNPNDAGPIISHCSAGIGRTGAFIVIDCMLERLRYDNTVDIYGCVTALRAQRSYMVQTEEQYIFIHDAVLDAVNSGSTEVPASRLHQHLHILSQPSADQLSGIDMEFRHLTTLKWTSNRCTVANLPVNRPKNRMLSAVPYDSNRVIMRLLPGADGSDYINASWIDGYKERGAYIATQAPTNETAADFWRAIWEHNSPIIAMLVRTNERGQEQCSDYWPLETGVQVGMLVVEPMAEYDMKHYHLR-EFRISDINTREVRTVRQFHFMEWPDVGKPHTADHFLDFVTQVHNTYAQFGCTGPITVHCCSGAGRTAVFIALSIILDRMRAEHVVDVFTTVKLLRTERQNMIQEPEQYHFLY 1069          

HSP 2 Score: 132.109 bits (331), Expect = 2.820e-31
Identity = 70/200 (35.00%), Postives = 109/200 (54.50%), Query Frame = 3
Query:   96 GFKRPYAYIATQGPLTETVADFWQMVWEQNSEIIVMISNFVERGRSKCEIYWSPNKTLNCGNISVHQIYQKEMAFYTERAFRIRNIRLKKNIKDRTVYHYQYTDWRDFDXXXXXXXXXXFVRATTKHWSE--SSGPIIVHCSAGVGRTGTYICIESQIRQLDQEHHINVRGFLEHIRQQRMKLVQTESQYTFIHDALYEY 689
            G+K   AYIATQ P  ET ADFW+ +WE NS II M+    ERG+ +C  YW     +  G + V  + + +M  Y  R FRI +I  ++    RTV  + + +W D   P ++   L FV      +++   +GPI VHC +G GRT  +I +   + ++  EH ++V   ++ +R +R  ++Q   QY F++ A YEY
Sbjct:  879 GYKERGAYIATQAPTNETAADFWRAIWEHNSPIIAMLVRTNERGQEQCSDYWPLETGVQVGMLVVEPMAEYDMKHYHLREFRISDINTREV---RTVRQFHFMEWPDVGKPHTADHFLDFVTQVHNTYAQFGCTGPITVHCCSGAGRTAVFIALSIILDRMRAEHVVDVFTTVKLLRTERQNMIQEPEQYHFLYLAAYEY 1075          

HSP 3 Score: 86.6557 bits (213), Expect = 3.575e-17
Identity = 71/282 (25.18%), Postives = 127/282 (45.04%), Query Frame = 3
Query:  723 ELSIYISKLKEFDASGCMKLDTQFKKCINFEPSDYDYMESKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSN------ENMHQFWPGPDNNALTFRWFKVHCNSEKTEF-SVQYS-FLISSSREDYALDCTMHCLKY-----WPNTVSECSELLRLLFDINSKKY----SGPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELL 1517
            EL+ +I +L+  + +G     ++F+     +   + +  S    N  KNR   +   +  R+ LS   G  G +YINA+ + GY + + +I TQ PL ET  DFW+MVW+E    I++L+N          Q+WP         R    + + E T   SV  + + + + R     +  +  +K+     WP+          L+F    K      +GPI+     G  R G F+ +  +L +LR D+ V++Y  +  +  +R Y   +    +FI++ +
Sbjct:  514 ELANHIERLRMNNNAG---FQSEFESIETGQ--HFTWEHSSADMNKHKNRYANVAAYDHSRVVLSNVEGYPGMDYINANYVDGYDKPRSYIATQGPLPETFSDFWRMVWEEQSVTIVMLTNLEERSRVKCDQYWPS--------RGTATYGDIEVTLLESVHLAHYTMRTMRLKMVGEPEVREIKHLQYTAWPDHGVPDHPTPFLIFLKRVKTLNPNDAGPIISHCSAGIGRTGAFIVIDCMLERLRYDNTVDIYGCVTALRAQRSYMVQTEEQYIFIHDAV 782          
BLAST of Receptor type tyrosine protein phosphatase zeta vs. Ensembl Celegans
Match: ptp-3 (Tyrosine-protein phosphatase Lar-like [Source:UniProtKB/Swiss-Prot;Acc:Q9BMN8])

HSP 1 Score: 246.514 bits (628), Expect = 1.775e-68
Identity = 149/483 (30.85%), Postives = 237/483 (49.07%), Query Frame = 3
Query:   96 GFKRPYAYIATQGPLTETVADFWQMVWEQNSEIIVMISNFVERGRSKCEIYWSPNKTLNCGNISVHQIYQKEMAFYTERAFRIRNIRLKKNIKDRTVYHYQYTDWRDFDXXXXXXXXXXFVRATTKHWSESSGPIIVHCSAGVGRTGTYICIESQIRQLDQEHHINVRGFLEHIRQQRMKLVQTESQYTFIHDALYEYYLYPDREIHKLELSIYISKLKEFDASGCMKLDTQFKKCINFEPSDYDYMESKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILL------SNENMHQFWPGPDNNALTFRWFKVHCNSEKTEFSVQYSFLISSSREDYALDCTMHCLKYWPNTVSE--CSELLRLLFDINSK----KYSGPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIY 1508
            G+ +P +YIATQGPL ET +DFW+MVWE+ S  IVM++N  ER R KC+ YW    T   G+I V  +    +A YT R  R++ +      + R + H QYT W D  VP    P L+F++         +GPII HCSAG+GRTG +I I+  + +L  ++ +++ G +  +R QR  +VQTE QY FIHDA+ +       E+    L  ++  L +  A     +D +F+     + +      +    N  KNR  + +P +S R+ +   PG +GS+YINAS I GY +   +I TQ P +ET  DFW+ +W+ N  +I +L        E    +WP      +     +     +   + ++  F IS                 WP+          L  +  +++       +GPI V    G+ R  +F+A+S +L ++R + VV+V+  +K++  ER           F+Y
Sbjct:  724 GYDKPRSYIATQGPLPETFSDFWRMVWEEQSVTIVMLTNLEERSRVKCDQYWPSRGTATYGDIEVTLLESVHLAHYTMRTMRLKMV---GEPEVREIKHLQYTAWPDHGVPDHPTPFLIFLKRVKTLNPNDAGPIISHCSAGIGRTGAFIVIDCMLERLRYDNTVDIYGCVTALRAQRSYMVQTEEQYIFIHDAVLDAVNSGSTEVPASRLHQHLHILSQPSADQLSGIDMEFRHLTTLKWTSNRCTVANLPVNRPKNRMLSAVPYDSNRVIMRLLPGADGSDYINASWIDGYKERGAYIATQAPTNETAADFWRAIWEHNSPIIAMLVRTNERGQEQCSDYWPLETGVQVGMLVVEPMAEYDMKHYHLR-EFRISDINTREVRTVRQFHFMEWPDVGKPHTADHFLDFVTQVHNTYAQFGCTGPITVHCCSGAGRTAVFIALSIILDRMRAEHVVDVFTTVKLLRTERQNMIQEPEQYHFLY 1202          

HSP 2 Score: 132.109 bits (331), Expect = 3.174e-31
Identity = 70/200 (35.00%), Postives = 109/200 (54.50%), Query Frame = 3
Query:   96 GFKRPYAYIATQGPLTETVADFWQMVWEQNSEIIVMISNFVERGRSKCEIYWSPNKTLNCGNISVHQIYQKEMAFYTERAFRIRNIRLKKNIKDRTVYHYQYTDWRDFDXXXXXXXXXXFVRATTKHWSE--SSGPIIVHCSAGVGRTGTYICIESQIRQLDQEHHINVRGFLEHIRQQRMKLVQTESQYTFIHDALYEY 689
            G+K   AYIATQ P  ET ADFW+ +WE NS II M+    ERG+ +C  YW     +  G + V  + + +M  Y  R FRI +I  ++    RTV  + + +W D   P ++   L FV      +++   +GPI VHC +G GRT  +I +   + ++  EH ++V   ++ +R +R  ++Q   QY F++ A YEY
Sbjct: 1012 GYKERGAYIATQAPTNETAADFWRAIWEHNSPIIAMLVRTNERGQEQCSDYWPLETGVQVGMLVVEPMAEYDMKHYHLREFRISDINTREV---RTVRQFHFMEWPDVGKPHTADHFLDFVTQVHNTYAQFGCTGPITVHCCSGAGRTAVFIALSIILDRMRAEHVVDVFTTVKLLRTERQNMIQEPEQYHFLYLAAYEY 1208          

HSP 3 Score: 86.2705 bits (212), Expect = 4.912e-17
Identity = 71/282 (25.18%), Postives = 127/282 (45.04%), Query Frame = 3
Query:  723 ELSIYISKLKEFDASGCMKLDTQFKKCINFEPSDYDYMESKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSN------ENMHQFWPGPDNNALTFRWFKVHCNSEKTEF-SVQYS-FLISSSREDYALDCTMHCLKY-----WPNTVSECSELLRLLFDINSKKY----SGPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELL 1517
            EL+ +I +L+  + +G     ++F+     +   + +  S    N  KNR   +   +  R+ LS   G  G +YINA+ + GY + + +I TQ PL ET  DFW+MVW+E    I++L+N          Q+WP         R    + + E T   SV  + + + + R     +  +  +K+     WP+          L+F    K      +GPI+     G  R G F+ +  +L +LR D+ V++Y  +  +  +R Y   +    +FI++ +
Sbjct:  647 ELANHIERLRMNNNAG---FQSEFESIETGQ--HFTWEHSSADMNKHKNRYANVAAYDHSRVVLSNVEGYPGMDYINANYVDGYDKPRSYIATQGPLPETFSDFWRMVWEEQSVTIVMLTNLEERSRVKCDQYWPS--------RGTATYGDIEVTLLESVHLAHYTMRTMRLKMVGEPEVREIKHLQYTAWPDHGVPDHPTPFLIFLKRVKTLNPNDAGPIISHCSAGIGRTGAFIVIDCMLERLRYDNTVDIYGCVTALRAQRSYMVQTEEQYIFIHDAV 915          
BLAST of Receptor type tyrosine protein phosphatase zeta vs. Ensembl Celegans
Match: ptp-3 (Tyrosine-protein phosphatase Lar-like [Source:UniProtKB/Swiss-Prot;Acc:Q9BMN8])

HSP 1 Score: 246.514 bits (628), Expect = 2.185e-68
Identity = 149/483 (30.85%), Postives = 237/483 (49.07%), Query Frame = 3
Query:   96 GFKRPYAYIATQGPLTETVADFWQMVWEQNSEIIVMISNFVERGRSKCEIYWSPNKTLNCGNISVHQIYQKEMAFYTERAFRIRNIRLKKNIKDRTVYHYQYTDWRDFDXXXXXXXXXXFVRATTKHWSESSGPIIVHCSAGVGRTGTYICIESQIRQLDQEHHINVRGFLEHIRQQRMKLVQTESQYTFIHDALYEYYLYPDREIHKLELSIYISKLKEFDASGCMKLDTQFKKCINFEPSDYDYMESKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILL------SNENMHQFWPGPDNNALTFRWFKVHCNSEKTEFSVQYSFLISSSREDYALDCTMHCLKYWPNTVSE--CSELLRLLFDINSK----KYSGPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIY 1508
            G+ +P +YIATQGPL ET +DFW+MVWE+ S  IVM++N  ER R KC+ YW    T   G+I V  +    +A YT R  R++ +      + R + H QYT W D  VP    P L+F++         +GPII HCSAG+GRTG +I I+  + +L  ++ +++ G +  +R QR  +VQTE QY FIHDA+ +       E+    L  ++  L +  A     +D +F+     + +      +    N  KNR  + +P +S R+ +   PG +GS+YINAS I GY +   +I TQ P +ET  DFW+ +W+ N  +I +L        E    +WP      +     +     +   + ++  F IS                 WP+          L  +  +++       +GPI V    G+ R  +F+A+S +L ++R + VV+V+  +K++  ER           F+Y
Sbjct:  755 GYDKPRSYIATQGPLPETFSDFWRMVWEEQSVTIVMLTNLEERSRVKCDQYWPSRGTATYGDIEVTLLESVHLAHYTMRTMRLKMV---GEPEVREIKHLQYTAWPDHGVPDHPTPFLIFLKRVKTLNPNDAGPIISHCSAGIGRTGAFIVIDCMLERLRYDNTVDIYGCVTALRAQRSYMVQTEEQYIFIHDAVLDAVNSGSTEVPASRLHQHLHILSQPSADQLSGIDMEFRHLTTLKWTSNRCTVANLPVNRPKNRMLSAVPYDSNRVIMRLLPGADGSDYINASWIDGYKERGAYIATQAPTNETAADFWRAIWEHNSPIIAMLVRTNERGQEQCSDYWPLETGVQVGMLVVEPMAEYDMKHYHLR-EFRISDINTREVRTVRQFHFMEWPDVGKPHTADHFLDFVTQVHNTYAQFGCTGPITVHCCSGAGRTAVFIALSIILDRMRAEHVVDVFTTVKLLRTERQNMIQEPEQYHFLY 1233          

HSP 2 Score: 131.724 bits (330), Expect = 4.542e-31
Identity = 70/200 (35.00%), Postives = 109/200 (54.50%), Query Frame = 3
Query:   96 GFKRPYAYIATQGPLTETVADFWQMVWEQNSEIIVMISNFVERGRSKCEIYWSPNKTLNCGNISVHQIYQKEMAFYTERAFRIRNIRLKKNIKDRTVYHYQYTDWRDFDXXXXXXXXXXFVRATTKHWSE--SSGPIIVHCSAGVGRTGTYICIESQIRQLDQEHHINVRGFLEHIRQQRMKLVQTESQYTFIHDALYEY 689
            G+K   AYIATQ P  ET ADFW+ +WE NS II M+    ERG+ +C  YW     +  G + V  + + +M  Y  R FRI +I  ++    RTV  + + +W D   P ++   L FV      +++   +GPI VHC +G GRT  +I +   + ++  EH ++V   ++ +R +R  ++Q   QY F++ A YEY
Sbjct: 1043 GYKERGAYIATQAPTNETAADFWRAIWEHNSPIIAMLVRTNERGQEQCSDYWPLETGVQVGMLVVEPMAEYDMKHYHLREFRISDINTREV---RTVRQFHFMEWPDVGKPHTADHFLDFVTQVHNTYAQFGCTGPITVHCCSGAGRTAVFIALSIILDRMRAEHVVDVFTTVKLLRTERQNMIQEPEQYHFLYLAAYEY 1239          

HSP 3 Score: 87.0409 bits (214), Expect = 3.378e-17
Identity = 71/282 (25.18%), Postives = 127/282 (45.04%), Query Frame = 3
Query:  723 ELSIYISKLKEFDASGCMKLDTQFKKCINFEPSDYDYMESKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSN------ENMHQFWPGPDNNALTFRWFKVHCNSEKTEF-SVQYS-FLISSSREDYALDCTMHCLKY-----WPNTVSECSELLRLLFDINSKKY----SGPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELL 1517
            EL+ +I +L+  + +G     ++F+     +   + +  S    N  KNR   +   +  R+ LS   G  G +YINA+ + GY + + +I TQ PL ET  DFW+MVW+E    I++L+N          Q+WP         R    + + E T   SV  + + + + R     +  +  +K+     WP+          L+F    K      +GPI+     G  R G F+ +  +L +LR D+ V++Y  +  +  +R Y   +    +FI++ +
Sbjct:  678 ELANHIERLRMNNNAG---FQSEFESIETGQ--HFTWEHSSADMNKHKNRYANVAAYDHSRVVLSNVEGYPGMDYINANYVDGYDKPRSYIATQGPLPETFSDFWRMVWEEQSVTIVMLTNLEERSRVKCDQYWPS--------RGTATYGDIEVTLLESVHLAHYTMRTMRLKMVGEPEVREIKHLQYTAWPDHGVPDHPTPFLIFLKRVKTLNPNDAGPIISHCSAGIGRTGAFIVIDCMLERLRYDNTVDIYGCVTALRAQRSYMVQTEEQYIFIHDAV 946          
BLAST of Receptor type tyrosine protein phosphatase zeta vs. Ensembl Celegans
Match: ptp-3 (Tyrosine-protein phosphatase Lar-like [Source:UniProtKB/Swiss-Prot;Acc:Q9BMN8])

HSP 1 Score: 245.743 bits (626), Expect = 4.800e-68
Identity = 149/483 (30.85%), Postives = 237/483 (49.07%), Query Frame = 3
Query:   96 GFKRPYAYIATQGPLTETVADFWQMVWEQNSEIIVMISNFVERGRSKCEIYWSPNKTLNCGNISVHQIYQKEMAFYTERAFRIRNIRLKKNIKDRTVYHYQYTDWRDFDXXXXXXXXXXFVRATTKHWSESSGPIIVHCSAGVGRTGTYICIESQIRQLDQEHHINVRGFLEHIRQQRMKLVQTESQYTFIHDALYEYYLYPDREIHKLELSIYISKLKEFDASGCMKLDTQFKKCINFEPSDYDYMESKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILL------SNENMHQFWPGPDNNALTFRWFKVHCNSEKTEFSVQYSFLISSSREDYALDCTMHCLKYWPNTVSE--CSELLRLLFDINSK----KYSGPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIY 1508
            G+ +P +YIATQGPL ET +DFW+MVWE+ S  IVM++N  ER R KC+ YW    T   G+I V  +    +A YT R  R++ +      + R + H QYT W D  VP    P L+F++         +GPII HCSAG+GRTG +I I+  + +L  ++ +++ G +  +R QR  +VQTE QY FIHDA+ +       E+    L  ++  L +  A     +D +F+     + +      +    N  KNR  + +P +S R+ +   PG +GS+YINAS I GY +   +I TQ P +ET  DFW+ +W+ N  +I +L        E    +WP      +     +     +   + ++  F IS                 WP+          L  +  +++       +GPI V    G+ R  +F+A+S +L ++R + VV+V+  +K++  ER           F+Y
Sbjct:  975 GYDKPRSYIATQGPLPETFSDFWRMVWEEQSVTIVMLTNLEERSRVKCDQYWPSRGTATYGDIEVTLLESVHLAHYTMRTMRLKMV---GEPEVREIKHLQYTAWPDHGVPDHPTPFLIFLKRVKTLNPNDAGPIISHCSAGIGRTGAFIVIDCMLERLRYDNTVDIYGCVTALRAQRSYMVQTEEQYIFIHDAVLDAVNSGSTEVPASRLHQHLHILSQPSADQLSGIDMEFRHLTTLKWTSNRCTVANLPVNRPKNRMLSAVPYDSNRVIMRLLPGADGSDYINASWIDGYKERGAYIATQAPTNETAADFWRAIWEHNSPIIAMLVRTNERGQEQCSDYWPLETGVQVGMLVVEPMAEYDMKHYHLR-EFRISDINTREVRTVRQFHFMEWPDVGKPHTADHFLDFVTQVHNTYAQFGCTGPITVHCCSGAGRTAVFIALSIILDRMRAEHVVDVFTTVKLLRTERQNMIQEPEQYHFLY 1453          

HSP 2 Score: 132.109 bits (331), Expect = 3.759e-31
Identity = 70/200 (35.00%), Postives = 109/200 (54.50%), Query Frame = 3
Query:   96 GFKRPYAYIATQGPLTETVADFWQMVWEQNSEIIVMISNFVERGRSKCEIYWSPNKTLNCGNISVHQIYQKEMAFYTERAFRIRNIRLKKNIKDRTVYHYQYTDWRDFDXXXXXXXXXXFVRATTKHWSE--SSGPIIVHCSAGVGRTGTYICIESQIRQLDQEHHINVRGFLEHIRQQRMKLVQTESQYTFIHDALYEY 689
            G+K   AYIATQ P  ET ADFW+ +WE NS II M+    ERG+ +C  YW     +  G + V  + + +M  Y  R FRI +I  ++    RTV  + + +W D   P ++   L FV      +++   +GPI VHC +G GRT  +I +   + ++  EH ++V   ++ +R +R  ++Q   QY F++ A YEY
Sbjct: 1263 GYKERGAYIATQAPTNETAADFWRAIWEHNSPIIAMLVRTNERGQEQCSDYWPLETGVQVGMLVVEPMAEYDMKHYHLREFRISDINTREV---RTVRQFHFMEWPDVGKPHTADHFLDFVTQVHNTYAQFGCTGPITVHCCSGAGRTAVFIALSIILDRMRAEHVVDVFTTVKLLRTERQNMIQEPEQYHFLYLAAYEY 1459          

HSP 3 Score: 86.2705 bits (212), Expect = 6.738e-17
Identity = 71/282 (25.18%), Postives = 127/282 (45.04%), Query Frame = 3
Query:  723 ELSIYISKLKEFDASGCMKLDTQFKKCINFEPSDYDYMESKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSN------ENMHQFWPGPDNNALTFRWFKVHCNSEKTEF-SVQYS-FLISSSREDYALDCTMHCLKY-----WPNTVSECSELLRLLFDINSKKY----SGPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELL 1517
            EL+ +I +L+  + +G     ++F+     +   + +  S    N  KNR   +   +  R+ LS   G  G +YINA+ + GY + + +I TQ PL ET  DFW+MVW+E    I++L+N          Q+WP         R    + + E T   SV  + + + + R     +  +  +K+     WP+          L+F    K      +GPI+     G  R G F+ +  +L +LR D+ V++Y  +  +  +R Y   +    +FI++ +
Sbjct:  898 ELANHIERLRMNNNAG---FQSEFESIETGQ--HFTWEHSSADMNKHKNRYANVAAYDHSRVVLSNVEGYPGMDYINANYVDGYDKPRSYIATQGPLPETFSDFWRMVWEEQSVTIVMLTNLEERSRVKCDQYWPS--------RGTATYGDIEVTLLESVHLAHYTMRTMRLKMVGEPEVREIKHLQYTAWPDHGVPDHPTPFLIFLKRVKTLNPNDAGPIISHCSAGIGRTGAFIVIDCMLERLRYDNTVDIYGCVTALRAQRSYMVQTEEQYIFIHDAV 1166          
BLAST of Receptor type tyrosine protein phosphatase zeta vs. Ensembl Celegans
Match: ptp-3 (Tyrosine-protein phosphatase Lar-like [Source:UniProtKB/Swiss-Prot;Acc:Q9BMN8])

HSP 1 Score: 245.743 bits (626), Expect = 5.013e-68
Identity = 149/483 (30.85%), Postives = 237/483 (49.07%), Query Frame = 3
Query:   96 GFKRPYAYIATQGPLTETVADFWQMVWEQNSEIIVMISNFVERGRSKCEIYWSPNKTLNCGNISVHQIYQKEMAFYTERAFRIRNIRLKKNIKDRTVYHYQYTDWRDFDXXXXXXXXXXFVRATTKHWSESSGPIIVHCSAGVGRTGTYICIESQIRQLDQEHHINVRGFLEHIRQQRMKLVQTESQYTFIHDALYEYYLYPDREIHKLELSIYISKLKEFDASGCMKLDTQFKKCINFEPSDYDYMESKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILL------SNENMHQFWPGPDNNALTFRWFKVHCNSEKTEFSVQYSFLISSSREDYALDCTMHCLKYWPNTVSE--CSELLRLLFDINSK----KYSGPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIY 1508
            G+ +P +YIATQGPL ET +DFW+MVWE+ S  IVM++N  ER R KC+ YW    T   G+I V  +    +A YT R  R++ +      + R + H QYT W D  VP    P L+F++         +GPII HCSAG+GRTG +I I+  + +L  ++ +++ G +  +R QR  +VQTE QY FIHDA+ +       E+    L  ++  L +  A     +D +F+     + +      +    N  KNR  + +P +S R+ +   PG +GS+YINAS I GY +   +I TQ P +ET  DFW+ +W+ N  +I +L        E    +WP      +     +     +   + ++  F IS                 WP+          L  +  +++       +GPI V    G+ R  +F+A+S +L ++R + VV+V+  +K++  ER           F+Y
Sbjct:  995 GYDKPRSYIATQGPLPETFSDFWRMVWEEQSVTIVMLTNLEERSRVKCDQYWPSRGTATYGDIEVTLLESVHLAHYTMRTMRLKMV---GEPEVREIKHLQYTAWPDHGVPDHPTPFLIFLKRVKTLNPNDAGPIISHCSAGIGRTGAFIVIDCMLERLRYDNTVDIYGCVTALRAQRSYMVQTEEQYIFIHDAVLDAVNSGSTEVPASRLHQHLHILSQPSADQLSGIDMEFRHLTTLKWTSNRCTVANLPVNRPKNRMLSAVPYDSNRVIMRLLPGADGSDYINASWIDGYKERGAYIATQAPTNETAADFWRAIWEHNSPIIAMLVRTNERGQEQCSDYWPLETGVQVGMLVVEPMAEYDMKHYHLR-EFRISDINTREVRTVRQFHFMEWPDVGKPHTADHFLDFVTQVHNTYAQFGCTGPITVHCCSGAGRTAVFIALSIILDRMRAEHVVDVFTTVKLLRTERQNMIQEPEQYHFLY 1473          

HSP 2 Score: 132.109 bits (331), Expect = 3.627e-31
Identity = 70/200 (35.00%), Postives = 109/200 (54.50%), Query Frame = 3
Query:   96 GFKRPYAYIATQGPLTETVADFWQMVWEQNSEIIVMISNFVERGRSKCEIYWSPNKTLNCGNISVHQIYQKEMAFYTERAFRIRNIRLKKNIKDRTVYHYQYTDWRDFDXXXXXXXXXXFVRATTKHWSE--SSGPIIVHCSAGVGRTGTYICIESQIRQLDQEHHINVRGFLEHIRQQRMKLVQTESQYTFIHDALYEY 689
            G+K   AYIATQ P  ET ADFW+ +WE NS II M+    ERG+ +C  YW     +  G + V  + + +M  Y  R FRI +I  ++    RTV  + + +W D   P ++   L FV      +++   +GPI VHC +G GRT  +I +   + ++  EH ++V   ++ +R +R  ++Q   QY F++ A YEY
Sbjct: 1283 GYKERGAYIATQAPTNETAADFWRAIWEHNSPIIAMLVRTNERGQEQCSDYWPLETGVQVGMLVVEPMAEYDMKHYHLREFRISDINTREV---RTVRQFHFMEWPDVGKPHTADHFLDFVTQVHNTYAQFGCTGPITVHCCSGAGRTAVFIALSIILDRMRAEHVVDVFTTVKLLRTERQNMIQEPEQYHFLYLAAYEY 1479          

HSP 3 Score: 85.8853 bits (211), Expect = 6.825e-17
Identity = 71/282 (25.18%), Postives = 127/282 (45.04%), Query Frame = 3
Query:  723 ELSIYISKLKEFDASGCMKLDTQFKKCINFEPSDYDYMESKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSN------ENMHQFWPGPDNNALTFRWFKVHCNSEKTEF-SVQYS-FLISSSREDYALDCTMHCLKY-----WPNTVSECSELLRLLFDINSKKY----SGPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELL 1517
            EL+ +I +L+  + +G     ++F+     +   + +  S    N  KNR   +   +  R+ LS   G  G +YINA+ + GY + + +I TQ PL ET  DFW+MVW+E    I++L+N          Q+WP         R    + + E T   SV  + + + + R     +  +  +K+     WP+          L+F    K      +GPI+     G  R G F+ +  +L +LR D+ V++Y  +  +  +R Y   +    +FI++ +
Sbjct:  918 ELANHIERLRMNNNAG---FQSEFESIETGQ--HFTWEHSSADMNKHKNRYANVAAYDHSRVVLSNVEGYPGMDYINANYVDGYDKPRSYIATQGPLPETFSDFWRMVWEEQSVTIVMLTNLEERSRVKCDQYWPS--------RGTATYGDIEVTLLESVHLAHYTMRTMRLKMVGEPEVREIKHLQYTAWPDHGVPDHPTPFLIFLKRVKTLNPNDAGPIISHCSAGIGRTGAFIVIDCMLERLRYDNTVDIYGCVTALRAQRSYMVQTEEQYIFIHDAV 1186          
BLAST of Receptor type tyrosine protein phosphatase zeta vs. Ensembl Fly
Match: Ptp99A (gene:FBgn0004369 transcript:FBtr0303454)

HSP 1 Score: 343.199 bits (879), Expect = 1.580e-104
Identity = 195/493 (39.55%), Postives = 292/493 (59.23%), Query Frame = 3
Query:   96 GFKRPYAYIATQGPLTETVADFWQMVWEQNSEIIVMISNFVERGRSKCEIYWSPNKTLNCGNISVHQIYQKEMAFYTERAFRIRNIRLKKNIK---DRTVYHYQYTDWRDFDXXXXXXXXXXFVRATTKHWSESSGPIIVHCSAGVGRTGTYICIESQIRQLDQEHHINVRGFLEHIRQQRMKLVQTESQYTFIHDALYEYYLYPDREIHKLELSIYISKLKEFDASGCMK-LDTQFKKCINFEPSDYDYMESKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLS---NENMHQFWPGPDNNALTFRWFKVHCNSEKTEFSVQYSFLISSSREDYALDCTMHCLKYWPNTVSECSELLRLLFDINSK---KYSGPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELLEFVILNQHL 1544
            G+++ +A+I TQGPL +T   FW+M+WEQ   IIVMI+N VERGR KC++YW  +     G I V  I ++ M+ YT R  +I++++LKK  +   ++ VY Y YT+W D   P   LPVL FV+ ++      +GPI+VHCSAGVGRTGTYI +++ ++Q+ Q++ +NV GFL HIR QR  LVQTE QY F+HDAL E        I   E ++   +++E     C   L+ Q+K  I F+P D     + K+ N +KNR   I PIE  R++L+ +PG +GS+YINAS + G+ ++++FI+TQHP+  T +DFW+MVWD N   ++LLS   + N  QFWP       +  +     N       V   F+I S ++DY L   M     WP  +S  + +   + D++ +     +GPIV++D YG ++A  F A+SSL  ++      NVY   K+ H +RP  ++SS D+  IY +L F+  N +L
Sbjct:  166 GYQKGHAFIGTQGPLPDTFDCFWRMIWEQRVAIIVMITNLVERGRRKCDMYWPKDGVETYGVIQVKLIEEEVMSTYTVRTLQIKHLKLKKKKQCNTEKLVYQYHYTNWPDHGTPDHPLPVLNFVKKSSAANPAEAGPIVVHCSAGVGRTGTYIVLDAMLKQIQQKNIVNVFGFLRHIRAQRNFLVQTEEQYIFLHDALVE-------AIASGETNLMAEQVEEL--KNCTPYLEQQYKNIIQFQPKDIHIASAMKQVNSIKNRG-AIFPIEGSRVHLTPKPGEDGSDYINASWLHGFRRLRDFIVTQHPMAHTIKDFWQMVWDHNAQTVVLLSSLDDINFAQFWPDEATPIESDHYRVKFLNKTNKSDYVSRDFVIQSIQDDYELTVKMLHCPSWPE-MSNPNSIYDFIVDVHERCNDYRNGPIVIVDRYGGAQACTFCAISSLAIEMEYCSTANVYQYAKLYHNKRPGVWTSSEDIRVIYNILSFLPGNLNL 647          

HSP 2 Score: 87.0409 bits (214), Expect = 3.739e-17
Identity = 66/260 (25.38%), Postives = 124/260 (47.69%), Query Frame = 3
Query:  798 KCINFE-PSDYDYMESKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGS-NYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSN------ENMHQFWPGPDNNALTFRWFKVHCNSEK--TEFSVQYSFLISSSREDYALDCTMHCLKY------WPNTVSECSELLRLLFDINSKKY----SGPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELL 1517
            +CI+ + P ++      KR    KNR   I   +  R++L   PG + + +YINA+ I GY +   FI TQ PL +T   FW+M+W++  ++I++++N           +W  P +   T+   +V    E+  + ++V+ +  I   +      C    L Y      WP+  +    L  L F   S       +GPIVV    G  R G ++ + ++L Q+++ ++VNV+  ++ I  +R +   +    +F+++ L
Sbjct:  111 ECISDDLPCEHSQHPENKR----KNRYLNITAYDHSRVHLHPTPGQKKNLDYINANFIDGYQKGHAFIGTQGPLPDTFDCFWRMIWEQRVAIIVMITNLVERGRRKCDMYW--PKDGVETYGVIQVKLIEEEVMSTYTVR-TLQIKHLKLKKKKQCNTEKLVYQYHYTNWPDHGTPDHPLPVLNFVKKSSAANPAEAGPIVVHCSAGVGRTGTYIVLDAMLKQIQQKNIVNVFGFLRHIRAQRNFLVQTEEQYIFLHDAL 363          
BLAST of Receptor type tyrosine protein phosphatase zeta vs. Ensembl Fly
Match: Ptp99A (gene:FBgn0004369 transcript:FBtr0085422)

HSP 1 Score: 343.969 bits (881), Expect = 1.046e-102
Identity = 195/493 (39.55%), Postives = 292/493 (59.23%), Query Frame = 3
Query:   96 GFKRPYAYIATQGPLTETVADFWQMVWEQNSEIIVMISNFVERGRSKCEIYWSPNKTLNCGNISVHQIYQKEMAFYTERAFRIRNIRLKKNIK---DRTVYHYQYTDWRDFDXXXXXXXXXXFVRATTKHWSESSGPIIVHCSAGVGRTGTYICIESQIRQLDQEHHINVRGFLEHIRQQRMKLVQTESQYTFIHDALYEYYLYPDREIHKLELSIYISKLKEFDASGCMK-LDTQFKKCINFEPSDYDYMESKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLS---NENMHQFWPGPDNNALTFRWFKVHCNSEKTEFSVQYSFLISSSREDYALDCTMHCLKYWPNTVSECSELLRLLFDINSK---KYSGPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELLEFVILNQHL 1544
            G+++ +A+I TQGPL +T   FW+M+WEQ   IIVMI+N VERGR KC++YW  +     G I V  I ++ M+ YT R  +I++++LKK  +   ++ VY Y YT+W D   P   LPVL FV+ ++      +GPI+VHCSAGVGRTGTYI +++ ++Q+ Q++ +NV GFL HIR QR  LVQTE QY F+HDAL E        I   E ++   +++E     C   L+ Q+K  I F+P D     + K+ N +KNR   I PIE  R++L+ +PG +GS+YINAS + G+ ++++FI+TQHP+  T +DFW+MVWD N   ++LLS   + N  QFWP       +  +     N       V   F+I S ++DY L   M     WP  +S  + +   + D++ +     +GPIV++D YG ++A  F A+SSL  ++      NVY   K+ H +RP  ++SS D+  IY +L F+  N +L
Sbjct:  541 GYQKGHAFIGTQGPLPDTFDCFWRMIWEQRVAIIVMITNLVERGRRKCDMYWPKDGVETYGVIQVKLIEEEVMSTYTVRTLQIKHLKLKKKKQCNTEKLVYQYHYTNWPDHGTPDHPLPVLNFVKKSSAANPAEAGPIVVHCSAGVGRTGTYIVLDAMLKQIQQKNIVNVFGFLRHIRAQRNFLVQTEEQYIFLHDALVE-------AIASGETNLMAEQVEEL--KNCTPYLEQQYKNIIQFQPKDIHIASAMKQVNSIKNRG-AIFPIEGSRVHLTPKPGEDGSDYINASWLHGFRRLRDFIVTQHPMAHTIKDFWQMVWDHNAQTVVLLSSLDDINFAQFWPDEATPIESDHYRVKFLNKTNKSDYVSRDFVIQSIQDDYELTVKMLHCPSWPE-MSNPNSIYDFIVDVHERCNDYRNGPIVIVDRYGGAQACTFCAISSLAIEMEYCSTANVYQYAKLYHNKRPGVWTSSEDIRVIYNILSFLPGNLNL 1022          

HSP 2 Score: 87.0409 bits (214), Expect = 4.597e-17
Identity = 66/260 (25.38%), Postives = 124/260 (47.69%), Query Frame = 3
Query:  798 KCINFE-PSDYDYMESKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGS-NYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSN------ENMHQFWPGPDNNALTFRWFKVHCNSEK--TEFSVQYSFLISSSREDYALDCTMHCLKY------WPNTVSECSELLRLLFDINSKKY----SGPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELL 1517
            +CI+ + P ++      KR    KNR   I   +  R++L   PG + + +YINA+ I GY +   FI TQ PL +T   FW+M+W++  ++I++++N           +W  P +   T+   +V    E+  + ++V+ +  I   +      C    L Y      WP+  +    L  L F   S       +GPIVV    G  R G ++ + ++L Q+++ ++VNV+  ++ I  +R +   +    +F+++ L
Sbjct:  486 ECISDDLPCEHSQHPENKR----KNRYLNITAYDHSRVHLHPTPGQKKNLDYINANFIDGYQKGHAFIGTQGPLPDTFDCFWRMIWEQRVAIIVMITNLVERGRRKCDMYW--PKDGVETYGVIQVKLIEEEVMSTYTVR-TLQIKHLKLKKKKQCNTEKLVYQYHYTNWPDHGTPDHPLPVLNFVKKSSAANPAEAGPIVVHCSAGVGRTGTYIVLDAMLKQIQQKNIVNVFGFLRHIRAQRNFLVQTEEQYIFLHDAL 738          
BLAST of Receptor type tyrosine protein phosphatase zeta vs. Ensembl Fly
Match: Ptp99A (gene:FBgn0004369 transcript:FBtr0085424)

HSP 1 Score: 343.969 bits (881), Expect = 1.117e-102
Identity = 195/493 (39.55%), Postives = 292/493 (59.23%), Query Frame = 3
Query:   96 GFKRPYAYIATQGPLTETVADFWQMVWEQNSEIIVMISNFVERGRSKCEIYWSPNKTLNCGNISVHQIYQKEMAFYTERAFRIRNIRLKKNIK---DRTVYHYQYTDWRDFDXXXXXXXXXXFVRATTKHWSESSGPIIVHCSAGVGRTGTYICIESQIRQLDQEHHINVRGFLEHIRQQRMKLVQTESQYTFIHDALYEYYLYPDREIHKLELSIYISKLKEFDASGCMK-LDTQFKKCINFEPSDYDYMESKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLS---NENMHQFWPGPDNNALTFRWFKVHCNSEKTEFSVQYSFLISSSREDYALDCTMHCLKYWPNTVSECSELLRLLFDINSK---KYSGPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELLEFVILNQHL 1544
            G+++ +A+I TQGPL +T   FW+M+WEQ   IIVMI+N VERGR KC++YW  +     G I V  I ++ M+ YT R  +I++++LKK  +   ++ VY Y YT+W D   P   LPVL FV+ ++      +GPI+VHCSAGVGRTGTYI +++ ++Q+ Q++ +NV GFL HIR QR  LVQTE QY F+HDAL E        I   E ++   +++E     C   L+ Q+K  I F+P D     + K+ N +KNR   I PIE  R++L+ +PG +GS+YINAS + G+ ++++FI+TQHP+  T +DFW+MVWD N   ++LLS   + N  QFWP       +  +     N       V   F+I S ++DY L   M     WP  +S  + +   + D++ +     +GPIV++D YG ++A  F A+SSL  ++      NVY   K+ H +RP  ++SS D+  IY +L F+  N +L
Sbjct:  556 GYQKGHAFIGTQGPLPDTFDCFWRMIWEQRVAIIVMITNLVERGRRKCDMYWPKDGVETYGVIQVKLIEEEVMSTYTVRTLQIKHLKLKKKKQCNTEKLVYQYHYTNWPDHGTPDHPLPVLNFVKKSSAANPAEAGPIVVHCSAGVGRTGTYIVLDAMLKQIQQKNIVNVFGFLRHIRAQRNFLVQTEEQYIFLHDALVE-------AIASGETNLMAEQVEEL--KNCTPYLEQQYKNIIQFQPKDIHIASAMKQVNSIKNRG-AIFPIEGSRVHLTPKPGEDGSDYINASWLHGFRRLRDFIVTQHPMAHTIKDFWQMVWDHNAQTVVLLSSLDDINFAQFWPDEATPIESDHYRVKFLNKTNKSDYVSRDFVIQSIQDDYELTVKMLHCPSWPE-MSNPNSIYDFIVDVHERCNDYRNGPIVIVDRYGGAQACTFCAISSLAIEMEYCSTANVYQYAKLYHNKRPGVWTSSEDIRVIYNILSFLPGNLNL 1037          

HSP 2 Score: 87.0409 bits (214), Expect = 4.352e-17
Identity = 66/260 (25.38%), Postives = 124/260 (47.69%), Query Frame = 3
Query:  798 KCINFE-PSDYDYMESKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGS-NYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSN------ENMHQFWPGPDNNALTFRWFKVHCNSEK--TEFSVQYSFLISSSREDYALDCTMHCLKY------WPNTVSECSELLRLLFDINSKKY----SGPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELL 1517
            +CI+ + P ++      KR    KNR   I   +  R++L   PG + + +YINA+ I GY +   FI TQ PL +T   FW+M+W++  ++I++++N           +W  P +   T+   +V    E+  + ++V+ +  I   +      C    L Y      WP+  +    L  L F   S       +GPIVV    G  R G ++ + ++L Q+++ ++VNV+  ++ I  +R +   +    +F+++ L
Sbjct:  501 ECISDDLPCEHSQHPENKR----KNRYLNITAYDHSRVHLHPTPGQKKNLDYINANFIDGYQKGHAFIGTQGPLPDTFDCFWRMIWEQRVAIIVMITNLVERGRRKCDMYW--PKDGVETYGVIQVKLIEEEVMSTYTVR-TLQIKHLKLKKKKQCNTEKLVYQYHYTNWPDHGTPDHPLPVLNFVKKSSAANPAEAGPIVVHCSAGVGRTGTYIVLDAMLKQIQQKNIVNVFGFLRHIRAQRNFLVQTEEQYIFLHDAL 753          
BLAST of Receptor type tyrosine protein phosphatase zeta vs. Ensembl Fly
Match: Ptp99A (gene:FBgn0004369 transcript:FBtr0085423)

HSP 1 Score: 343.969 bits (881), Expect = 2.252e-102
Identity = 197/494 (39.88%), Postives = 294/494 (59.51%), Query Frame = 3
Query:   96 GFKRPYAYIATQGPLTETVADFWQMVWEQNSEIIVMISNFVERGRSKCEIYWSPNKTLNCGNISVHQIYQKEMAFYTERAFRIRNIRLKKNIK---DRTVYHYQYTDWRDFDXXXXXXXXXXFVRATTKHWSESSGPIIVHCSAGVGRTGTYICIESQIRQLDQEHHINVRGFLEHIRQQRMKLVQTESQYTFIHDALYEYYLYPDREIHKLELSIYISKLKEFDASGCMK-LDTQFKKCINFEPSDYDYMESKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLS---NENMHQFWPGPDNNALTFRWFKVHCNSEKTEFSVQYSFLISSSREDYALDCTM-HCLKYWPNTVSECSELLRLLFDINSK---KYSGPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELLEFVILNQHL 1544
            G+++ +A+I TQGPL +T   FW+M+WEQ   IIVMI+N VERGR KC++YW  +     G I V  I ++ M+ YT R  +I++++LKK  +   ++ VY Y YT+W D   P   LPVL FV+ ++      +GPI+VHCSAGVGRTGTYI +++ ++Q+ Q++ +NV GFL HIR QR  LVQTE QY F+HDAL E        I   E ++   +++E     C   L+ Q+K  I F+P D     + K+ N +KNR   I PIE  R++L+ +PG +GS+YINAS + G+ ++++FI+TQHP+  T +DFW+MVWD N   ++LLS   + N  QFWP       +  +     N       V   F+I S ++DY L   M HC   WP  +S  + +   + D++ +     +GPIV++D YG ++A  F A+SSL  ++      NVY   K+ H +RP  ++SS D+  IY +L F+  N +L
Sbjct:  541 GYQKGHAFIGTQGPLPDTFDCFWRMIWEQRVAIIVMITNLVERGRRKCDMYWPKDGVETYGVIQVKLIEEEVMSTYTVRTLQIKHLKLKKKKQCNTEKLVYQYHYTNWPDHGTPDHPLPVLNFVKKSSAANPAEAGPIVVHCSAGVGRTGTYIVLDAMLKQIQQKNIVNVFGFLRHIRAQRNFLVQTEEQYIFLHDALVE-------AIASGETNLMAEQVEEL--KNCTPYLEQQYKNIIQFQPKDIHIASAMKQVNSIKNRG-AIFPIEGSRVHLTPKPGEDGSDYINASWLHGFRRLRDFIVTQHPMAHTIKDFWQMVWDHNAQTVVLLSSLDDINFAQFWPDEATPIESDHYRVKFLNKTNKSDYVSRDFVIQSIQDDYELTVKMLHC-PSWPE-MSNPNSIYDFIVDVHERCNDYRNGPIVIVDRYGGAQACTFCAISSLAIEMEYCSTANVYQYAKLYHNKRPGVWTSSEDIRVIYNILSFLPGNLNL 1022          

HSP 2 Score: 86.6557 bits (213), Expect = 4.907e-17
Identity = 66/260 (25.38%), Postives = 124/260 (47.69%), Query Frame = 3
Query:  798 KCINFE-PSDYDYMESKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGS-NYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSN------ENMHQFWPGPDNNALTFRWFKVHCNSEK--TEFSVQYSFLISSSREDYALDCTMHCLKY------WPNTVSECSELLRLLFDINSKKY----SGPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELL 1517
            +CI+ + P ++      KR    KNR   I   +  R++L   PG + + +YINA+ I GY +   FI TQ PL +T   FW+M+W++  ++I++++N           +W  P +   T+   +V    E+  + ++V+ +  I   +      C    L Y      WP+  +    L  L F   S       +GPIVV    G  R G ++ + ++L Q+++ ++VNV+  ++ I  +R +   +    +F+++ L
Sbjct:  486 ECISDDLPCEHSQHPENKR----KNRYLNITAYDHSRVHLHPTPGQKKNLDYINANFIDGYQKGHAFIGTQGPLPDTFDCFWRMIWEQRVAIIVMITNLVERGRRKCDMYW--PKDGVETYGVIQVKLIEEEVMSTYTVR-TLQIKHLKLKKKKQCNTEKLVYQYHYTNWPDHGTPDHPLPVLNFVKKSSAANPAEAGPIVVHCSAGVGRTGTYIVLDAMLKQIQQKNIVNVFGFLRHIRAQRNFLVQTEEQYIFLHDAL 738          
BLAST of Receptor type tyrosine protein phosphatase zeta vs. Ensembl Fly
Match: Ptp99A (gene:FBgn0004369 transcript:FBtr0303148)

HSP 1 Score: 343.584 bits (880), Expect = 7.641e-102
Identity = 195/493 (39.55%), Postives = 292/493 (59.23%), Query Frame = 3
Query:   96 GFKRPYAYIATQGPLTETVADFWQMVWEQNSEIIVMISNFVERGRSKCEIYWSPNKTLNCGNISVHQIYQKEMAFYTERAFRIRNIRLKKNIK---DRTVYHYQYTDWRDFDXXXXXXXXXXFVRATTKHWSESSGPIIVHCSAGVGRTGTYICIESQIRQLDQEHHINVRGFLEHIRQQRMKLVQTESQYTFIHDALYEYYLYPDREIHKLELSIYISKLKEFDASGCMK-LDTQFKKCINFEPSDYDYMESKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLS---NENMHQFWPGPDNNALTFRWFKVHCNSEKTEFSVQYSFLISSSREDYALDCTMHCLKYWPNTVSECSELLRLLFDINSK---KYSGPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELLEFVILNQHL 1544
            G+++ +A+I TQGPL +T   FW+M+WEQ   IIVMI+N VERGR KC++YW  +     G I V  I ++ M+ YT R  +I++++LKK  +   ++ VY Y YT+W D   P   LPVL FV+ ++      +GPI+VHCSAGVGRTGTYI +++ ++Q+ Q++ +NV GFL HIR QR  LVQTE QY F+HDAL E        I   E ++   +++E     C   L+ Q+K  I F+P D     + K+ N +KNR   I PIE  R++L+ +PG +GS+YINAS + G+ ++++FI+TQHP+  T +DFW+MVWD N   ++LLS   + N  QFWP       +  +     N       V   F+I S ++DY L   M     WP  +S  + +   + D++ +     +GPIV++D YG ++A  F A+SSL  ++      NVY   K+ H +RP  ++SS D+  IY +L F+  N +L
Sbjct:  712 GYQKGHAFIGTQGPLPDTFDCFWRMIWEQRVAIIVMITNLVERGRRKCDMYWPKDGVETYGVIQVKLIEEEVMSTYTVRTLQIKHLKLKKKKQCNTEKLVYQYHYTNWPDHGTPDHPLPVLNFVKKSSAANPAEAGPIVVHCSAGVGRTGTYIVLDAMLKQIQQKNIVNVFGFLRHIRAQRNFLVQTEEQYIFLHDALVE-------AIASGETNLMAEQVEEL--KNCTPYLEQQYKNIIQFQPKDIHIASAMKQVNSIKNRG-AIFPIEGSRVHLTPKPGEDGSDYINASWLHGFRRLRDFIVTQHPMAHTIKDFWQMVWDHNAQTVVLLSSLDDINFAQFWPDEATPIESDHYRVKFLNKTNKSDYVSRDFVIQSIQDDYELTVKMLHCPSWPE-MSNPNSIYDFIVDVHERCNDYRNGPIVIVDRYGGAQACTFCAISSLAIEMEYCSTANVYQYAKLYHNKRPGVWTSSEDIRVIYNILSFLPGNLNL 1193          

HSP 2 Score: 87.0409 bits (214), Expect = 4.708e-17
Identity = 66/260 (25.38%), Postives = 124/260 (47.69%), Query Frame = 3
Query:  798 KCINFE-PSDYDYMESKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGS-NYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSN------ENMHQFWPGPDNNALTFRWFKVHCNSEK--TEFSVQYSFLISSSREDYALDCTMHCLKY------WPNTVSECSELLRLLFDINSKKY----SGPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELL 1517
            +CI+ + P ++      KR    KNR   I   +  R++L   PG + + +YINA+ I GY +   FI TQ PL +T   FW+M+W++  ++I++++N           +W  P +   T+   +V    E+  + ++V+ +  I   +      C    L Y      WP+  +    L  L F   S       +GPIVV    G  R G ++ + ++L Q+++ ++VNV+  ++ I  +R +   +    +F+++ L
Sbjct:  657 ECISDDLPCEHSQHPENKR----KNRYLNITAYDHSRVHLHPTPGQKKNLDYINANFIDGYQKGHAFIGTQGPLPDTFDCFWRMIWEQRVAIIVMITNLVERGRRKCDMYW--PKDGVETYGVIQVKLIEEEVMSTYTVR-TLQIKHLKLKKKKQCNTEKLVYQYHYTNWPDHGTPDHPLPVLNFVKKSSAANPAEAGPIVVHCSAGVGRTGTYIVLDAMLKQIQQKNIVNVFGFLRHIRAQRNFLVQTEEQYIFLHDAL 909          
BLAST of Receptor type tyrosine protein phosphatase zeta vs. Ensembl Zebrafish
Match: ptprga (protein tyrosine phosphatase receptor type Ga [Source:ZFIN;Acc:ZDB-GENE-101101-4])

HSP 1 Score: 364.77 bits (935), Expect = 3.012e-109
Identity = 202/500 (40.40%), Postives = 290/500 (58.00%), Query Frame = 3
Query:   96 GFKRPYAYIATQGPLTETVADFWQMVWEQNSEIIVMISNFVERGRSKCEIYWSPNKTLNCGNISVHQIYQKEMAFYTERAFRIRNIRLKKNIK--------DRTVYHYQYTDWRDFDXXXXXXXXXXFVRATTKHWSESSGPIIVHCSAGVGRTGTYICIESQIRQLDQEHHINVRGFLEHIRQQRMKLVQTESQYTFIHDALYEYYLYPDREIHKLELSIYISKLKEFDASGCMKLDTQFKKCINFEPSDYDYMESKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSN-----ENMHQFWPGPDNNALTFRWFKVH-------CNSEKTEFSVQYSFLISSSREDYALDCTMHCLKYWPNTVSECSELLRLLFDINSKKYS--GPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELLEFVI 1529
            G+ +P AYIA QGPL  T  DFW+MVWEQN+ IIVMI+N VE+GR KC+ YW    +   GNI V     K MA YT R F IRN ++KK  K        +RTV  Y YT W D  VP  +LPVL FVR ++   +   GP++VHCSAGVGRTGTYI I+S ++QL  +  +NV GFL+HIR QR  LVQTE QY FIHDAL E  L  + E+   +L  Y++ +      G  +L+ QFK          +   ++K  N  KNR+ +++P E  R+ L+  PG++G++YINAS I GY++  EFIITQHPL  T +DFW+M+WD N  +I++L +     E+   +WP  +  A+    F V        C S + +  + + F++ ++++DY L+        WPN  +  S    L+  I  +  +  GP +V DE+G+  AG+F A+++L  QL  +    VY V KMI++ RP  F+      ++Y+ +  +I
Sbjct:  883 GYNKPKAYIAAQGPLKSTFEDFWRMVWEQNTGIIVMITNLVEKGRRKCDQYWPSENSEEYGNIVVTLKRTKVMACYTLRIFTIRNTKVKKGQKGNTKGRQSERTVLQYHYTQWPDMGVPEYTLPVLTFVRKSSAAQTPDMGPMLVHCSAGVGRTGTYIVIDSMLQQLKDKGAVNVLGFLKHIRTQRNYLVQTEEQYIFIHDALMEAILGKETEVPSSQLHSYVNSILTPGPGGKTRLEKQFKLVTQCNARFVECFSAQKDCNKEKNRNSSVVPSERARVGLAPLPGMKGTDYINASYIMGYYRSNEFIITQHPLPHTTKDFWRMIWDHNAQIIVMLPDNQGLAEDEFVYWPSRE-EAMNCEAFTVTLISKDRLCLSNEEQIII-HDFILEATQDDYVLEVRHFQCPKWPNPDAPISSTFELINVIKEEAMTRDGPTIVHDEFGAVSAGMFCALTTLSQQLESEGAAGVYQVAKMINLMRPGVFTDIEQYQYLYKAMLSLI 1380          

HSP 2 Score: 90.8929 bits (224), Expect = 3.437e-18
Identity = 68/250 (27.20%), Postives = 113/250 (45.20%), Query Frame = 3
Query:  855 NLVKNRSDTIMPIESRRINLSCEPGVEG--SNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSN------ENMHQFWPGPD-----NNALTFRWFKVHCNSEKTEFSVQYSFLISSSREDY-ALDCTMHCLKY----WPNTVSECSELLRLLFDINSKKYS----GPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELLEFVILNQ 1538
            N  KNR   I+  +  R+ L    G +   S+YINA+ + GY + K +I  Q PL  T +DFW+MVW++N  +I++++N          Q+WP  +     N  +T +  KV        F+++ + +    + +          L+Y    WP+       L  L F   S        GP++V    G  R G ++ + S+L QL+    VNV   +K I  +R Y   +    +FI++ L   IL +
Sbjct:  843 NKHKNRYINIIAYDHSRVKLRPLAGKDSKHSDYINANYVDGYNKPKAYIAAQGPLKSTFEDFWRMVWEQNTGIIVMITNLVEKGRRKCDQYWPSENSEEYGNIVVTLKRTKVMACYTLRIFTIRNTKVKKGQKGNTKGRQSERTVLQYHYTQWPDMGVPEYTLPVLTFVRKSSAAQTPDMGPMLVHCSAGVGRTGTYIVIDSMLQQLKDKGAVNVLGFLKHIRTQRNYLVQTEEQYIFIHDALMEAILGK 1092          
BLAST of Receptor type tyrosine protein phosphatase zeta vs. Ensembl Zebrafish
Match: ca16b (carbonic anhydrase XVI b [Source:ZFIN;Acc:ZDB-GENE-080818-1])

HSP 1 Score: 362.844 bits (930), Expect = 1.349e-108
Identity = 197/491 (40.12%), Postives = 287/491 (58.45%), Query Frame = 3
Query:   96 GFKRPYAYIATQGPLTETVADFWQMVWEQNSEIIVMISNFVERGRSKCEIYWSPNKTLNCGNISVHQIYQKEMAFYTERAFRIRNIRLKKNIK----DRTVYHYQYTDWRDFDXXXXXXXXXXFVRATTKHWSESSGPIIVHCSAGVGRTGTYICIESQIRQLDQEHHINVRGFLEHIRQQRMKLVQTESQYTFIHDALYEYYLYPDREIHKLELSIYISKLKEFDASGCMKLDTQFKKCINFEPSDYDYMESKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSN-----ENMHQFWPGPDN--NALTFRWFKVH----CNSEKTEFSVQYSFLISSSREDYALDCTMHCLKYWPNTVSECSELLRLLFDINSKKYS--GPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELL 1517
            G+KR  AYIA QGPL  T  DFW+M+WEQN+ +IVMI+N VE+GR KC+ YW    +   GNI V     K  A+YT R F +RN +LKK  K    +R V  Y YT W D  VP  +LPVL F+  +T   + S+GP++VHCSAGVGRTGTYI I+S ++Q+     +NV GFL+HIR+QR  LVQTE Q+ FIHDAL E  L  D E+   +L  Y + L     +G  ++D  FK          + +  +K  N  KNR+  ++P E  R+ LS  PG++G++YINAS I GY++  EFIITQHPL  T  DFW+M+WD N  +I++L +     E+   +WP  +   N + F    ++    C S + +  + + F++ ++++DY L+        WP+  +  S    L+  I  +  +  GP +V DE+G+  AG F A+++L  QL  +  V+VY V KMI++ RP  F+      ++Y+ +
Sbjct:  857 GYKRARAYIAAQGPLKSTFEDFWRMIWEQNTTVIVMITNLVEKGRRKCDQYWPSENSEVYGNIMVTLKSTKVYAYYTLRHFIVRNSKLKKGQKGRQNERLVLQYHYTQWPDMGVPEYTLPVLKFISRSTVTHASSTGPVLVHCSAGVGRTGTYIVIDSMLKQIKDRGSVNVLGFLKHIREQRNYLVQTEEQFIFIHDALMEAVLSKDTEVSAWQLHTYTNSLLTPSPTGHTRMDKHFKLLTQCNAHLAECLSGQKECNKEKNRTSAVLPTERARVALSPLPGLKGTDYINASYIMGYYRSNEFIITQHPLPHTTTDFWRMIWDHNAQVIVMLPDNLGLTEDEFVYWPSREEPMNCIAFTVTLINTDRLCLSNEEQLII-HDFILEATQDDYVLEVRHFQCPNWPDPDASISSTFELINIIKEEAMTRDGPTIVHDEFGAVSAGTFCALTTLSQQLENESAVDVYQVAKMINLMRPGVFTEIEHYHYLYQAM 1346          

HSP 2 Score: 97.0561 bits (240), Expect = 4.230e-20
Identity = 68/247 (27.53%), Postives = 118/247 (47.77%), Query Frame = 3
Query:  855 NLVKNRSDTIMPIESRRINLSCEPGVEG--SNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSN------ENMHQFWPGPD-----NNALTFRWFKVHCNSEKTEFSVQYSFLISS--SREDYALDCTMHCLKYWPNTVSECSELLRLLF----DINSKKYSGPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELLEFVILNQ 1538
            N  KNR   I+  +  R+ L   PG +   S+YINA+ + GY + + +I  Q PL  T +DFW+M+W++N ++I++++N          Q+WP  +     N  +T +  KV+       F V+ S L      R++  L    H  + WP+       L  L F     +     +GP++V    G  R G ++ + S+L Q++    VNV   +K I  +R Y   +    +FI++ L   +L++
Sbjct:  817 NKHKNRYINIVAYDHSRVKLQQLPGKDSKHSDYINANYVDGYKRARAYIAAQGPLKSTFEDFWRMIWEQNTTVIVMITNLVEKGRRKCDQYWPSENSEVYGNIMVTLKSTKVYAYYTLRHFIVRNSKLKKGQKGRQNERLVLQYHYTQ-WPDMGVPEYTLPVLKFISRSTVTHASSTGPVLVHCSAGVGRTGTYIVIDSMLKQIKDRGSVNVLGFLKHIREQRNYLVQTEEQFIFIHDALMEAVLSK 1062          
BLAST of Receptor type tyrosine protein phosphatase zeta vs. Ensembl Zebrafish
Match: ca16b (carbonic anhydrase XVI b [Source:ZFIN;Acc:ZDB-GENE-080818-1])

HSP 1 Score: 355.14 bits (910), Expect = 1.441e-106
Identity = 199/492 (40.45%), Postives = 289/492 (58.74%), Query Frame = 3
Query:   96 GFKRPYAYIATQGPLTETVADFWQMVWEQNSEIIVMISNFVERGRSKCEIYWSPNKTLNCGNISVHQIYQKEMAFYTERAFRIRNIRLKKNIK----DRTVYHYQYTDWRDFDXXXXXXXXXXFVRATTKHWSESSGPIIVHCSAGVGRTGTYICIESQIRQLDQEHHINVRGFLEHIRQQRMKLVQTESQYTFIHDALYEYYLYPDREIHKLELSIYISKLKEFDASGCMKLDTQFKKCINFEPSDYDYMESKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSN-----ENMHQFWPGPDN--NALTFRWFKVH----CNSEKTEFSVQYSFLISSSREDYALDCT-MHCLKYWPNTVSECS--ELLRLLFDINSKKYSGPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELL 1517
            G+KR  AYIA QGPL  T  DFW+M+WEQN+ +IVMI+N VE+GR KC+ YW    +   GNI V     K  A+YT R F +RN +LKK  K    +R V  Y YT W D  VP  +LPVL F+  +T   + S+GP++VHCSAGVGRTGTYI I+S ++Q+     +NV GFL+HIR+QR  LVQTE Q+ FIHDAL E  L  D E+   +L  Y + L     +G  ++D  FK          + +  +K  N  KNR+  ++P E  R+ LS  PG++G++YINAS I GY++  EFIITQHPL  T  DFW+M+WD N  +I++L +     E+   +WP  +   N + F    ++    C S + +  + + F++ ++++DY L+     C    PN    CS  EL+ ++ +  +    GP +V DE+G+  AG F A+++L  QL  +  V+VY V KMI++ RP  F+      ++Y+ +
Sbjct:  729 GYKRARAYIAAQGPLKSTFEDFWRMIWEQNTTVIVMITNLVEKGRRKCDQYWPSENSEVYGNIMVTLKSTKVYAYYTLRHFIVRNSKLKKGQKGRQNERLVLQYHYTQWPDMGVPEYTLPVLKFISRSTVTHASSTGPVLVHCSAGVGRTGTYIVIDSMLKQIKDRGSVNVLGFLKHIREQRNYLVQTEEQFIFIHDALMEAVLSKDTEVSAWQLHTYTNSLLTPSPTGHTRMDKHFKLLTQCNAHLAECLSGQKECNKEKNRTSAVLPTERARVALSPLPGLKGTDYINASYIMGYYRSNEFIITQHPLPHTTTDFWRMIWDHNAQVIVMLPDNLGLTEDEFVYWPSREEPMNCIAFTVTLINTDRLCLSNEEQLII-HDFILEATQDDYVLEVRHFQC----PN----CSTFELINIIKE-EAMTRDGPTIVHDEFGAVSAGTFCALTTLSQQLENESAVDVYQVAKMINLMRPGVFTEIEHYHYLYQAM 1210          

HSP 2 Score: 97.0561 bits (240), Expect = 4.555e-20
Identity = 67/244 (27.46%), Postives = 117/244 (47.95%), Query Frame = 3
Query:  864 KNRSDTIMPIESRRINLSCEPGVEG--SNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSN------ENMHQFWPGPD-----NNALTFRWFKVHCNSEKTEFSVQYSFLISS--SREDYALDCTMHCLKYWPNTVSECSELLRLLF----DINSKKYSGPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELLEFVILNQ 1538
            KNR   I+  +  R+ L   PG +   S+YINA+ + GY + + +I  Q PL  T +DFW+M+W++N ++I++++N          Q+WP  +     N  +T +  KV+       F V+ S L      R++  L    H  + WP+       L  L F     +     +GP++V    G  R G ++ + S+L Q++    VNV   +K I  +R Y   +    +FI++ L   +L++
Sbjct:  692 KNRYINIVAYDHSRVKLQQLPGKDSKHSDYINANYVDGYKRARAYIAAQGPLKSTFEDFWRMIWEQNTTVIVMITNLVEKGRRKCDQYWPSENSEVYGNIMVTLKSTKVYAYYTLRHFIVRNSKLKKGQKGRQNERLVLQYHYTQ-WPDMGVPEYTLPVLKFISRSTVTHASSTGPVLVHCSAGVGRTGTYIVIDSMLKQIKDRGSVNVLGFLKHIREQRNYLVQTEEQFIFIHDALMEAVLSK 934          
BLAST of Receptor type tyrosine protein phosphatase zeta vs. Ensembl Zebrafish
Match: BX663614.2 (carbonic anhydrase XVI b [Source:NCBI gene;Acc:569183])

HSP 1 Score: 355.14 bits (910), Expect = 1.627e-106
Identity = 199/492 (40.45%), Postives = 289/492 (58.74%), Query Frame = 3
Query:   96 GFKRPYAYIATQGPLTETVADFWQMVWEQNSEIIVMISNFVERGRSKCEIYWSPNKTLNCGNISVHQIYQKEMAFYTERAFRIRNIRLKKNIK----DRTVYHYQYTDWRDFDXXXXXXXXXXFVRATTKHWSESSGPIIVHCSAGVGRTGTYICIESQIRQLDQEHHINVRGFLEHIRQQRMKLVQTESQYTFIHDALYEYYLYPDREIHKLELSIYISKLKEFDASGCMKLDTQFKKCINFEPSDYDYMESKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSN-----ENMHQFWPGPDN--NALTFRWFKVH----CNSEKTEFSVQYSFLISSSREDYALDCT-MHCLKYWPNTVSECS--ELLRLLFDINSKKYSGPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELL 1517
            G+KR  AYIA QGPL  T  DFW+M+WEQN+ +IVMI+N VE+GR KC+ YW    +   GNI V     K  A+YT R F +RN +LKK  K    +R V  Y YT W D  VP  +LPVL F+  +T   + S+GP++VHCSAGVGRTGTYI I+S ++Q+     +NV GFL+HIR+QR  LVQTE Q+ FIHDAL E  L  D E+   +L  Y + L     +G  ++D  FK          + +  +K  N  KNR+  ++P E  R+ LS  PG++G++YINAS I GY++  EFIITQHPL  T  DFW+M+WD N  +I++L +     E+   +WP  +   N + F    ++    C S + +  + + F++ ++++DY L+     C    PN    CS  EL+ ++ +  +    GP +V DE+G+  AG F A+++L  QL  +  V+VY V KMI++ RP  F+      ++Y+ +
Sbjct:  729 GYKRARAYIAAQGPLKSTFEDFWRMIWEQNTTVIVMITNLVEKGRRKCDQYWPSENSEVYGNIMVTLKSTKVYAYYTLRHFIVRNSKLKKGQKGRQNERLVLQYHYTQWPDMGVPEYTLPVLKFISRSTVTHASSTGPVLVHCSAGVGRTGTYIVIDSMLKQIKDRGSVNVLGFLKHIREQRNYLVQTEEQFIFIHDALMEAVLSKDTEVSAWQLHTYTNSLLTPSPTGHTRMDKHFKLLTQCNAHLAECLSGQKECNKEKNRTSAVLPTERARVALSPLPGLKGTDYINASYIMGYYRSNEFIITQHPLPHTTTDFWRMIWDHNAQVIVMLPDNLGLTEDEFVYWPSREEPMNCIAFTVTLINTDRLCLSNEEQLII-HDFILEATQDDYVLEVRHFQC----PN----CSTFELINIIKE-EAMTRDGPTIVHDEFGAVSAGTFCALTTLSQQLENESAVDVYQVAKMINLMRPGVFTEIEHYHYLYQAM 1210          

HSP 2 Score: 97.0561 bits (240), Expect = 4.836e-20
Identity = 67/244 (27.46%), Postives = 117/244 (47.95%), Query Frame = 3
Query:  864 KNRSDTIMPIESRRINLSCEPGVEG--SNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSN------ENMHQFWPGPD-----NNALTFRWFKVHCNSEKTEFSVQYSFLISS--SREDYALDCTMHCLKYWPNTVSECSELLRLLF----DINSKKYSGPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELLEFVILNQ 1538
            KNR   I+  +  R+ L   PG +   S+YINA+ + GY + + +I  Q PL  T +DFW+M+W++N ++I++++N          Q+WP  +     N  +T +  KV+       F V+ S L      R++  L    H  + WP+       L  L F     +     +GP++V    G  R G ++ + S+L Q++    VNV   +K I  +R Y   +    +FI++ L   +L++
Sbjct:  692 KNRYINIVAYDHSRVKLQQLPGKDSKHSDYINANYVDGYKRARAYIAAQGPLKSTFEDFWRMIWEQNTTVIVMITNLVEKGRRKCDQYWPSENSEVYGNIMVTLKSTKVYAYYTLRHFIVRNSKLKKGQKGRQNERLVLQYHYTQ-WPDMGVPEYTLPVLKFISRSTVTHASSTGPVLVHCSAGVGRTGTYIVIDSMLKQIKDRGSVNVLGFLKHIREQRNYLVQTEEQFIFIHDALMEAVLSK 934          
BLAST of Receptor type tyrosine protein phosphatase zeta vs. Ensembl Zebrafish
Match: ptprz1b (protein tyrosine phosphatase receptor type Z1b [Source:ZFIN;Acc:ZDB-GENE-050506-100])

HSP 1 Score: 352.443 bits (903), Expect = 3.012e-105
Identity = 192/502 (38.25%), Postives = 295/502 (58.76%), Query Frame = 3
Query:   96 GFKRPYAYIATQGPLTETVADFWQMVWEQNSEIIVMISNFVERGRSKCEIYWSPNKTLNCGNISVHQIYQKEMAFYTERAFRIRNIRLKKNIK-----DRTVYHYQYTDWRDFDXXXXXXXXXXFVRATTKHWSESSGPIIVHCSAGVGRTGTYICIESQIRQLDQEHHINVRGFLEHIRQQRMKLVQTESQYTFIHDALYEYYLYPDREIHKLELSIYISKLKEFDASGCMKLDTQFKKCINFEPSDYDYMESKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILL------SNENMHQFWPGPDNNALTFRWFKVHCNSEKT------EFSVQYSFLISSSREDYALDCTMHCLKYWPN---TVSECSELLRLLFDINSKKYSGPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELLEFVILNQH 1541
            GF +P AYIA QGPL  ++ DFW+M+WEQN  +IVMI+N VE+GR KC+ YW      + G   V     + +A+YT R F +RN+++KK  +     +RTV H+ YT W D  VP  +LP+L F+R +++  +   GP++VHCSAGVGRTGTYI I+S ++Q+ +E+ +N+ GFL+HIR QR  LVQTE QY FIHDAL E     +  +    +  Y+S L     +G   L+ QFK          DY  + K  N+ KNR+  +MP+E  R++LS   G E S+YINAS + G+ Q +EFI+TQ+PL  T  DFW+M+WD N  +I+ L      S+E    +WP  D   ++   F V    E +      E  +   F++ + ++DY L+        WP+    +S C EL+ ++ + +S++  GP+++ D  G S AG+F A+ +L++QL +++ V+VY   +MI++ RP  F+      F+Y+ +  ++  Q 
Sbjct:  779 GFNQPKAYIAAQGPLKGSLEDFWRMIWEQNVGVIVMITNLVEKGRRKCDQYWPLENQEDYGCFLVTLKSSRTLAYYTLRTFTLRNVQIKKGSQKGRSQERTVLHFHYTQWPDMGVPEYTLPLLSFIRTSSQARTAEMGPVVVHCSAGVGRTGTYIVIDSMLKQIKEENTVNIMGFLKHIRTQRNYLVQTEEQYVFIHDALVEAIRSKETLVSSSLIHTYVSGLLTPGPAGKTPLEKQFKLVSQSCAKQSDYTTALKESNVSKNRTACLMPVERSRVSLSAAAG-ESSDYINASYLLGFHQSREFIVTQNPLPNTIHDFWRMIWDHNTQIIVSLPDTHNMSSEAECVYWPTKD-EPISCETFTVSFRDEDSLNLSNEEPVLVQHFILEALKDDYVLEVHQFQSPRWPDPDSPISNCFELINIIREESSRR-EGPVLIHDGCGGSSAGLFCALVTLVNQLDEENSVDVYQTARMINLMRPGVFNDVEQYQFLYKAILSLVSTQE 1277          

HSP 2 Score: 93.5893 bits (231), Expect = 5.715e-19
Identity = 71/273 (26.01%), Postives = 130/273 (47.62%), Query Frame = 3
Query:  855 NLVKNRSDTIMPIESRRINLSCEPGVEG--SNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSN------ENMHQFWPGPDNNALTFRWFKVHCNSEKT-------EFSVQYSFLISSSREDYALDCTMHCLKY--WPNT-VSECSELLRLLFDINSKKYS---GPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELLEFVILNQHLYTFFSRSQQDFIPNGIAHLPVS 1610
            N  KNR   I+  +  R+ LS     +G   +YINA+ + G+ Q K +I  Q PL  + +DFW+M+W++N  +I++++N          Q+WP    N   +  F V   S +T        F+++   +   S++  + + T+    Y  WP+  V E +  L      +S+  +   GP+VV    G  R G ++ + S+L Q+++++ VN+   +K I  +R Y   +    +FI++ L   I          RS++  + + + H  VS
Sbjct:  739 NKSKNRYINILAYDHSRVKLSQNSDKDGKTGDYINANYVDGFNQPKAYIAAQGPLKGSLEDFWRMIWEQNVGVIVMITNLVEKGRRKCDQYWPL--ENQEDYGCFLVTLKSSRTLAYYTLRTFTLRNVQIKKGSQKGRSQERTVLHFHYTQWPDMGVPEYTLPLLSFIRTSSQARTAEMGPVVVHCSAGVGRTGTYIVIDSMLKQIKEENTVNIMGFLKHIRTQRNYLVQTEEQYVFIHDALVEAI----------RSKETLVSSSLIHTYVS 999          
BLAST of Receptor type tyrosine protein phosphatase zeta vs. Ensembl Xenopus
Match: tfam (transcription factor A, mitochondrial [Source:Xenbase;Acc:XB-GENE-978256])

HSP 1 Score: 348.591 bits (893), Expect = 6.047e-110
Identity = 195/498 (39.16%), Postives = 289/498 (58.03%), Query Frame = 3
Query:   96 GFKRPYAYIATQGPLTETVADFWQMVWEQNSEIIVMISNFVERGRSKCEIYWSPNKTLNCGNISVHQIYQKEMAFYTERAFRIRNIRLKK--NIK----DRTVYHYQYTDWRDFDXXXXXXXXXXFVRATTKHWSESSGPIIVHCSAGVGRTGTYICIESQIRQLDQEHHINVRGFLEHIRQQRMKLVQTESQYTFIHDALYEYYLYPDREIHKLELSIYISKLKEFDASGCMKLDTQFKKCINFEPSDYDYMESKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSN-----ENMHQFWPGPDNNALTFRWFKVH-------CNSEKTEFSVQYSFLISSSREDYALDCTMHCLKYWPNTVSECSELLRLLFDINSKKYS--GPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELLEFVI 1529
            G+ +  AYIATQGPL  T  DFW+M+WEQN+ IIVMI+N VE+GR KC+ YW    +   GNI V     +  A YT R F IRN+++KK  N K    +RTV  Y YT W D  VP  +LPVL FVR ++       GP++VHCSAGVGRTGTYI I+S ++Q+  +  +N  GFL+HIR QR  LVQTE QY FIHDAL E  L  + E+   +L  Y++ +      G  +L+ QF+          +   ++K  N  KNR+ +++P E  R+ L+  PG++G++YINAS I GY +  EFIITQHP+  T +DFW+M+WD N  +I++L +     E+   +WP  +  ++    F V        C S + +  + + F++ ++++DY L+        WPN  +  S    L+  I  +  +  GP +V DE+G+  AG   A+++L  Q+  ++ V+VY V KMI++ RP  F+      F+Y+ +  +I
Sbjct:   57 GYNKAKAYIATQGPLKSTFEDFWRMIWEQNTGIIVMITNLVEKGRRKCDQYWPTENSDEYGNIMVTLKSTRVYACYTVRKFTIRNMKMKKKGNAKGRHNERTVMQYHYTQWPDMGVPEYALPVLTFVRRSSAVQLPEMGPVLVHCSAGVGRTGTYIVIDSMLQQIKDKSTVNALGFLKHIRTQRNYLVQTEEQYIFIHDALLEAILGKETEVCANQLHSYVNSILTPGPGGRTRLEKQFRLVTQCNAKYVECFSAQKDSNKEKNRNSSVVPSERARVGLAPLPGMKGTDYINASYIMGYLRSNEFIITQHPMPHTTKDFWRMIWDHNAQIIVMLPDNQSLAEDEFVYWPSRE-ESMNCEAFTVTLISKDRLCLSNEEQIII-HDFILEATQDDYVLEVRHFQCPKWPNPDAPISSAFELINVIKEEALTRDGPTIVHDEFGAVSAGTLCALATLSQQMENENAVDVYQVAKMINLMRPGVFTDIEHYQFLYKAMLSLI 552          

HSP 2 Score: 94.7449 bits (234), Expect = 1.433e-19
Identity = 67/250 (26.80%), Postives = 116/250 (46.40%), Query Frame = 3
Query:  852 YNLVKNRSDTIMPIESRRINLSCEPGVEG--SNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSN------ENMHQFWPGPD-----NNALTFRWFKVHCNSEKTEFSVQYSFLI----SSSREDYALDCTMHCLKYWPNTVSECSELLRLLFDINSKKYS----GPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELLEFVILNQ 1538
            YN  KNR   I+  +  R+ L   PG +   S+YINA+ + GY + K +I TQ PL  T +DFW+M+W++N  +I++++N          Q+WP  +     N  +T +  +V+      +F+++   +     +  R +       H  + WP+       L  L F   S        GP++V    G  R G ++ + S+L Q++    VN    +K I  +R Y   +    +FI++ L   IL +
Sbjct:   16 YNKHKNRYINIVAYDHSRVKLRPLPGKDSKHSDYINANYVDGYNKAKAYIATQGPLKSTFEDFWRMIWEQNTGIIVMITNLVEKGRRKCDQYWPTENSDEYGNIMVTLKSTRVYACYTVRKFTIRNMKMKKKGNAKGRHNERTVMQYHYTQ-WPDMGVPEYALPVLTFVRRSSAVQLPEMGPVLVHCSAGVGRTGTYIVIDSMLQQIKDKSTVNALGFLKHIRTQRNYLVQTEEQYIFIHDALLEAILGK 264          
BLAST of Receptor type tyrosine protein phosphatase zeta vs. Ensembl Xenopus
Match: tfam (transcription factor A, mitochondrial [Source:Xenbase;Acc:XB-GENE-978256])

HSP 1 Score: 348.206 bits (892), Expect = 6.260e-109
Identity = 194/500 (38.80%), Postives = 288/500 (57.60%), Query Frame = 3
Query:   96 GFKRPYAYIATQGPLTETVADFWQMVWEQNSEIIVMISNFVERGRSKCEIYWSPNKTLNCGNISVHQIYQKEMAFYTERAFRIRNIRLKKNIK--------DRTVYHYQYTDWRDFDXXXXXXXXXXFVRATTKHWSESSGPIIVHCSAGVGRTGTYICIESQIRQLDQEHHINVRGFLEHIRQQRMKLVQTESQYTFIHDALYEYYLYPDREIHKLELSIYISKLKEFDASGCMKLDTQFKKCINFEPSDYDYMESKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSN-----ENMHQFWPGPDNNALTFRWFKVH-------CNSEKTEFSVQYSFLISSSREDYALDCTMHCLKYWPNTVSECSELLRLLFDINSKKYS--GPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELLEFVI 1529
            G+ +  AYIATQGPL  T  DFW+M+WEQN+ IIVMI+N VE+GR KC+ YW    +   GNI V     +  A YT R F IRN+++KK  K        +RTV  Y YT W D  VP  +LPVL FVR ++       GP++VHCSAGVGRTGTYI I+S ++Q+  +  +N  GFL+HIR QR  LVQTE QY FIHDAL E  L  + E+   +L  Y++ +      G  +L+ QF+          +   ++K  N  KNR+ +++P E  R+ L+  PG++G++YINAS I GY +  EFIITQHP+  T +DFW+M+WD N  +I++L +     E+   +WP  +  ++    F V        C S + +  + + F++ ++++DY L+        WPN  +  S    L+  I  +  +  GP +V DE+G+  AG   A+++L  Q+  ++ V+VY V KMI++ RP  F+      F+Y+ +  +I
Sbjct:  124 GYNKAKAYIATQGPLKSTFEDFWRMIWEQNTGIIVMITNLVEKGRRKCDQYWPTENSDEYGNIMVTLKSTRVYACYTVRKFTIRNMKMKKGQKGNAKGRHNERTVMQYHYTQWPDMGVPEYALPVLTFVRRSSAVQLPEMGPVLVHCSAGVGRTGTYIVIDSMLQQIKDKSTVNALGFLKHIRTQRNYLVQTEEQYIFIHDALLEAILGKETEVCANQLHSYVNSILTPGPGGRTRLEKQFRLVTQCNAKYVECFSAQKDSNKEKNRNSSVVPSERARVGLAPLPGMKGTDYINASYIMGYLRSNEFIITQHPMPHTTKDFWRMIWDHNAQIIVMLPDNQSLAEDEFVYWPSRE-ESMNCEAFTVTLISKDRLCLSNEEQIII-HDFILEATQDDYVLEVRHFQCPKWPNPDAPISSAFELINVIKEEALTRDGPTIVHDEFGAVSAGTLCALATLSQQMENENAVDVYQVAKMINLMRPGVFTDIEHYQFLYKAMLSLI 621          

HSP 2 Score: 92.0485 bits (227), Expect = 1.273e-18
Identity = 63/247 (25.51%), Postives = 112/247 (45.34%), Query Frame = 3
Query:  864 KNRSDTIMPIESRRINLSCEPGVEG--SNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSN------ENMHQFWPGPD-----NNALTFRWFKVHCNSEKTEFSVQYSFLISSSREDYA-----LDCTMHCLKYWPNTVSECSELLRLLFDINSKKYS----GPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELLEFVILNQ 1538
            KNR   I+  +  R+ L   PG +   S+YINA+ + GY + K +I TQ PL  T +DFW+M+W++N  +I++++N          Q+WP  +     N  +T +  +V+      +F+++   +    + +            +    WP+       L  L F   S        GP++V    G  R G ++ + S+L Q++    VN    +K I  +R Y   +    +FI++ L   IL +
Sbjct:   87 KNRYINIVAYDHSRVKLRPLPGKDSKHSDYINANYVDGYNKAKAYIATQGPLKSTFEDFWRMIWEQNTGIIVMITNLVEKGRRKCDQYWPTENSDEYGNIMVTLKSTRVYACYTVRKFTIRNMKMKKGQKGNAKGRHNERTVMQYHYTQWPDMGVPEYALPVLTFVRRSSAVQLPEMGPVLVHCSAGVGRTGTYIVIDSMLQQIKDKSTVNALGFLKHIRTQRNYLVQTEEQYIFIHDALLEAILGK 333          
BLAST of Receptor type tyrosine protein phosphatase zeta vs. Ensembl Xenopus
Match: PTPRZ1 (protein tyrosine phosphatase receptor type Z1 [Source:HGNC Symbol;Acc:HGNC:9685])

HSP 1 Score: 360.918 bits (925), Expect = 1.565e-107
Identity = 204/493 (41.38%), Postives = 295/493 (59.84%), Query Frame = 3
Query:   96 GFKRPYAYIATQGPLTETVADFWQMVWEQNSEIIVMISNFVERGRSKCEIYWSPNKTLNCGNISVHQIYQKEMAFYTERAFRIRNIRLKKNIK-----DRTVYHYQYTDWRDFDXXXXXXXXXXFVRATTKHWSESSGPIIVHCSAGVGRTGTYICIESQIRQLDQEHHINVRGFLEHIRQQRMKLVQTESQYTFIHDALYEYYLYPDREIHKLELSIYISKLKEFDASGCMKLDTQFKKCINFEPSDYDYMESKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILL-SNENMHQ----FWPGPDNNAL--TFRWFKV----HCNSEKTEFSVQYSFLISSSREDYALDCTMHCLKYWPN---TVSECSELLRLLFDINSKKYSGPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELL 1517
            G+ +  AYIA QGPL  T  DFW+M+WE N E+IVMI+N VE+GR KC+ YW  + +   G+  V     K +A+YT R F +RN ++KK  +     +RTV  Y YT W D  VP  +LPVL FVR  +      +GP++VHCSAGVGRTGTYI ++S ++Q+  E  +N+ GFL+HIR QR  LVQTE QY FIHDAL E  L  + E+ +  +  Y++ L     SG  +L+TQFK          DY  + K  N  KNR+ +I+P+E  R+ LS   G EG++YINAS + GY +  +FIITQHPL  T +DFW+M+WD N  LI++L  N+NM +    +WP  D   +  TF    V     C S + +  +Q  F++ ++++DY L+        WPN    +S+  E++ L+ +  + K  G I+V DEYG   AG F A+ SL+HQL +++ V++Y + KMI++ RP  F+      F+Y+ +
Sbjct:  910 GYNKQKAYIAAQGPLKSTAEDFWRMLWEHNVEVIVMITNLVEKGRRKCDQYWPSDGSEEYGSFLVTHKNTKVLAYYTVRTFILRNNKIKKGSQKGRHNERTVVQYHYTQWPDMGVPEYTLPVLTFVRKASATKCNGNGPVVVHCSAGVGRTGTYIVLDSMLKQIQHEGTVNIFGFLKHIRSQRNYLVQTEEQYIFIHDALVEAILSRETEVPESHIHGYVNTLLTTGPSGKSRLETQFKLLSEPNILQCDYSMALKPQNRDKNRTSSIIPVERSRVGLSSLAG-EGTDYINASYVMGYHESNQFIITQHPLLHTIKDFWRMMWDHNSQLIVMLPDNQNMAEDEFVYWPNKDQPIMCDTFTVSLVGEDHMCLSNEEKLIIQ-DFILEATQDDYVLEVRHFQCPKWPNPDSPISKTFEIINLIKEEATNK-DGTIIVHDEYGGVTAGTFCALYSLMHQLEQENSVDIYQLAKMINLMRPGIFTDIEQYQFLYKAM 1399          

HSP 2 Score: 93.9745 bits (232), Expect = 6.380e-19
Identity = 65/245 (26.53%), Postives = 122/245 (49.80%), Query Frame = 3
Query:  864 KNRSDTIMPIESRRINLSCEPGVEG--SNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSN------ENMHQFWPGPDNNALTFRWFKVHCNSEKTEFSVQYSFLISSSREDYALDCTMH----CLKY----WPNT-VSECS-ELLRLLFDINSKKY--SGPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELLEFVILNQ 1538
            KNR   I+  +  R+ LS     EG  ++YINA+ + GY + K +I  Q PL  T +DFW+M+W+ N  +I++++N          Q+WP  D +     +   H N++   +    +F++ +++         H     ++Y    WP+  V E +  +L  +   ++ K   +GP+VV    G  R G ++ + S+L Q++ +  VN++  +K I  +R Y   +    +FI++ L   IL++
Sbjct:  873 KNRYVNIVAYDHSRVKLSQLGEKEGKATDYINANFVDGYNKQKAYIAAQGPLKSTAEDFWRMLWEHNVEVIVMITNLVEKGRRKCDQYWPS-DGSEEYGSFLVTHKNTKVLAYYTVRTFILRNNKIKKGSQKGRHNERTVVQYHYTQWPDMGVPEYTLPVLTFVRKASATKCNGNGPVVVHCSAGVGRTGTYIVLDSMLKQIQHEGTVNIFGFLKHIRSQRNYLVQTEEQYIFIHDALVEAILSR 1116          
BLAST of Receptor type tyrosine protein phosphatase zeta vs. Ensembl Xenopus
Match: PTPRZ1 (protein tyrosine phosphatase receptor type Z1 [Source:HGNC Symbol;Acc:HGNC:9685])

HSP 1 Score: 359.762 bits (922), Expect = 1.610e-107
Identity = 204/493 (41.38%), Postives = 295/493 (59.84%), Query Frame = 3
Query:   96 GFKRPYAYIATQGPLTETVADFWQMVWEQNSEIIVMISNFVERGRSKCEIYWSPNKTLNCGNISVHQIYQKEMAFYTERAFRIRNIRLKKNIK-----DRTVYHYQYTDWRDFDXXXXXXXXXXFVRATTKHWSESSGPIIVHCSAGVGRTGTYICIESQIRQLDQEHHINVRGFLEHIRQQRMKLVQTESQYTFIHDALYEYYLYPDREIHKLELSIYISKLKEFDASGCMKLDTQFKKCINFEPSDYDYMESKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILL-SNENMHQ----FWPGPDNNAL--TFRWFKV----HCNSEKTEFSVQYSFLISSSREDYALDCTMHCLKYWPN---TVSECSELLRLLFDINSKKYSGPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELL 1517
            G+ +  AYIA QGPL  T  DFW+M+WE N E+IVMI+N VE+GR KC+ YW  + +   G+  V     K +A+YT R F +RN ++KK  +     +RTV  Y YT W D  VP  +LPVL FVR  +      +GP++VHCSAGVGRTGTYI ++S ++Q+  E  +N+ GFL+HIR QR  LVQTE QY FIHDAL E  L  + E+ +  +  Y++ L     SG  +L+TQFK          DY  + K  N  KNR+ +I+P+E  R+ LS   G EG++YINAS + GY +  +FIITQHPL  T +DFW+M+WD N  LI++L  N+NM +    +WP  D   +  TF    V     C S + +  +Q  F++ ++++DY L+        WPN    +S+  E++ L+ +  + K  G I+V DEYG   AG F A+ SL+HQL +++ V++Y + KMI++ RP  F+      F+Y+ +
Sbjct:  832 GYNKQKAYIAAQGPLKSTAEDFWRMLWEHNVEVIVMITNLVEKGRRKCDQYWPSDGSEEYGSFLVTHKNTKVLAYYTVRTFILRNNKIKKGSQKGRHNERTVVQYHYTQWPDMGVPEYTLPVLTFVRKASATKCNGNGPVVVHCSAGVGRTGTYIVLDSMLKQIQHEGTVNIFGFLKHIRSQRNYLVQTEEQYIFIHDALVEAILSRETEVPESHIHGYVNTLLTTGPSGKSRLETQFKLLSEPNILQCDYSMALKPQNRDKNRTSSIIPVERSRVGLSSLAG-EGTDYINASYVMGYHESNQFIITQHPLLHTIKDFWRMMWDHNSQLIVMLPDNQNMAEDEFVYWPNKDQPIMCDTFTVSLVGEDHMCLSNEEKLIIQ-DFILEATQDDYVLEVRHFQCPKWPNPDSPISKTFEIINLIKEEATNK-DGTIIVHDEYGGVTAGTFCALYSLMHQLEQENSVDIYQLAKMINLMRPGIFTDIEQYQFLYKAM 1321          

HSP 2 Score: 93.2041 bits (230), Expect = 8.868e-19
Identity = 66/248 (26.61%), Postives = 123/248 (49.60%), Query Frame = 3
Query:  855 NLVKNRSDTIMPIESRRINLSCEPGVEG--SNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSN------ENMHQFWPGPDNNALTFRWFKVHCNSEKTEFSVQYSFLISSSREDYALDCTMH----CLKY----WPNT-VSECS-ELLRLLFDINSKKY--SGPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELLEFVILNQ 1538
            N  KNR   I+  +  R+ LS     EG  ++YINA+ + GY + K +I  Q PL  T +DFW+M+W+ N  +I++++N          Q+WP  D +     +   H N++   +    +F++ +++         H     ++Y    WP+  V E +  +L  +   ++ K   +GP+VV    G  R G ++ + S+L Q++ +  VN++  +K I  +R Y   +    +FI++ L   IL++
Sbjct:  792 NKNKNRYVNIVAYDHSRVKLSQLGEKEGKATDYINANFVDGYNKQKAYIAAQGPLKSTAEDFWRMLWEHNVEVIVMITNLVEKGRRKCDQYWPS-DGSEEYGSFLVTHKNTKVLAYYTVRTFILRNNKIKKGSQKGRHNERTVVQYHYTQWPDMGVPEYTLPVLTFVRKASATKCNGNGPVVVHCSAGVGRTGTYIVLDSMLKQIQHEGTVNIFGFLKHIRSQRNYLVQTEEQYIFIHDALVEAILSR 1038          
BLAST of Receptor type tyrosine protein phosphatase zeta vs. Ensembl Xenopus
Match: PTPRZ1 (protein tyrosine phosphatase receptor type Z1 [Source:HGNC Symbol;Acc:HGNC:9685])

HSP 1 Score: 363.999 bits (933), Expect = 1.785e-107
Identity = 204/493 (41.38%), Postives = 295/493 (59.84%), Query Frame = 3
Query:   96 GFKRPYAYIATQGPLTETVADFWQMVWEQNSEIIVMISNFVERGRSKCEIYWSPNKTLNCGNISVHQIYQKEMAFYTERAFRIRNIRLKKNIK-----DRTVYHYQYTDWRDFDXXXXXXXXXXFVRATTKHWSESSGPIIVHCSAGVGRTGTYICIESQIRQLDQEHHINVRGFLEHIRQQRMKLVQTESQYTFIHDALYEYYLYPDREIHKLELSIYISKLKEFDASGCMKLDTQFKKCINFEPSDYDYMESKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILL-SNENMHQ----FWPGPDNNAL--TFRWFKV----HCNSEKTEFSVQYSFLISSSREDYALDCTMHCLKYWPN---TVSECSELLRLLFDINSKKYSGPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELL 1517
            G+ +  AYIA QGPL  T  DFW+M+WE N E+IVMI+N VE+GR KC+ YW  + +   G+  V     K +A+YT R F +RN ++KK  +     +RTV  Y YT W D  VP  +LPVL FVR  +      +GP++VHCSAGVGRTGTYI ++S ++Q+  E  +N+ GFL+HIR QR  LVQTE QY FIHDAL E  L  + E+ +  +  Y++ L     SG  +L+TQFK          DY  + K  N  KNR+ +I+P+E  R+ LS   G EG++YINAS + GY +  +FIITQHPL  T +DFW+M+WD N  LI++L  N+NM +    +WP  D   +  TF    V     C S + +  +Q  F++ ++++DY L+        WPN    +S+  E++ L+ +  + K  G I+V DEYG   AG F A+ SL+HQL +++ V++Y + KMI++ RP  F+      F+Y+ +
Sbjct: 1751 GYNKQKAYIAAQGPLKSTAEDFWRMLWEHNVEVIVMITNLVEKGRRKCDQYWPSDGSEEYGSFLVTHKNTKVLAYYTVRTFILRNNKIKKGSQKGRHNERTVVQYHYTQWPDMGVPEYTLPVLTFVRKASATKCNGNGPVVVHCSAGVGRTGTYIVLDSMLKQIQHEGTVNIFGFLKHIRSQRNYLVQTEEQYIFIHDALVEAILSRETEVPESHIHGYVNTLLTTGPSGKSRLETQFKLLSEPNILQCDYSMALKPQNRDKNRTSSIIPVERSRVGLSSLAG-EGTDYINASYVMGYHESNQFIITQHPLLHTIKDFWRMMWDHNSQLIVMLPDNQNMAEDEFVYWPNKDQPIMCDTFTVSLVGEDHMCLSNEEKLIIQ-DFILEATQDDYVLEVRHFQCPKWPNPDSPISKTFEIINLIKEEATNK-DGTIIVHDEYGGVTAGTFCALYSLMHQLEQENSVDIYQLAKMINLMRPGIFTDIEQYQFLYKAM 2240          

HSP 2 Score: 92.8189 bits (229), Expect = 1.400e-18
Identity = 65/245 (26.53%), Postives = 122/245 (49.80%), Query Frame = 3
Query:  864 KNRSDTIMPIESRRINLSCEPGVEG--SNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSN------ENMHQFWPGPDNNALTFRWFKVHCNSEKTEFSVQYSFLISSSREDYALDCTMH----CLKY----WPNT-VSECS-ELLRLLFDINSKK--YSGPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELLEFVILNQ 1538
            KNR   I+  +  R+ LS     EG  ++YINA+ + GY + K +I  Q PL  T +DFW+M+W+ N  +I++++N          Q+WP  D +     +   H N++   +    +F++ +++         H     ++Y    WP+  V E +  +L  +   ++ K   +GP+VV    G  R G ++ + S+L Q++ +  VN++  +K I  +R Y   +    +FI++ L   IL++
Sbjct: 1714 KNRYVNIVAYDHSRVKLSQLGEKEGKATDYINANFVDGYNKQKAYIAAQGPLKSTAEDFWRMLWEHNVEVIVMITNLVEKGRRKCDQYWPS-DGSEEYGSFLVTHKNTKVLAYYTVRTFILRNNKIKKGSQKGRHNERTVVQYHYTQWPDMGVPEYTLPVLTFVRKASATKCNGNGPVVVHCSAGVGRTGTYIVLDSMLKQIQHEGTVNIFGFLKHIRSQRNYLVQTEEQYIFIHDALVEAILSR 1957          
BLAST of Receptor type tyrosine protein phosphatase zeta vs. Ensembl Mouse
Match: Ptprg (protein tyrosine phosphatase, receptor type, G [Source:MGI Symbol;Acc:MGI:97814])

HSP 1 Score: 355.91 bits (912), Expect = 9.035e-112
Identity = 197/500 (39.40%), Postives = 289/500 (57.80%), Query Frame = 3
Query:   96 GFKRPYAYIATQGPLTETVADFWQMVWEQNSEIIVMISNFVERGRSKCEIYWSPNKTLNCGNISVHQIYQKEMAFYTERAFRIRNIRLKKNIK--------DRTVYHYQYTDWRDFDXXXXXXXXXXFVRATTKHWSESSGPIIVHCSAGVGRTGTYICIESQIRQLDQEHHINVRGFLEHIRQQRMKLVQTESQYTFIHDALYEYYLYPDREIHKLELSIYISKLKEFDASGCMKLDTQFKKCINFEPSDYDYMESKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSN-----ENMHQFWPGPDNNALTFRWFKVH-------CNSEKTEFSVQYSFLISSSREDYALDCTMHCLKYWPNTVSECSELLRLLFDINSKKYS--GPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELLEFVI 1529
            G+ +  AYIATQGPL  T  DFW+M+WEQN+ II+MI+N VE+GR KC+ YW    T   GNI V     K  A YT R   +RN ++KK  K        +RTV  Y YT W D  VP  +LPVL FVR ++       GP++VHCSAGVGRTGTYI I+S ++Q+  +  +NV GFL+HIR QR  LVQTE QY FIHDAL E  L  + E+   +L  Y++ +      G  +L+ QFK          +   ++K  N  KNR+ +++P E  R+ L+  PG++G++YINAS I GY++  EFIITQHPL  T +DFW+M+WD N  +I++L +     E+   +WP  +  ++    F V        C S + +  + + F++ ++++DY L+        WPN  +  S    L+  I  +  +  GP +V DEYG+  AG+  A+++L  QL  ++ V+V+ V KMI++ RP  F+      F+Y+ +  +I
Sbjct:  136 GYNKAKAYIATQGPLKSTFEDFWRMIWEQNTGIIIMITNLVEKGRRKCDQYWPTENTEEYGNIIVTLKSTKVHACYTVRRLSVRNTKVKKGQKGNPKGRQNERTVIQYHYTQWPDMGVPEYALPVLTFVRRSSAARMPDMGPVLVHCSAGVGRTGTYIVIDSMLQQIKDKSTVNVLGFLKHIRTQRNYLVQTEEQYIFIHDALLEAILGKETEVSSSQLHSYVNSILIPGVGGKTRLEKQFKLITQCNAKYVECFSAQKECNKEKNRNSSVVPAERARVGLAPLPGMKGTDYINASYIMGYYRSNEFIITQHPLPHTTKDFWRMIWDHNAQIIVMLPDNQSLAEDEFVYWPSRE-ESMNCEAFTVTLISKDRLCLSNEEQIII-HDFILEATQDDYVLEVRHFQCPKWPNPDAPISSTFELINVIKEEALTRDGPTIVHDEYGAVSAGMLCALTTLSQQLENENAVDVFQVAKMINLMRPGVFTDIEQYQFVYKAMLSLI 633          

HSP 2 Score: 97.4413 bits (241), Expect = 2.124e-20
Identity = 70/248 (28.23%), Postives = 114/248 (45.97%), Query Frame = 3
Query:  864 KNRSDTIMPIESRRINLSCEPGVEG--SNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSN------ENMHQFWPGPD-----NNALTFRWFKVHCNSEKTEFSVQYSFLISS------SREDYALDCTMHCLKYWPNTVSECSELLRLLFDINSKKYS----GPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELLEFVILNQ 1538
            KNR   I+  +  R+ L   PG +   S+YINA+ + GY + K +I TQ PL  T +DFW+M+W++N  +II+++N          Q+WP  +     N  +T +  KVH        SV+ + +          R++       H  + WP+       L  L F   S        GP++V    G  R G ++ + S+L Q++    VNV   +K I  +R Y   +    +FI++ L   IL +
Sbjct:   99 KNRYINILAYDHSRVKLRPLPGKDSKHSDYINANYVDGYNKAKAYIATQGPLKSTFEDFWRMIWEQNTGIIIMITNLVEKGRRKCDQYWPTENTEEYGNIIVTLKSTKVHACYTVRRLSVRNTKVKKGQKGNPKGRQNERTVIQYHYTQ-WPDMGVPEYALPVLTFVRRSSAARMPDMGPVLVHCSAGVGRTGTYIVIDSMLQQIKDKSTVNVLGFLKHIRTQRNYLVQTEEQYIFIHDALLEAILGK 345          
BLAST of Receptor type tyrosine protein phosphatase zeta vs. Ensembl Mouse
Match: Ptprz1 (protein tyrosine phosphatase, receptor type Z, polypeptide 1 [Source:MGI Symbol;Acc:MGI:97816])

HSP 1 Score: 370.933 bits (951), Expect = 3.075e-111
Identity = 204/493 (41.38%), Postives = 295/493 (59.84%), Query Frame = 3
Query:   96 GFKRPYAYIATQGPLTETVADFWQMVWEQNSEIIVMISNFVERGRSKCEIYWSPNKTLNCGNISVHQIYQKEMAFYTERAFRIRNIRLKKNIKD-----RTVYHYQYTDWRDFDXXXXXXXXXXFVRATTKHWSESSGPIIVHCSAGVGRTGTYICIESQIRQLDQEHHINVRGFLEHIRQQRMKLVQTESQYTFIHDALYEYYLYPDREIHKLELSIYISKLKEFDASGCMKLDTQFKKCINFEPSDYDYMESKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSN-ENMHQ----FWPGPDNNALTFRWFKV-------HCNSEKTEFSVQYSFLISSSREDYALDCTMHCLKYWPNTVSECSELLRLLFDINSKKYS--GPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELL 1517
            G+ RP AYIA QGPL  T  DFW+M+WE N E+IVMI+N VE+GR KC+ YW  + +   G+  V+Q   + +A+YT R F +RN +LKK  +      R V  Y YT W D  VP  SLPVL FVR   +    + GP++VHCSAGVGRTGTYI ++S ++Q+  E  +N+ GFL+HIR QR  LVQTE QY FIHD L E  L  + E+    +  Y++ L     +G  KL+ QF+          DY  + K+ N  KNR+ +I+P+E  R+ +S   G EG++YINAS I GY+Q  EFIITQHPL  T +DFW+M+WD N  L++++ + +NM +    +WP  D   +    FKV        C S + +  VQ  F++ ++++DY L+        WPN  S  S+   L+  I  +  +  GP++V DE+G   AG F A+++L+HQL K++ ++VY V KMI++ RP  F+      F+Y+++
Sbjct:  938 GYNRPKAYIAAQGPLKSTAEDFWRMIWEHNVEVIVMITNLVEKGRRKCDQYWPTDGSEEYGSFLVNQKSVQVLAYYTVRNFTLRNTKLKKGSQKGRSSGRLVTQYHYTQWPDMGVPEYSLPVLAFVRKAAQAKRHAVGPVVVHCSAGVGRTGTYIVLDSMLQQIQHEGTVNIFGFLKHIRSQRNYLVQTEEQYVFIHDTLVEAILSKETEVPDSHIHSYVNTLLIPGPTGKTKLEKQFQLLSQSNILQSDYSTALKQCNREKNRTSSIIPVERSRVGISSLSG-EGTDYINASYIMGYYQSNEFIITQHPLLHTIKDFWRMIWDHNAQLVVMIPDGQNMAEDEFVYWPNKD-EPINCESFKVTLMSEEHKCLSNEEKLIVQ-DFILEATQDDYVLEVRHFQCPKWPNPDSPISKTFELISIIKEEAANRDGPMIVHDEHGGVTAGTFCALTTLMHQLEKENAMDVYQVAKMINLMRPGVFTDIEQYQFLYKVV 1427          

HSP 2 Score: 90.5077 bits (223), Expect = 4.977e-18
Identity = 64/246 (26.02%), Postives = 121/246 (49.19%), Query Frame = 3
Query:  864 KNRSDTIMPIESRRINLS--CEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSN------ENMHQFWPGPDNNALTFRWFKVHCNSEKT-------EFSVQYSFLISSSREDYALD--CTMHCLKYWPNTVSECSELLRLLF---DINSKKYS-GPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELLEFVILNQ 1538
            KNR   I+  +  R+ L+   E   + ++YINA+ + GY + K +I  Q PL  T +DFW+M+W+ N  +I++++N          Q+W  P + +  +  F V+  S +         F+++ + L   S++  +     T +    WP+       L  L F      +K+++ GP+VV    G  R G ++ + S+L Q++ +  VN++  +K I  +R Y   +    +FI++ L   IL++
Sbjct:  901 KNRYVNIVAYDHSRVKLTQLAEKDGKLTDYINANYVDGYNRPKAYIAAQGPLKSTAEDFWRMIWEHNVEVIVMITNLVEKGRRKCDQYW--PTDGSEEYGSFLVNQKSVQVLAYYTVRNFTLRNTKLKKGSQKGRSSGRLVTQYHYTQWPDMGVPEYSLPVLAFVRKAAQAKRHAVGPVVVHCSAGVGRTGTYIVLDSMLQQIQHEGTVNIFGFLKHIRSQRNYLVQTEEQYVFIHDTLVEAILSK 1144          
BLAST of Receptor type tyrosine protein phosphatase zeta vs. Ensembl Mouse
Match: Ptprz1 (protein tyrosine phosphatase, receptor type Z, polypeptide 1 [Source:MGI Symbol;Acc:MGI:97816])

HSP 1 Score: 374.4 bits (960), Expect = 3.480e-111
Identity = 204/493 (41.38%), Postives = 295/493 (59.84%), Query Frame = 3
Query:   96 GFKRPYAYIATQGPLTETVADFWQMVWEQNSEIIVMISNFVERGRSKCEIYWSPNKTLNCGNISVHQIYQKEMAFYTERAFRIRNIRLKKNIKD-----RTVYHYQYTDWRDFDXXXXXXXXXXFVRATTKHWSESSGPIIVHCSAGVGRTGTYICIESQIRQLDQEHHINVRGFLEHIRQQRMKLVQTESQYTFIHDALYEYYLYPDREIHKLELSIYISKLKEFDASGCMKLDTQFKKCINFEPSDYDYMESKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSN-ENMHQ----FWPGPDNNALTFRWFKV-------HCNSEKTEFSVQYSFLISSSREDYALDCTMHCLKYWPNTVSECSELLRLLFDINSKKYS--GPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELL 1517
            G+ RP AYIA QGPL  T  DFW+M+WE N E+IVMI+N VE+GR KC+ YW  + +   G+  V+Q   + +A+YT R F +RN +LKK  +      R V  Y YT W D  VP  SLPVL FVR   +    + GP++VHCSAGVGRTGTYI ++S ++Q+  E  +N+ GFL+HIR QR  LVQTE QY FIHD L E  L  + E+    +  Y++ L     +G  KL+ QF+          DY  + K+ N  KNR+ +I+P+E  R+ +S   G EG++YINAS I GY+Q  EFIITQHPL  T +DFW+M+WD N  L++++ + +NM +    +WP  D   +    FKV        C S + +  VQ  F++ ++++DY L+        WPN  S  S+   L+  I  +  +  GP++V DE+G   AG F A+++L+HQL K++ ++VY V KMI++ RP  F+      F+Y+++
Sbjct: 1787 GYNRPKAYIAAQGPLKSTAEDFWRMIWEHNVEVIVMITNLVEKGRRKCDQYWPTDGSEEYGSFLVNQKSVQVLAYYTVRNFTLRNTKLKKGSQKGRSSGRLVTQYHYTQWPDMGVPEYSLPVLAFVRKAAQAKRHAVGPVVVHCSAGVGRTGTYIVLDSMLQQIQHEGTVNIFGFLKHIRSQRNYLVQTEEQYVFIHDTLVEAILSKETEVPDSHIHSYVNTLLIPGPTGKTKLEKQFQLLSQSNILQSDYSTALKQCNREKNRTSSIIPVERSRVGISSLSG-EGTDYINASYIMGYYQSNEFIITQHPLLHTIKDFWRMIWDHNAQLVVMIPDGQNMAEDEFVYWPNKD-EPINCESFKVTLMSEEHKCLSNEEKLIVQ-DFILEATQDDYVLEVRHFQCPKWPNPDSPISKTFELISIIKEEAANRDGPMIVHDEHGGVTAGTFCALTTLMHQLEKENAMDVYQVAKMINLMRPGVFTDIEQYQFLYKVV 2276          

HSP 2 Score: 90.1225 bits (222), Expect = 8.369e-18
Identity = 64/246 (26.02%), Postives = 121/246 (49.19%), Query Frame = 3
Query:  864 KNRSDTIMPIESRRINLS--CEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSN------ENMHQFWPGPDNNALTFRWFKVHCNSEKT-------EFSVQYSFLISSSREDYALD--CTMHCLKYWPNTVSECSELLRLLF---DINSKKYS-GPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELLEFVILNQ 1538
            KNR   I+  +  R+ L+   E   + ++YINA+ + GY + K +I  Q PL  T +DFW+M+W+ N  +I++++N          Q+W  P + +  +  F V+  S +         F+++ + L   S++  +     T +    WP+       L  L F      +K+++ GP+VV    G  R G ++ + S+L Q++ +  VN++  +K I  +R Y   +    +FI++ L   IL++
Sbjct: 1750 KNRYVNIVAYDHSRVKLTQLAEKDGKLTDYINANYVDGYNRPKAYIAAQGPLKSTAEDFWRMIWEHNVEVIVMITNLVEKGRRKCDQYW--PTDGSEEYGSFLVNQKSVQVLAYYTVRNFTLRNTKLKKGSQKGRSSGRLVTQYHYTQWPDMGVPEYSLPVLAFVRKAAQAKRHAVGPVVVHCSAGVGRTGTYIVLDSMLQQIQHEGTVNIFGFLKHIRSQRNYLVQTEEQYVFIHDTLVEAILSK 1993          
BLAST of Receptor type tyrosine protein phosphatase zeta vs. Ensembl Mouse
Match: Ptprg (protein tyrosine phosphatase, receptor type, G [Source:MGI Symbol;Acc:MGI:97814])

HSP 1 Score: 357.451 bits (916), Expect = 1.833e-106
Identity = 197/500 (39.40%), Postives = 289/500 (57.80%), Query Frame = 3
Query:   96 GFKRPYAYIATQGPLTETVADFWQMVWEQNSEIIVMISNFVERGRSKCEIYWSPNKTLNCGNISVHQIYQKEMAFYTERAFRIRNIRLKKNIK--------DRTVYHYQYTDWRDFDXXXXXXXXXXFVRATTKHWSESSGPIIVHCSAGVGRTGTYICIESQIRQLDQEHHINVRGFLEHIRQQRMKLVQTESQYTFIHDALYEYYLYPDREIHKLELSIYISKLKEFDASGCMKLDTQFKKCINFEPSDYDYMESKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSN-----ENMHQFWPGPDNNALTFRWFKVH-------CNSEKTEFSVQYSFLISSSREDYALDCTMHCLKYWPNTVSECSELLRLLFDINSKKYS--GPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELLEFVI 1529
            G+ +  AYIATQGPL  T  DFW+M+WEQN+ II+MI+N VE+GR KC+ YW    T   GNI V     K  A YT R   +RN ++KK  K        +RTV  Y YT W D  VP  +LPVL FVR ++       GP++VHCSAGVGRTGTYI I+S ++Q+  +  +NV GFL+HIR QR  LVQTE QY FIHDAL E  L  + E+   +L  Y++ +      G  +L+ QFK          +   ++K  N  KNR+ +++P E  R+ L+  PG++G++YINAS I GY++  EFIITQHPL  T +DFW+M+WD N  +I++L +     E+   +WP  +  ++    F V        C S + +  + + F++ ++++DY L+        WPN  +  S    L+  I  +  +  GP +V DEYG+  AG+  A+++L  QL  ++ V+V+ V KMI++ RP  F+      F+Y+ +  +I
Sbjct:  911 GYNKAKAYIATQGPLKSTFEDFWRMIWEQNTGIIIMITNLVEKGRRKCDQYWPTENTEEYGNIIVTLKSTKVHACYTVRRLSVRNTKVKKGQKGNPKGRQNERTVIQYHYTQWPDMGVPEYALPVLTFVRRSSAARMPDMGPVLVHCSAGVGRTGTYIVIDSMLQQIKDKSTVNVLGFLKHIRTQRNYLVQTEEQYIFIHDALLEAILGKETEVSSSQLHSYVNSILIPGVGGKTRLEKQFKLITQCNAKYVECFSAQKECNKEKNRNSSVVPAERARVGLAPLPGMKGTDYINASYIMGYYRSNEFIITQHPLPHTTKDFWRMIWDHNAQIIVMLPDNQSLAEDEFVYWPSRE-ESMNCEAFTVTLISKDRLCLSNEEQIII-HDFILEATQDDYVLEVRHFQCPKWPNPDAPISSTFELINVIKEEALTRDGPTIVHDEYGAVSAGMLCALTTLSQQLENENAVDVFQVAKMINLMRPGVFTDIEQYQFVYKAMLSLI 1408          

HSP 2 Score: 97.8265 bits (242), Expect = 2.708e-20
Identity = 71/251 (28.29%), Postives = 115/251 (45.82%), Query Frame = 3
Query:  855 NLVKNRSDTIMPIESRRINLSCEPGVEG--SNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSN------ENMHQFWPGPD-----NNALTFRWFKVHCNSEKTEFSVQYSFLISS------SREDYALDCTMHCLKYWPNTVSECSELLRLLFDINSKKYS----GPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELLEFVILNQ 1538
            N  KNR   I+  +  R+ L   PG +   S+YINA+ + GY + K +I TQ PL  T +DFW+M+W++N  +II+++N          Q+WP  +     N  +T +  KVH        SV+ + +          R++       H  + WP+       L  L F   S        GP++V    G  R G ++ + S+L Q++    VNV   +K I  +R Y   +    +FI++ L   IL +
Sbjct:  871 NKHKNRYINILAYDHSRVKLRPLPGKDSKHSDYINANYVDGYNKAKAYIATQGPLKSTFEDFWRMIWEQNTGIIIMITNLVEKGRRKCDQYWPTENTEEYGNIIVTLKSTKVHACYTVRRLSVRNTKVKKGQKGNPKGRQNERTVIQYHYTQ-WPDMGVPEYALPVLTFVRRSSAARMPDMGPVLVHCSAGVGRTGTYIVIDSMLQQIKDKSTVNVLGFLKHIRTQRNYLVQTEEQYIFIHDALLEAILGK 1120          
BLAST of Receptor type tyrosine protein phosphatase zeta vs. Ensembl Mouse
Match: Ptprd (protein tyrosine phosphatase, receptor type, D [Source:MGI Symbol;Acc:MGI:97812])

HSP 1 Score: 277.715 bits (709), Expect = 6.168e-79
Identity = 164/492 (33.33%), Postives = 257/492 (52.24%), Query Frame = 3
Query:   96 GFKRPYAYIATQGPLTETVADFWQMVWEQNSEIIVMISNFVERGRSKCEIYWSPNKTLNCGNISVHQIYQKEMAFYTERAFRIRNIRLKKNIKDRTVYHYQYTDWRDFDXXXXXXXXXXFVRATTKHWSESSGPIIVHCSAGVGRTGTYICIESQIRQLDQEHHINVRGFLEHIRQQRMKLVQTESQYTFIHDALYEYYLYPDREIHKLELSIYISKLKEFD-ASGCMKLDTQFKKCINFEPSDYDYMESKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSN------ENMHQFWPGPDNNALTFRWFKVHCNSE-KTEFSVQYSFLISSSREDYALDCTMHCLKYWP-NTVSECSE-LLRLLFDINSKK----YSGPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYE-LLEFV 1526
            G+++  AYIATQG L ET  DFW+M+WEQ S  +VM++   ER R KC+ YW    T   G + V  +   E+A Y  R F +       + + R V  +Q+T W D  VP    P L F+R         +GP++VHCSAGVGRTG +I I++ + ++  E  +++ G +  +R QR  +VQTE QY FIHDAL E     + E+    L  YI KL + +       ++ +FK+  + +     ++ +    N  KNR   IMP ES R+ L    GVEGS+YINAS + GY Q K +I TQ PL ET +DFW+M+W+ N +++++L+       E  HQ+WP     +  +++F V   +E      +   F ++ +R+  +          WP   V +  E  +  +  ++  K      GPI V    G  R G+F+ +S +L ++R + VV+++  +KM+  +RP    +     F Y   LE++
Sbjct:  760 GYRKQNAYIATQGSLPETFGDFWRMIWEQRSATVVMMTKLEERSRVKCDQYWPSRGTETHGLVQVTLLDTVELATYCVRTFALYK---NGSSEKREVRQFQFTAWPDHGVPEHPTPFLAFLRRVKTCNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRAQRNYMVQTEDQYIFIHDALLEAVTCGNTEVPARNLYAYIQKLTQIETGENVTGMELEFKRLASSKAHTSRFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFLDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPA--ERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDQYQFCYRAALEYL 1246          

HSP 2 Score: 93.5893 bits (231), Expect = 5.664e-19
Identity = 70/302 (23.18%), Postives = 138/302 (45.70%), Query Frame = 3
Query:  720 LELSIYISKLKEFDASGCMKLDTQFKKCINFEPSD-YDYMESKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILL------SNENMHQFWPGPDNNALTFRWFKVHCNSEKTEFSVQYSFLISSSREDYALDCTMHCLKYWPN--TVSECSELLRLLFDINS--KKYSGPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYE-LLEFV------ILNQHLYTFFSRSQQ 1571
            LEL+ +I +LK   A+  +K   +++   + +P   + +  S    N  KNR   ++  +  R+ LS   G+ GS+Y+NA+ I GY +   +I TQ  L ET  DFW+M+W++  + ++++      S     Q+WP             +    E   + V+ +F +  +      +        WP+       +  L  L  + +     +GP+VV    G  R G F+ + ++L +++ +  V++Y  + ++  +R Y   +    +FI++ LLE V      +  ++LY +  +  Q
Sbjct:  682 LELADHIERLK---ANDNLKFSQEYE---SIDPGQQFTWEHSNLEVNKPKNRYANVIAYDHSRVLLSAIEGIPGSDYVNANYIDGYRKQNAYIATQGSLPETFGDFWRMIWEQRSATVVMMTKLEERSRVKCDQYWPSRGTETHGLVQVTLLDTVELATYCVR-TFALYKNGSSEKREVRQFQFTAWPDHGVPEHPTPFLAFLRRVKTCNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRAQRNYMVQTEDQYIFIHDALLEAVTCGNTEVPARNLYAYIQKLTQ 976          
BLAST of Receptor type tyrosine protein phosphatase zeta vs. UniProt/SwissProt
Match: sp|P23471|PTPRZ_HUMAN (Receptor-type tyrosine-protein phosphatase zeta OS=Homo sapiens OX=9606 GN=PTPRZ1 PE=1 SV=4)

HSP 1 Score: 375.941 bits (964), Expect = 7.375e-111
Identity = 204/493 (41.38%), Postives = 293/493 (59.43%), Query Frame = 3
Query:   96 GFKRPYAYIATQGPLTETVADFWQMVWEQNSEIIVMISNFVERGRSKCEIYWSPNKTLNCGNISVHQIYQKEMAFYTERAFRIRNIRLKKNIKD-----RTVYHYQYTDWRDFDXXXXXXXXXXFVRATTKHWSESSGPIIVHCSAGVGRTGTYICIESQIRQLDQEHHINVRGFLEHIRQQRMKLVQTESQYTFIHDALYEYYLYPDREIHKLELSIYISKLKEFDASGCMKLDTQFKKCINFEPSDYDYMESKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSN-ENMHQ----FWPGPDNNALTFRWFKV-------HCNSEKTEFSVQYSFLISSSREDYALDCTMHCLKYWPNTVSECSELLRLLFDINSKKYS--GPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELL 1517
            G+ RP AYIA QGPL  T  DFW+M+WE N E+IVMI+N VE+GR KC+ YW  + +   GN  V Q   + +A+YT R F +RN ++KK  +      R V  Y YT W D  VP  SLPVL FVR        + GP++VHCSAGVGRTGTYI ++S ++Q+  E  +N+ GFL+HIR QR  LVQTE QY FIHD L E  L  + E+    +  Y++ L     +G  KL+ QF+          DY  + K+ N  KNR+ +I+P+E  R+ +S   G EG++YINAS I GY+Q  EFIITQHPL  T +DFW+M+WD N  L++++ + +NM +    +WP  D   +    FKV        C S + +  +Q  F++ ++++DY L+        WPN  S  S+   L+  I  +  +  GP++V DE+G   AG F A+++L+HQL K++ V+VY V KMI++ RP  F+      F+Y+++
Sbjct: 1790 GYNRPKAYIAAQGPLKSTAEDFWRMIWEHNVEVIVMITNLVEKGRRKCDQYWPADGSEEYGNFLVTQKSVQVLAYYTVRNFTLRNTKIKKGSQKGRPSGRVVTQYHYTQWPDMGVPEYSLPVLTFVRKAAYAKRHAVGPVVVHCSAGVGRTGTYIVLDSMLQQIQHEGTVNIFGFLKHIRSQRNYLVQTEEQYVFIHDTLVEAILSKETEVLDSHIHAYVNALLIPGPAGKTKLEKQFQLLSQSNIQQSDYSAALKQCNREKNRTSSIIPVERSRVGISSLSG-EGTDYINASYIMGYYQSNEFIITQHPLLHTIKDFWRMIWDHNAQLVVMIPDGQNMAEDEFVYWPNKD-EPINCESFKVTLMAEEHKCLSNEEKLIIQ-DFILEATQDDYVLEVRHFQCPKWPNPDSPISKTFELISVIKEEAANRDGPMIVHDEHGGVTAGTFCALTTLMHQLEKENSVDVYQVAKMINLMRPGVFADIEQYQFLYKVI 2279          

HSP 2 Score: 90.1225 bits (222), Expect = 6.059e-17
Identity = 66/258 (25.58%), Postives = 123/258 (47.67%), Query Frame = 3
Query:  864 KNRSDTIMPIESRRINLS--CEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSN------ENMHQFWPGP-----DNNALTFRWFKVHCNSEKTEFSVQYSFLISSSREDYALD--CTMHCLKYWPNT-VSECSELLRLLFDINSKKYS-----GPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELL-------EFVILNQHLYTF 1553
            KNR   I+  +  R+ L+   E   + ++YINA+ + GY + K +I  Q PL  T +DFW+M+W+ N  +I++++N          Q+WP        N  +T +  +V        F+++ + +   S++        T +    WP+  V E S  L +L  +    Y+     GP+VV    G  R G ++ + S+L Q++ +  VN++  +K I  +R Y   +    +FI++ L       E  +L+ H++ +
Sbjct: 1753 KNRYINIVAYDHSRVKLAQLAEKDGKLTDYINANYVDGYNRPKAYIAAQGPLKSTAEDFWRMIWEHNVEVIVMITNLVEKGRRKCDQYWPADGSEEYGNFLVTQKSVQVLAYYTVRNFTLRNTKIKKGSQKGRPSGRVVTQYHYTQWPDMGVPEYS--LPVLTFVRKAAYAKRHAVGPVVVHCSAGVGRTGTYIVLDSMLQQIQHEGTVNIFGFLKHIRSQRNYLVQTEEQYVFIHDTLVEAILSKETEVLDSHIHAY 2008          
BLAST of Receptor type tyrosine protein phosphatase zeta vs. UniProt/SwissProt
Match: sp|Q62656|PTPRZ_RAT (Receptor-type tyrosine-protein phosphatase zeta OS=Rattus norvegicus OX=10116 GN=Ptprz1 PE=1 SV=1)

HSP 1 Score: 374.785 bits (961), Expect = 2.074e-110
Identity = 205/493 (41.58%), Postives = 296/493 (60.04%), Query Frame = 3
Query:   96 GFKRPYAYIATQGPLTETVADFWQMVWEQNSEIIVMISNFVERGRSKCEIYWSPNKTLNCGNISVHQIYQKEMAFYTERAFRIRNIRLKKNIKD-----RTVYHYQYTDWRDFDXXXXXXXXXXFVRATTKHWSESSGPIIVHCSAGVGRTGTYICIESQIRQLDQEHHINVRGFLEHIRQQRMKLVQTESQYTFIHDALYEYYLYPDREIHKLELSIYISKLKEFDASGCMKLDTQFKKCINFEPSDYDYMESKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSN-ENMHQ----FWPGPDNNALTFRWFKV-------HCNSEKTEFSVQYSFLISSSREDYALDCTMHCLKYWPNTVSECSELLRLLFDINSKKYS--GPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELL 1517
            G+ RP AYIA QGPL  T  DFW+M+WE N E+IVMI+N VE+GR KC+ YW  + +   G+  V+Q   + +A+YT R F +RN ++KK  +      R V  Y YT W D  VP  SLPVL FVR T +    + GP++VHCSAGVGRTGTYI ++S ++Q+  E  +N+ GFL+HIR QR  LVQTE QY FIHD L E  L  + E+    +  Y++ L     SG  KL+ QF+          DY  + K+ N  KNR+ +I+P+E  R+ +S   G EG++YINAS I GY+Q  EFIITQHPL  T +DFW+M+WD N  L++++ + +NM +    +WP  D   +    FKV        C S + +  VQ  F++ ++++DY L+        WPN  S  S+   L+  I  +  +  GP++V DE+G   AG F A+++L+HQL K++ ++VY V KMI++ RP  F+      F+Y+++
Sbjct: 1791 GYNRPKAYIAAQGPLKSTAEDFWRMIWEHNVEVIVMITNLVEKGRRKCDQYWPTDGSEEYGSFLVNQKNVQVLAYYTVRNFTLRNTKIKKGSQKGRSSGRLVTQYHYTQWPDMGVPEYSLPVLAFVRKTAQAKRHAVGPVVVHCSAGVGRTGTYIVLDSMLQQIQHEGTVNIFGFLKHIRSQRNYLVQTEEQYVFIHDTLVEAILSKETEVPDSHIHSYVNTLLIPGPSGKTKLEKQFQLLSQSNILQSDYSTALKQCNREKNRTSSIIPVERSRVGISSLSG-EGTDYINASYIMGYYQSNEFIITQHPLLHTIKDFWRMIWDHNAQLVVMIPDGQNMAEDEFVYWPNKD-EPINCESFKVTLMSEEHKCLSNEEKLIVQ-DFILEATQDDYVLEVRHFQCPKWPNPDSPISKTFELISIIKEEAANRDGPMIVHDEHGGVTAGTFCALTTLMHQLEKENSMDVYQVAKMINLMRPGVFTDIEQYQFLYKVV 2280          

HSP 2 Score: 87.4261 bits (215), Expect = 3.752e-16
Identity = 62/246 (25.20%), Postives = 121/246 (49.19%), Query Frame = 3
Query:  864 KNRSDTIMPIESRRINLS--CEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSN------ENMHQFWPGPDNNALTFRWFKVHCNSEKT-------EFSVQYSFLISSSREDYALD--CTMHCLKYWPNTVSECSELLRLLF---DINSKKYS-GPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELLEFVILNQ 1538
            KNR   I+  +  R+ L+   E   + ++YINA+ + GY + K +I  Q PL  T +DFW+M+W+ N  +I++++N          Q+WP   + +  +  F V+  + +         F+++ + +   S++  +     T +    WP+       L  L F      +K+++ GP+VV    G  R G ++ + S+L Q++ +  VN++  +K I  +R Y   +    +FI++ L   IL++
Sbjct: 1754 KNRYVNIVAYDHSRVKLTQLAEKDGKLTDYINANYVDGYNRPKAYIAAQGPLKSTAEDFWRMIWEHNVEVIVMITNLVEKGRRKCDQYWP--TDGSEEYGSFLVNQKNVQVLAYYTVRNFTLRNTKIKKGSQKGRSSGRLVTQYHYTQWPDMGVPEYSLPVLAFVRKTAQAKRHAVGPVVVHCSAGVGRTGTYIVLDSMLQQIQHEGTVNIFGFLKHIRSQRNYLVQTEEQYVFIHDTLVEAILSK 1997          
BLAST of Receptor type tyrosine protein phosphatase zeta vs. UniProt/SwissProt
Match: sp|B9EKR1|PTPRZ_MOUSE (Receptor-type tyrosine-protein phosphatase zeta OS=Mus musculus OX=10090 GN=Ptprz1 PE=1 SV=1)

HSP 1 Score: 374.4 bits (960), Expect = 2.435e-110
Identity = 204/493 (41.38%), Postives = 295/493 (59.84%), Query Frame = 3
Query:   96 GFKRPYAYIATQGPLTETVADFWQMVWEQNSEIIVMISNFVERGRSKCEIYWSPNKTLNCGNISVHQIYQKEMAFYTERAFRIRNIRLKKNIKD-----RTVYHYQYTDWRDFDXXXXXXXXXXFVRATTKHWSESSGPIIVHCSAGVGRTGTYICIESQIRQLDQEHHINVRGFLEHIRQQRMKLVQTESQYTFIHDALYEYYLYPDREIHKLELSIYISKLKEFDASGCMKLDTQFKKCINFEPSDYDYMESKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSN-ENMHQ----FWPGPDNNALTFRWFKV-------HCNSEKTEFSVQYSFLISSSREDYALDCTMHCLKYWPNTVSECSELLRLLFDINSKKYS--GPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELL 1517
            G+ RP AYIA QGPL  T  DFW+M+WE N E+IVMI+N VE+GR KC+ YW  + +   G+  V+Q   + +A+YT R F +RN +LKK  +      R V  Y YT W D  VP  SLPVL FVR   +    + GP++VHCSAGVGRTGTYI ++S ++Q+  E  +N+ GFL+HIR QR  LVQTE QY FIHD L E  L  + E+    +  Y++ L     +G  KL+ QF+          DY  + K+ N  KNR+ +I+P+E  R+ +S   G EG++YINAS I GY+Q  EFIITQHPL  T +DFW+M+WD N  L++++ + +NM +    +WP  D   +    FKV        C S + +  VQ  F++ ++++DY L+        WPN  S  S+   L+  I  +  +  GP++V DE+G   AG F A+++L+HQL K++ ++VY V KMI++ RP  F+      F+Y+++
Sbjct: 1787 GYNRPKAYIAAQGPLKSTAEDFWRMIWEHNVEVIVMITNLVEKGRRKCDQYWPTDGSEEYGSFLVNQKSVQVLAYYTVRNFTLRNTKLKKGSQKGRSSGRLVTQYHYTQWPDMGVPEYSLPVLAFVRKAAQAKRHAVGPVVVHCSAGVGRTGTYIVLDSMLQQIQHEGTVNIFGFLKHIRSQRNYLVQTEEQYVFIHDTLVEAILSKETEVPDSHIHSYVNTLLIPGPTGKTKLEKQFQLLSQSNILQSDYSTALKQCNREKNRTSSIIPVERSRVGISSLSG-EGTDYINASYIMGYYQSNEFIITQHPLLHTIKDFWRMIWDHNAQLVVMIPDGQNMAEDEFVYWPNKD-EPINCESFKVTLMSEEHKCLSNEEKLIVQ-DFILEATQDDYVLEVRHFQCPKWPNPDSPISKTFELISIIKEEAANRDGPMIVHDEHGGVTAGTFCALTTLMHQLEKENAMDVYQVAKMINLMRPGVFTDIEQYQFLYKVV 2276          

HSP 2 Score: 90.1225 bits (222), Expect = 5.854e-17
Identity = 64/246 (26.02%), Postives = 121/246 (49.19%), Query Frame = 3
Query:  864 KNRSDTIMPIESRRINLS--CEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSN------ENMHQFWPGPDNNALTFRWFKVHCNSEKT-------EFSVQYSFLISSSREDYALD--CTMHCLKYWPNTVSECSELLRLLF---DINSKKYS-GPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELLEFVILNQ 1538
            KNR   I+  +  R+ L+   E   + ++YINA+ + GY + K +I  Q PL  T +DFW+M+W+ N  +I++++N          Q+W  P + +  +  F V+  S +         F+++ + L   S++  +     T +    WP+       L  L F      +K+++ GP+VV    G  R G ++ + S+L Q++ +  VN++  +K I  +R Y   +    +FI++ L   IL++
Sbjct: 1750 KNRYVNIVAYDHSRVKLTQLAEKDGKLTDYINANYVDGYNRPKAYIAAQGPLKSTAEDFWRMIWEHNVEVIVMITNLVEKGRRKCDQYW--PTDGSEEYGSFLVNQKSVQVLAYYTVRNFTLRNTKLKKGSQKGRSSGRLVTQYHYTQWPDMGVPEYSLPVLAFVRKAAQAKRHAVGPVVVHCSAGVGRTGTYIVLDSMLQQIQHEGTVNIFGFLKHIRSQRNYLVQTEEQYVFIHDTLVEAILSK 1993          
BLAST of Receptor type tyrosine protein phosphatase zeta vs. UniProt/SwissProt
Match: sp|P23470|PTPRG_HUMAN (Receptor-type tyrosine-protein phosphatase gamma OS=Homo sapiens OX=9606 GN=PTPRG PE=1 SV=4)

HSP 1 Score: 357.836 bits (917), Expect = 1.069e-105
Identity = 198/496 (39.92%), Postives = 288/496 (58.06%), Query Frame = 3
Query:   96 GFKRPYAYIATQGPLTETVADFWQMVWEQNSEIIVMISNFVERGRSKCEIYWSPNKTLNCGNISVHQIYQKEMAFYTERAFRIRNIRLKKNIK--------DRTVYHYQYTDWRDFDXXXXXXXXXXFVRATTKHWSESSGPIIVHCSAGVGRTGTYICIESQIRQLDQEHHINVRGFLEHIRQQRMKLVQTESQYTFIHDALYEYYLYPDREIHKLELSIYISKLKEFDASGCMKLDTQFKKCINFEPSDYDYMESKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSN-----ENMHQFWPGPDNNALTFRWFKVH-------CNSEKTEFSVQYSFLISSSREDYALDCTMHCLKYWPNTVSECSELLRLLFDINSKKYS--GPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELL 1517
            G+ +  AYIATQGPL  T  DFW+M+WEQN+ IIVMI+N VE+GR KC+ YW    +   GNI V     K  A YT R F IRN ++KK  K        +R V  Y YT W D  VP  +LPVL FVR ++      +GP++VHCSAGVGRTGTYI I+S ++Q+  +  +NV GFL+HIR QR  LVQTE QY FIHDAL E  L  + E+   +L  Y++ +      G  +L+ QFK          +   ++K  N  KNR+ +++P E  R+ L+  PG++G++YINAS I GY++  EFIITQHPL  T +DFW+M+WD N  +I++L +     E+   +WP  +  ++    F V        C S + +  + + F++ ++++DY L+        WPN  +  S    L+  I  +  +  GP +V DEYG+  AG+  A+++L  QL  ++ V+V+ V KMI++ RP  F+      FIY+ +
Sbjct:  914 GYNKAKAYIATQGPLKSTFEDFWRMIWEQNTGIIVMITNLVEKGRRKCDQYWPTENSEEYGNIIVTLKSTKIHACYTVRRFSIRNTKVKKGQKGNPKGRQNERVVIQYHYTQWPDMGVPEYALPVLTFVRRSSAARMPETGPVLVHCSAGVGRTGTYIVIDSMLQQIKDKSTVNVLGFLKHIRTQRNYLVQTEEQYIFIHDALLEAILGKETEVSSNQLHSYVNSILIPGVGGKTRLEKQFKLVTQCNAKYVECFSAQKECNKEKNRNSSVVPSERARVGLAPLPGMKGTDYINASYIMGYYRSNEFIITQHPLPHTTKDFWRMIWDHNAQIIVMLPDNQSLAEDEFVYWPSRE-ESMNCEAFTVTLISKDRLCLSNEEQIII-HDFILEATQDDYVLEVRHFQCPKWPNPDAPISSTFELINVIKEEALTRDGPTIVHDEYGAVSAGMLCALTTLSQQLENENAVDVFQVAKMINLMRPGVFTDIEQYQFIYKAM 1407          

HSP 2 Score: 100.138 bits (248), Expect = 3.478e-20
Identity = 69/251 (27.49%), Postives = 118/251 (47.01%), Query Frame = 3
Query:  855 NLVKNRSDTIMPIESRRINLSCEPGVEG--SNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSN------ENMHQFWPGPD-----NNALTFRWFKVHCNSEKTEFSVQYSFLISS------SREDYALDCTMHCLKYWPNTVSECSELLRLLFDINSKKY----SGPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELLEFVILNQ 1538
            N  KNR   I+  +  R+ L   PG +   S+YINA+ + GY + K +I TQ PL  T +DFW+M+W++N  +I++++N          Q+WP  +     N  +T +  K+H       FS++ + +          R++  +    H  + WP+       L  L F   S       +GP++V    G  R G ++ + S+L Q++    VNV   +K I  +R Y   +    +FI++ L   IL +
Sbjct:  874 NKHKNRYINILAYDHSRVKLRPLPGKDSKHSDYINANYVDGYNKAKAYIATQGPLKSTFEDFWRMIWEQNTGIIVMITNLVEKGRRKCDQYWPTENSEEYGNIIVTLKSTKIHACYTVRRFSIRNTKVKKGQKGNPKGRQNERVVIQYHYTQ-WPDMGVPEYALPVLTFVRRSSAARMPETGPVLVHCSAGVGRTGTYIVIDSMLQQIKDKSTVNVLGFLKHIRTQRNYLVQTEEQYIFIHDALLEAILGK 1123          
BLAST of Receptor type tyrosine protein phosphatase zeta vs. UniProt/SwissProt
Match: sp|Q05909|PTPRG_MOUSE (Receptor-type tyrosine-protein phosphatase gamma OS=Mus musculus OX=10090 GN=Ptprg PE=1 SV=1)

HSP 1 Score: 355.525 bits (911), Expect = 6.464e-105
Identity = 196/500 (39.20%), Postives = 288/500 (57.60%), Query Frame = 3
Query:   96 GFKRPYAYIATQGPLTETVADFWQMVWEQNSEIIVMISNFVERGRSKCEIYWSPNKTLNCGNISVHQIYQKEMAFYTERAFRIRNIRLKKNIK--------DRTVYHYQYTDWRDFDXXXXXXXXXXFVRATTKHWSESSGPIIVHCSAGVGRTGTYICIESQIRQLDQEHHINVRGFLEHIRQQRMKLVQTESQYTFIHDALYEYYLYPDREIHKLELSIYISKLKEFDASGCMKLDTQFKKCINFEPSDYDYMESKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSN-----ENMHQFWPGPDNNALTFRWFKVH-------CNSEKTEFSVQYSFLISSSREDYALDCTMHCLKYWPNTVSECSELLRLLFDINSKKYS--GPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELLEFVI 1529
            G+ +  AYIATQGPL  T  DFW+M+WEQN+ II+MI+N VE+GR KC+ YW    T   GNI V     K  A YT R   +RN ++KK  K        +RTV  Y YT W D  VP  +LPVL FVR ++       GP++VHCSAGVGRTGTYI I+S ++Q+  +  +NV GFL+HIR QR  LVQTE QY FIHDAL E  L  +  +   +L  Y++ +      G  +L+ QFK          +   ++K  N  KNR+ +++P E  R+ L+  PG++G++YINAS I GY++  EFIITQHPL  T +DFW+M+WD N  +I++L +     E+   +WP  +  ++    F V        C S + +  + + F++ ++++DY L+        WPN  +  S    L+  I  +  +  GP +V DEYG+  AG+  A+++L  QL  ++ V+V+ V KMI++ RP  F+      F+Y+ +  +I
Sbjct:  911 GYNKAKAYIATQGPLKSTFEDFWRMIWEQNTGIIIMITNLVEKGRRKCDQYWPTENTEEYGNIIVTLKSTKVHACYTVRRLSVRNTKVKKGQKGNPKGRQNERTVIQYHYTQWPDMGVPEYALPVLTFVRRSSAARMPDMGPVLVHCSAGVGRTGTYIVIDSMLQQIKDKSTVNVLGFLKHIRTQRNYLVQTEEQYIFIHDALLEAILGKETAVSSSQLHSYVNSILIPGVGGKTRLEKQFKLITQCNAKYVECFSAQKECNKEKNRNSSVVPAERARVGLAPLPGMKGTDYINASYIMGYYRSNEFIITQHPLPHTTKDFWRMIWDHNAQIIVMLPDNQSLAEDEFVYWPSRE-ESMNCEAFTVTLISKDRLCLSNEEQIII-HDFILEATQDDYVLEVRHFQCPKWPNPDAPISSTFELINVIKEEALTRDGPTIVHDEYGAVSAGMLCALTTLSQQLENENAVDVFQVAKMINLMRPGVFTDIEQYQFVYKAMLSLI 1408          

HSP 2 Score: 98.2117 bits (243), Expect = 1.380e-19
Identity = 75/261 (28.74%), Postives = 119/261 (45.59%), Query Frame = 3
Query:  855 NLVKNRSDTIMPIESRRINLSCEPGVEG--SNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSN------ENMHQFWPGPD-----NNALTFRWFKVHCNSEKTEFSVQYSFLISS------SREDYALDCTMHCLKYWPNTVSECSELLRLLFDINSKKYS----GPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELLEFVILNQHLYTFFSRSQ 1568
            N  KNR   I+  +  R+ L   PG +   S+YINA+ + GY + K +I TQ PL  T +DFW+M+W++N  +II+++N          Q+WP  +     N  +T +  KVH        SV+ + +          R++       H  + WP+       L  L F   S        GP++V    G  R G ++ + S+L Q++    VNV   +K I  +R Y   +    +FI++ L   IL +   T  S SQ
Sbjct:  871 NKHKNRYINILAYDHSRVKLRPLPGKDSKHSDYINANYVDGYNKAKAYIATQGPLKSTFEDFWRMIWEQNTGIIIMITNLVEKGRRKCDQYWPTENTEEYGNIIVTLKSTKVHACYTVRRLSVRNTKVKKGQKGNPKGRQNERTVIQYHYTQ-WPDMGVPEYALPVLTFVRRSSAARMPDMGPVLVHCSAGVGRTGTYIVIDSMLQQIKDKSTVNVLGFLKHIRTQRNYLVQTEEQYIFIHDALLEAILGKE--TAVSSSQ 1128          
BLAST of Receptor type tyrosine protein phosphatase zeta vs. TrEMBL
Match: A0A5K3F3L2 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 507.294 bits (1305), Expect = 6.166e-159
Identity = 252/481 (52.39%), Postives = 328/481 (68.19%), Query Frame = 3
Query:   96 GFKRPYAYIATQGPLTETVADFWQMVWEQNSEIIVMISNFVERGRSKCEIYWSPNKTLNCGNISVHQIYQKEMAFYTERAFRIRNIRLKKNIKDRTVYHYQYTDWRDFDXXXXXXXXXXFVRATTKHWSESSGPIIVHCSAGVGRTGTYICIESQIRQLDQEHHINVRGFLEHIRQQRMKLVQTESQYTFIHDALYEYYLYPDREIHKLELSIYISKLKEFDASGCMKLDTQFKKCINFEPSDYDYMESKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSNENMHQFWPGPDNNALTFRWFKVH-CNSEK-TEFSVQYSFLISSSREDYALDCTMHCLKYWPNTVSECS----ELLRLLFDINSKKYSGPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELLE 1520
            GF  P A+IA QGP   T  DFWQMVW++NS IIVMISNFVERGR KC+ YW  +     G+ISV  + + ++A Y  R F ++N++ KK  K+R V HYQYTDWRDFDVP S+LPVLVFV+ T K W+ + GPIIVHCSAGVGRTGTYICIES IRQLD E  +N+RGFLEHIRQQRMKLVQTE QY FIHDAL EY L P+ EI  L    Y   L+  D+SG   L  QF+ C +  P  Y++ E++K  N VKNR   ++P +SRR+ L  EPGV+GS YINAS +QGY+ ++EFI+TQHPL  TE DFWKMVWD+N  ++ +LS+E+M  FWP          W +V  C+ E+ T+   +Y FL+SSSREDYAL C +  L  WP   +E      +L  +L   ++   +G  +V+D+YG +RAGIF A++ L++QL     ++VYF++KM+H++R   F S  DL FIY ++E
Sbjct:  719 GFCGPRAFIAAQGPKDITFDDFWQMVWDENSNIIVMISNFVERGRRKCDQYWPSDGQQTYGSISVRMLSENKLACYVARVFLVKNVKCKKFAKERIVRHYQYTDWRDFDVPLSALPVLVFVKTTVKDWTPTRGPIIVHCSAGVGRTGTYICIESLIRQLDAEKQVNIRGFLEHIRQQRMKLVQTEQQYAFIHDALREYLLCPEHEISALSFPAYAQCLRVPDSSGVTGLQKQFEVCTDHIPRAYEFTEARKPVNEVKNRLSHLIPTDSRRVTLPNEPGVDGSTYINASIVQGYYNLQEFIVTQHPLTFTEADFWKMVWDKNSPMVFVLSSEDMPVFWPTGAQEPRVIGWLRVGFCDREEVTDGLTRYEFLLSSSREDYALTCHLWRLHNWPTAAAETRRDFLKLQSILVSDHASSANGSTIVVDDYGGNRAGIFCAVNVLINQLTMAGYIDVYFIVKMLHLQRTGIFKSCEDLDFIYSVME 1199          

HSP 2 Score: 88.5817 bits (218), Expect = 3.804e-14
Identity = 70/244 (28.69%), Postives = 116/244 (47.54%), Query Frame = 3
Query:  855 NLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSN------ENMHQFWPGPDNNALTFRWFKVHCNSE-KTEFSVQYSFLISSSR-EDYALDCTMHCLKY--WPNTVSECSELLRLLFDINSKK----YSGPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELL-EFVILNQH 1541
            N+ KNR   +   +  R+ L   P    S+YINA+ + G+   + FI  Q P D T  DFW+MVWDEN ++I+++SN          Q+W  P +   T+    V   SE K    V   FL+ + + + +A +  +   +Y  W +     S L  L+F   + K      GPI+V    G  R G ++ + SL+ QL  +  VN+   ++ I  +R     +     FI++ L E+++  +H
Sbjct:  682 NMPKNRYSNVFAYDHTRVILR-NPHGRRSDYINANYVDGFCGPRAFIAAQGPKDITFDDFWQMVWDENSNIIVMISNFVERGRRKCDQYW--PSDGQQTYGSISVRMLSENKLACYVARVFLVKNVKCKKFAKERIVRHYQYTDWRDFDVPLSALPVLVFVKTTVKDWTPTRGPIIVHCSAGVGRTGTYICIESLIRQLDAEKQVNIRGFLEHIRQQRMKLVQTEQQYAFIHDALREYLLCPEH 922          
BLAST of Receptor type tyrosine protein phosphatase zeta vs. TrEMBL
Match: A0A0X3PVJ1 (Tyrosine-protein phosphatase 99A (Fragment) OS=Schistocephalus solidus OX=70667 GN=PTP99 PE=4 SV=1)

HSP 1 Score: 509.605 bits (1311), Expect = 1.315e-158
Identity = 255/482 (52.90%), Postives = 334/482 (69.29%), Query Frame = 3
Query:   96 GFKRPYAYIATQGPLTETVADFWQMVWEQNSEIIVMISNFVERGRSKCEIYWSPNKTLNCGNISVHQIYQKEMAFYTERAFRIRNIRLKKNIKDRTVYHYQYTDWRDFDXXXXXXXXXXFVRATTKHWSESSGPIIVHCSAGVGRTGTYICIESQIRQLDQEHHINVRGFLEHIRQQRMKLVQTESQYTFIHDALYEYYLYPDREIHKLELSIYISKLKEFDASGCMKLDTQFKKCINFEPSDYDYMESKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSNENMHQFWPGPDNNALTFRWFKV-HCNSEK-TEFSVQYSFLISSSREDYALDCTMHCLKYWPNTVSECS--ELLRLLFDINSKK---YSGPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELLE 1520
            GF RP AYIA QGP++ T  DFWQM+W++N  IIVMISNFVERG+ KC+ YW      + G ISV  + +  +A Y  R F ++N++ KK  KDR VYHYQYTDWRDFDVP S LPVLVFV+ T  HWS  +GPI VHCSAGVGRTGTYICIES IRQL+ E+ +N++GFLEHIRQQRMKLVQTE QY FIHDAL EY + P+ E+   + + Y+  L++ +  GC  L  QF+ C    P DY++ E++K  NL KNRS TI+P ++RR+ L  EPGV+GS+YINAS +QGY  + EFII Q PL+ TE DFWKMVWD+N   I +LS+E+M  FWP    +A    W +V  C+SE  +E   ++ FL+SSSREDYAL C +  +  WP TV+  S  +LL+L F + S       GP VV+D++G +RAGIF A++ L++Q     V++ YF++KM+H++R   F S  DL FIY ++E
Sbjct:  777 GFHRPKAYIAAQGPMSSTFDDFWQMIWDENCSIIVMISNFVERGKRKCDQYWPSEGQQSYGTISVRMLSEAFLACYVIRVFDVKNLKCKKFAKDRIVYHYQYTDWRDFDVPLSPLPVLVFVKTTVAHWSSVTGPITVHCSAGVGRTGTYICIESLIRQLETENQVNIQGFLEHIRQQRMKLVQTEQQYAFIHDALREYLICPEHEVLASDFTAYVHCLRKVEPCGCSGLQKQFEICTERIPRDYEFTEARKACNLPKNRS-TIVPNDARRVTLPSEPGVDGSSYINASIVQGYRSLSEFIIAQQPLESTEADFWKMVWDKNSPFIFVLSSEDMPCFWPESPQSARVIGWLRVGFCSSESVSENLTRFEFLLSSSREDYALTCQLWRVHKWPTTVTADSTRDLLKLQFFLVSNHTLVAGGPTVVVDDFGGNRAGIFCAINFLINQFTLAGVIDAYFIVKMLHLQRAKLFRSYEDLDFIYLVIE 1257          

HSP 2 Score: 90.8929 bits (224), Expect = 7.913e-15
Identity = 63/242 (26.03%), Postives = 116/242 (47.93%), Query Frame = 3
Query:  855 NLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSN------ENMHQFWPGPDNNALTFRWFKVHCNSEKTEFSVQYSFLISSSREDYALDCTMHCLKY--WPNTVSECSELLRLLFDINSKKY----SGPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELL-EFVILNQH 1541
            N+ KNR   +   +  R+ L   P    S+YINA+ + G+ + K +I  Q P+  T  DFW+M+WDENCS+I+++SN          Q+WP     +      ++   +    + ++   + +   + +A D  ++  +Y  W +     S L  L+F   +  +    +GPI V    G  R G ++ + SL+ QL  ++ VN+   ++ I  +R     +     FI++ L E++I  +H
Sbjct:  740 NMQKNRYSNVFAYDHTRVVLR-NPHGRKSDYINANYVDGFHRPKAYIAAQGPMSSTFDDFWQMIWDENCSIIVMISNFVERGKRKCDQYWPSEGQQSYGTISVRMLSEAFLACYVIRVFDVKNLKCKKFAKDRIVYHYQYTDWRDFDVPLSPLPVLVFVKTTVAHWSSVTGPITVHCSAGVGRTGTYICIESLIRQLETENQVNIQGFLEHIRQQRMKLVQTEQQYAFIHDALREYLICPEH 980          
BLAST of Receptor type tyrosine protein phosphatase zeta vs. TrEMBL
Match: A0A0X3PY59 (Tyrosine-protein phosphatase 99A (Fragment) OS=Schistocephalus solidus OX=70667 GN=PTP99 PE=4 SV=1)

HSP 1 Score: 509.605 bits (1311), Expect = 1.535e-158
Identity = 259/500 (51.80%), Postives = 339/500 (67.80%), Query Frame = 3
Query:   96 GFKRPYAYIATQGPLTETVADFWQMVWEQNSEIIVMISNFVERGRSKCEIYWSPNKTLNCGNISVHQIYQKEMAFYTERAFRIRNIRLKKNIKDRTVYHYQYTDWRDFDXXXXXXXXXXFVRATTKHWSESSGPIIVHCSAGVGRTGTYICIESQIRQLDQEHHINVRGFLEHIRQQRMKLVQTESQYTFIHDALYEYYLYPDREIHKLELSIYISKLKEFDASGCMKLDTQFKKCINFEPSDYDYMESKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSNENMHQFWPGPDNNALTFRWFKV-HCNSEK-TEFSVQYSFLISSSREDYALDCTMHCLKYWPNTVSECS--ELLRLLFDINSKK---YSGPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELLEFVILNQHLYTFFSRSQQD 1574
            GF RP AYIA QGP++ T  DFWQM+W++N  IIVMISNFVERG+ KC+ YW      + G ISV  + +  +A Y  R F ++N++ KK  KDR VYHYQYTDWRDFDVP S LPVLVFV+ T  HWS  +GPI VHCSAGVGRTGTYICIES IRQL+ E+ +N++GFLEHIRQQRMKLVQTE QY FIHDAL EY + P+ E+   + + Y+  L++ +  GC  L  QF+ C    P DY++ E++K  NL KNRS TI+P ++RR+ L  EPGV+GS+YINAS +QGY  + EFII Q PL+ TE DFWKMVWD+N   I +LS+E+M  FWP    +A    W +V  C+SE  +E   ++ FL+SSSREDYAL C +  +  WP TV+  S  +LL+L F + S       GP VV+D++G +RAGIF A++ L++Q     V++ YF++KM+H++R   F S  DL FIY ++E          F +  QQD
Sbjct:  783 GFHRPKAYIAAQGPMSSTFDDFWQMIWDENCSIIVMISNFVERGKRKCDQYWPSEGQQSYGTISVRMLSEAFLACYVIRVFDVKNLKCKKFAKDRIVYHYQYTDWRDFDVPLSPLPVLVFVKTTVAHWSSVTGPITVHCSAGVGRTGTYICIESLIRQLETENQVNIQGFLEHIRQQRMKLVQTEQQYAFIHDALREYLICPEHEVLASDFTAYVHCLRKVEPCGCSGLQKQFEICTERIPRDYEFTEARKACNLPKNRS-TIVPNDARRVTLPSEPGVDGSSYINASIVQGYRSLSEFIIAQQPLESTEADFWKMVWDKNSPFIFVLSSEDMPCFWPESPQSARVIGWLRVGFCSSESVSENLTRFEFLLSSSREDYALTCQLWRVHKWPTTVTADSTRDLLKLQFFLVSNHTLVAGGPTVVVDDFGGNRAGIFCAINFLINQFTLAGVIDAYFIVKMLHLQRAKLFRSYEDLDFIYLVIE---------QFLADLQQD 1272          

HSP 2 Score: 90.8929 bits (224), Expect = 8.269e-15
Identity = 63/242 (26.03%), Postives = 116/242 (47.93%), Query Frame = 3
Query:  855 NLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSN------ENMHQFWPGPDNNALTFRWFKVHCNSEKTEFSVQYSFLISSSREDYALDCTMHCLKY--WPNTVSECSELLRLLFDINSKKY----SGPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELL-EFVILNQH 1541
            N+ KNR   +   +  R+ L   P    S+YINA+ + G+ + K +I  Q P+  T  DFW+M+WDENCS+I+++SN          Q+WP     +      ++   +    + ++   + +   + +A D  ++  +Y  W +     S L  L+F   +  +    +GPI V    G  R G ++ + SL+ QL  ++ VN+   ++ I  +R     +     FI++ L E++I  +H
Sbjct:  746 NMQKNRYSNVFAYDHTRVVLR-NPHGRKSDYINANYVDGFHRPKAYIAAQGPMSSTFDDFWQMIWDENCSIIVMISNFVERGKRKCDQYWPSEGQQSYGTISVRMLSEAFLACYVIRVFDVKNLKCKKFAKDRIVYHYQYTDWRDFDVPLSPLPVLVFVKTTVAHWSSVTGPITVHCSAGVGRTGTYICIESLIRQLETENQVNIQGFLEHIRQQRMKLVQTEQQYAFIHDALREYLICPEH 986          
BLAST of Receptor type tyrosine protein phosphatase zeta vs. TrEMBL
Match: A0A087VZX3 (Receptor type tyrosine protein phosphatase zeta OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000149750 PE=4 SV=1)

HSP 1 Score: 506.523 bits (1303), Expect = 2.357e-158
Identity = 260/491 (52.95%), Postives = 339/491 (69.04%), Query Frame = 3
Query:   96 GFKRPYAYIATQGPLTETVADFWQMVWEQNSEIIVMISNFVERGRSKCEIYWSPNKTLNCGNISVHQIYQKEMAFYTERAFRIRNIRLKKNIKDRTVYHYQYTDWRDFDXXXXXXXXXXFVRATTKHWSESSGPIIVHCSAGVGRTGTYICIESQIRQLDQEHHINVRGFLEHIRQQRMKLVQTESQYTFIHDALYEYYLYPDREIHKLELSIYISKLKEFDASGCMKLDTQFKKCINFEPSDYDYMESKKRYNLVKNR-SDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPL-DETEQDFWKMVWDENCSLIILLSNENMH---QFWPGPDNNALTFRWFKVH-CNSEK-TEFSVQYSFLISSSREDYALDCTMHCLKYWPNTVSE--CSELLRL---LFDINSKKYSGPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELLEFVIL 1532
            GF RP A+IA QGP   T  DFWQMVW++NS IIVMISNFVERGR KC+ YW  +     GNISV  + +  +A Y  R F ++N++ KK  K+R V HYQYTDWRDFDVPPS LPVLVFV+ T K W+ S GPIIVHCSAGVGRTGTYICIES IRQL+ E  +N+RGFLEHIRQQRMKLVQTE QY FIHDAL EY L P+ EI  +    Y+  L+  DA+G   L  QF+ C +  P  Y++ E++K  N+ KNR S  ++P +SRR+ L  E GVEG++YINAS +QGY +++EFI+TQHP+   TE DFW+MVWD+N SL+++LS+E       FWP   ++     W +V  CNSE+ +E   +Y FL+SSSREDYAL C +  L  WP TV+E  C + LRL   L    +   +G  +V+D YG +RAGIFVA++ L++QL     ++VY+++KM+H++R   F S +DL FIY ++E  +L
Sbjct:  719 GFCRPRAFIAAQGPKDTTFDDFWQMVWDENSNIIVMISNFVERGRRKCDQYWPSSGPQTYGNISVQMLSEDYLACYVARVFLVKNVKCKKFAKERIVRHYQYTDWRDFDVPPSPLPVLVFVKTTIKEWTPSRGPIIVHCSAGVGRTGTYICIESLIRQLEAEKQVNIRGFLEHIRQQRMKLVQTEQQYAFIHDALREYLLCPEHEILAMSFPAYVQCLRLPDAAGVTGLQKQFEICTDHLPRVYEFTEARKPVNVTKNRLSRRLLPTDSRRVLLPSEGGVEGASYINASVVQGYHRLQEFIVTQHPIPGTTEADFWRMVWDKNSSLVVVLSSEQADLFPDFWPVEVHDPREIGWLRVSFCNSEEVSEGLTRYEFLLSSSREDYALTCQLWRLHAWPTTVTEEACGDFLRLHSILVSNRTSAANGSTIVVDGYGGNRAGIFVAVNFLINQLTLSGYIDVYYIVKMLHLQRTGIFESPADLDFIYSVMEQFLL 1209          

HSP 2 Score: 88.5817 bits (218), Expect = 3.799e-14
Identity = 71/246 (28.86%), Postives = 117/246 (47.56%), Query Frame = 3
Query:  855 NLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSN------ENMHQFWP--GPDNNALTFRWFKVHCNSEK-TEFSVQYSFLISSSR-EDYALDCTMHCLKY--WPNTVSECSELLRLLFDINSKK----YSGPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELL-EFVILNQH 1541
            N+ KNR   + P +  R+ L        S+YINA+ + G+ + + FI  Q P D T  DFW+MVWDEN ++I+++SN          Q+WP  GP     T+    V   SE      V   FL+ + + + +A +  +   +Y  W +     S L  L+F   + K      GPI+V    G  R G ++ + SL+ QL  +  VN+   ++ I  +R     +     FI++ L E+++  +H
Sbjct:  684 NMAKNRYTNVFPYDHTRVILK---NGRKSDYINANYVDGFCRPRAFIAAQGPKDTTFDDFWQMVWDENSNIIVMISNFVERGRRKCDQYWPSSGPQ----TYGNISVQMLSEDYLACYVARVFLVKNVKCKKFAKERIVRHYQYTDWRDFDVPPSPLPVLVFVKTTIKEWTPSRGPIIVHCSAGVGRTGTYICIESLIRQLEAEKQVNIRGFLEHIRQQRMKLVQTEQQYAFIHDALREYLLCPEH 922          
BLAST of Receptor type tyrosine protein phosphatase zeta vs. TrEMBL
Match: A0A564YP23 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS8105 PE=4 SV=1)

HSP 1 Score: 495.738 bits (1275), Expect = 2.554e-154
Identity = 253/490 (51.63%), Postives = 337/490 (68.78%), Query Frame = 3
Query:   96 GFKRPYAYIATQGPLTETVADFWQMVWEQNSEIIVMISNFVERGRSKCEIYWSPNKTLNCGNISVHQIYQKEMAFYTERAFRIRNIRLKKNIKDRTVYHYQYTDWRDFDXXXXXXXXXXFVRATTKHWSESSGPIIVHCSAGVGRTGTYICIESQIRQLDQEHHINVRGFLEHIRQQRMKLVQTESQYTFIHDALYEYYLYPDREIHKLELSIYISKLKEFDASGCMKLDTQFKKCINFEPSDYDYMESKKRYNLVKNR-SDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPL-DETEQDFWKMVWDENCSLIILLS-----NENMHQFWPGPDNNALTFRWFKV-HCNSEKT-EFSVQYSFLISSSREDYALDCTMHCLKYWPNTVSE---CSELLRL---LFDINSKKYSGPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELLE 1520
            GF RP A+IA QGP   T  DFWQMVW++NS IIVMISNFVERGR KC+ YW  +     GNISV  + +  +A Y  R F ++N++ KK  K+R V HYQYTDWRDFDVPPS LPVLVFV+ T K W+ S GPIIVHCSAGVGRTGTYICIES IRQL+ E+ +N+RGFLEHIRQQRMKLVQTE QY FIHDAL EY L P+ EI  +    Y+  L+  DA+G   L  QF+ C ++ P  Y++ E++K  N+ KNR S  ++P +SRR+ L  E G+EG++YINAS +QGY ++ EFI+TQHP+ + TE DFW+MVWD+N  L+++LS     N     FWP   ++     W +V  C SE   +   +Y FL+SSSREDYAL C +  L  WP++ ++   CS+LL+L   L   +S   +G  +V+D+YG +RAGIFVA++ L++Q      +++Y+++KM+H++R   F S +DL FIY L+E
Sbjct:  720 GFCRPRAFIAAQGPKDTTFDDFWQMVWDENSNIIVMISNFVERGRRKCDQYWPSSGPQPYGNISVQMLSENYLACYVARVFLVKNVKCKKFAKERIVRHYQYTDWRDFDVPPSPLPVLVFVKTTIKEWTPSRGPIIVHCSAGVGRTGTYICIESLIRQLEAENQVNIRGFLEHIRQQRMKLVQTEQQYAFIHDALREYLLCPEHEISAMAFPSYVQCLRMPDANGVTGLQKQFEICTDYMPRVYEFTEARKPVNIPKNRLSRRLLPTDSRRVALPSEGGIEGASYINASVVQGYHRLHEFIVTQHPIPNSTETDFWRMVWDKNSPLVVVLSSSDSENGEFPDFWPTEAHDPREIGWLRVGFCASETVGDGLTRYEFLLSSSREDYALTCQLWRLHNWPSSTNDEVACSDLLKLQSVLISNSSSTANGSTIVVDDYGGNRAGIFVAVNFLINQFNLSGNIDIYYIVKMLHLQRTGIFQSPADLEFIYSLME 1209          

HSP 2 Score: 84.3445 bits (207), Expect = 8.341e-13
Identity = 76/298 (25.50%), Postives = 136/298 (45.64%), Query Frame = 3
Query:  699 PDREIHKLELSIYISKLKEFDASGCMKLDTQFKKCINFEPSDYDYMESKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSN------ENMHQFWP--GPDNNALTFRWFKVHCNSEK-TEFSVQYSFLISSSR-EDYALDCTMHCLKY--WPNTVSECSELLRLLFDINSKK----YSGPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELL-EFVILNQH 1541
            P + I   +L+ +++     D +G     T+F        + +    +++  N+ KNR   +   +  R+ L        S+YINA+ + G+ + + FI  Q P D T  DFW+MVWDEN ++I+++SN          Q+WP  GP      +    V   SE      V   FL+ + + + +A +  +   +Y  W +     S L  L+F   + K      GPI+V    G  R G ++ + SL+ QL  ++ VN+   ++ I  +R     +     FI++ L E+++  +H
Sbjct:  636 PHKPIPAEKLAAHVASYHVDDDAG---YQTEFDAIEQSVRTSWPTSVARQPDNMAKNRYTNVFAYDHTRVILK---NGRKSDYINANYVDGFCRPRAFIAAQGPKDTTFDDFWQMVWDENSNIIVMISNFVERGRRKCDQYWPSSGPQ----PYGNISVQMLSENYLACYVARVFLVKNVKCKKFAKERIVRHYQYTDWRDFDVPPSPLPVLVFVKTTIKEWTPSRGPIIVHCSAGVGRTGTYICIESLIRQLEAENQVNIRGFLEHIRQQRMKLVQTEQQYAFIHDALREYLLCPEH 923          
BLAST of Receptor type tyrosine protein phosphatase zeta vs. Ensembl Cavefish
Match: ptprga (protein tyrosine phosphatase receptor type Ga [Source:ZFIN;Acc:ZDB-GENE-101101-4])

HSP 1 Score: 363.999 bits (933), Expect = 3.238e-109
Identity = 200/496 (40.32%), Postives = 289/496 (58.27%), Query Frame = 3
Query:   96 GFKRPYAYIATQGPLTETVADFWQMVWEQNSEIIVMISNFVERGRSKCEIYWSPNKTLNCGNISVHQIYQKEMAFYTERAFRIRNIRLKKNIK--------DRTVYHYQYTDWRDFDXXXXXXXXXXFVRATTKHWSESSGPIIVHCSAGVGRTGTYICIESQIRQLDQEHHINVRGFLEHIRQQRMKLVQTESQYTFIHDALYEYYLYPDREIHKLELSIYISKLKEFDASGCMKLDTQFKKCINFEPSDYDYMESKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSN-----ENMHQFWPGPDNNALTFRWFKVH-------CNSEKTEFSVQYSFLISSSREDYALDCTMHCLKYWPNTVSECSELLRLLFDINSKKYS--GPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELL 1517
            G+ +P AYIA QGPL  T  DFW+MVWEQN+ IIVMI+N VE+GR KC+ YW    +   GNI V     K  A YT R F +RN ++KK  K        +RTV  Y YT W D  VP  +LPVL FVR ++   +   GP++VHCSAGVGRTGTYI I+S ++Q+  +  +NV GFL+HIR QR  LVQTE QY FIHDAL E  L  + E+   +L  Y++ +     SG  +L+ QFK          +   ++K  N  KNR+ +++P E  R+ L+  PG++G++YINAS I GY++  EFIITQHPL  T +DFW+M+WD N  +I++L +     E+   +WP  +  A+    F V        C S + +  + + F++ ++++DY L+        WPN  +  S    L+  I  +  +  GP +V DE+G+  AG+F A+++L  QL  +  V VY V KMI++ RP  F+      ++Y+ +
Sbjct:  831 GYNKPKAYIAAQGPLKSTFEDFWRMVWEQNTSIIVMITNLVEKGRRKCDQYWPTENSEEYGNIVVTLKCSKVHACYTVRRFTVRNTKVKKGQKGSVKSRQCERTVIQYHYTQWPDMGVPEYTLPVLTFVRRSSAAQTHEMGPMLVHCSAGVGRTGTYIVIDSMLQQIKDKGSVNVLGFLKHIRTQRNYLVQTEEQYVFIHDALLEAILGKETEVLSSQLHSYVNSILTPSHSGKTRLEKQFKLVTQCNARFAECFSAQKECNKEKNRNSSVVPSERARVGLAPLPGMKGTDYINASYIMGYYRSNEFIITQHPLPHTTKDFWRMIWDHNAQIIVMLPDNQGLAEDEFVYWPSRE-EAMNCEAFTVTLISKDRLCLSNEEQIII-HDFILEATQDDYVLEVRHFQCPKWPNPDAPISSTFELINIIKEEAMTRDGPTIVHDEFGAVSAGMFCALTTLSQQLENESAVGVYQVAKMINLMRPGVFTDMEQYQYLYKAM 1324          

HSP 2 Score: 97.8265 bits (242), Expect = 2.382e-20
Identity = 71/258 (27.52%), Postives = 118/258 (45.74%), Query Frame = 3
Query:  855 NLVKNRSDTIMPIESRRINLSCEPGVEG--SNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSN------ENMHQFWPGPD-----NNALTFRWFKVHCNSEKTEFSVQYSFLISSSREDY-ALDCTMHCLKY----WPNTVSECSELLRLLFDINSKKYS----GPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELLEFVILNQHLYTFFSR 1562
            N  KNR   I+  +  R+ L    G +   S+YINA+ + GY + K +I  Q PL  T +DFW+MVW++N S+I++++N          Q+WP  +     N  +T +  KVH       F+V+ + +    +    +  C    ++Y    WP+       L  L F   S        GP++V    G  R G ++ + S+L Q++    VNV   +K I  +R Y   +    +FI++ L   IL +      S+
Sbjct:  791 NKHKNRYINIVAYDHSRVKLRPLAGKDSKHSDYINANYVDGYNKPKAYIAAQGPLKSTFEDFWRMVWEQNTSIIVMITNLVEKGRRKCDQYWPTENSEEYGNIVVTLKCSKVHACYTVRRFTVRNTKVKKGQKGSVKSRQCERTVIQYHYTQWPDMGVPEYTLPVLTFVRRSSAAQTHEMGPMLVHCSAGVGRTGTYIVIDSMLQQIKDKGSVNVLGFLKHIRTQRNYLVQTEEQYVFIHDALLEAILGKETEVLSSQ 1048          
BLAST of Receptor type tyrosine protein phosphatase zeta vs. Ensembl Cavefish
Match: ptprz1a (protein tyrosine phosphatase receptor type Z1 [Source:NCBI gene;Acc:103029162])

HSP 1 Score: 352.829 bits (904), Expect = 3.556e-105
Identity = 203/521 (38.96%), Postives = 288/521 (55.28%), Query Frame = 3
Query:   96 GFKRPYAYIATQGPLTETVADFWQMVWEQNSEIIVMISNFVERGRSKCEIYWSPNKTLNCGNISVHQIYQKEMAFYTERAFRIRNIRLKKNIK-----DRTVYHYQYTDWRDFDXXXXXXXXXXFVRATTKHWSESSGPIIVHCSAGVGRTGTYICIESQIRQLDQEHHINVRGFLEHIRQQRMKLVQTESQYTFIHDALYEYYLYPDREIHKLELSIYISKLKEFDASGCMKLDTQFKKCINFEPSDYDYMESKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSNENMHQ-------FWPGPDNNALTFRWFKVHCNSEK------TEFSVQYSFLISSSREDYALDCTMHCLKYWPNTVSECSELLRLLFDINSKK--YSGPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYE-LLEFVILNQHLYTFFSRSQQDFIPNGIA 1595
            GF +  AYIA QGPL  +  DFW+MVWEQN  +IVMI+N VE GR KC+ YW        G   V     + MA+YT+R F IRN  +KK  +     +RTV HY YT W D  VP   LPV+ F+R +++  ++  GP++VHCSAGVGRTGTYI ++S ++Q+ ++  +N+ GFL+HIR QR  LVQTE QY FIHDAL E  L  + E+    +  Y+++L     S   +L+ QFK          DY  + K  N  KNRS +++P+E  RI LS     E ++YINAS I GY +  E+IITQ+PL  T +DFW+M+WD N  +I+ L + +          FWP  D   ++   F V    E+       E  +   +++ ++++DY L+   +    WPN  +  S    L+  I  ++    GPIVV D+YG   AG F A+ +LL QL  D  V+VY V KMI++ RP  F+      F+Y+ +L  V   +      S      +P G A
Sbjct:  833 GFNQQRAYIAAQGPLKSSTVDFWRMVWEQNVGVIVMITNLVENGRRKCDQYWPLETQEEYGCFLVTVKSTEVMAYYTQRTFTIRNTHVKKGSQKGRANERTVTHYHYTQWPDMGVPEYVLPVISFIRRSSRARTQDMGPVVVHCSAGVGRTGTYIVLDSMMKQISEQGLVNILGFLKHIRTQRNYLVQTEEQYVFIHDALVEAILSKETEVPTSRVHNYVNELLTTGPSCRTRLEKQFKLVNQSSAKQCDYSSALKDCNREKNRSSSLIPVERSRICLSTSAD-ETTDYINASYILGYRKSSEYIITQNPLPATVKDFWRMIWDHNAQVIVSLPDTSSLTEEPEPMIFWPKRD-QPISCSMFTVSLGREERVCMSNEEMLIVQDYILEATKDDYVLEVRHYRAPRWPNPDAPISNTFELINIIQRERSLKEGPIVVHDDYGGVTAGTFCALHTLLQQLETDSSVDVYLVAKMINLMRPGVFTDIEQYQFLYKAILSLVGTQEDEKALQSSDNNGAVPGGPA 1351          

HSP 2 Score: 94.7449 bits (234), Expect = 1.751e-19
Identity = 68/256 (26.56%), Postives = 122/256 (47.66%), Query Frame = 3
Query:  855 NLVKNRSDTIMPIESRRINLSCEPGVEGSN---YINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSN--EN----MHQFWPGPDNNA-----LTFRWFKVHCNSEKTEFSVQYSFLISSSREDYALDCTMHCLKY--WPNTVSECSELLRLLFDINSKKYS----GPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELLEFVILNQHLYTFFSR 1562
            N  KNR   I+  +  R+ LS +   +G N   YINA+ + G+ Q + +I  Q PL  +  DFW+MVW++N  +I++++N  EN      Q+WP           +T +  +V     +  F+++ + +   S++  A + T+    Y  WP+       L  + F   S +      GP+VV    G  R G ++ + S++ Q+ +  +VN+   +K I  +R Y   +    +FI++ L   IL++      SR
Sbjct:  792 NKTKNRYVNILAYDHSRVRLSAQSDKDGKNEGDYINANFVDGFNQQRAYIAAQGPLKSSTVDFWRMVWEQNVGVIVMITNLVENGRRKCDQYWPLETQEEYGCFLVTVKSTEVMAYYTQRTFTIRNTHVKKGSQKGRANERTVTHYHYTQWPDMGVPEYVLPVISFIRRSSRARTQDMGPVVVHCSAGVGRTGTYIVLDSMMKQISEQGLVNILGFLKHIRTQRNYLVQTEEQYVFIHDALVEAILSKETEVPTSR 1047          
BLAST of Receptor type tyrosine protein phosphatase zeta vs. Ensembl Cavefish
Match: ptprz1a (protein tyrosine phosphatase receptor type Z1 [Source:NCBI gene;Acc:103029162])

HSP 1 Score: 352.829 bits (904), Expect = 3.781e-105
Identity = 203/521 (38.96%), Postives = 288/521 (55.28%), Query Frame = 3
Query:   96 GFKRPYAYIATQGPLTETVADFWQMVWEQNSEIIVMISNFVERGRSKCEIYWSPNKTLNCGNISVHQIYQKEMAFYTERAFRIRNIRLKKNIK-----DRTVYHYQYTDWRDFDXXXXXXXXXXFVRATTKHWSESSGPIIVHCSAGVGRTGTYICIESQIRQLDQEHHINVRGFLEHIRQQRMKLVQTESQYTFIHDALYEYYLYPDREIHKLELSIYISKLKEFDASGCMKLDTQFKKCINFEPSDYDYMESKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSNENMHQ-------FWPGPDNNALTFRWFKVHCNSEK------TEFSVQYSFLISSSREDYALDCTMHCLKYWPNTVSECSELLRLLFDINSKK--YSGPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYE-LLEFVILNQHLYTFFSRSQQDFIPNGIA 1595
            GF +  AYIA QGPL  +  DFW+MVWEQN  +IVMI+N VE GR KC+ YW        G   V     + MA+YT+R F IRN  +KK  +     +RTV HY YT W D  VP   LPV+ F+R +++  ++  GP++VHCSAGVGRTGTYI ++S ++Q+ ++  +N+ GFL+HIR QR  LVQTE QY FIHDAL E  L  + E+    +  Y+++L     S   +L+ QFK          DY  + K  N  KNRS +++P+E  RI LS     E ++YINAS I GY +  E+IITQ+PL  T +DFW+M+WD N  +I+ L + +          FWP  D   ++   F V    E+       E  +   +++ ++++DY L+   +    WPN  +  S    L+  I  ++    GPIVV D+YG   AG F A+ +LL QL  D  V+VY V KMI++ RP  F+      F+Y+ +L  V   +      S      +P G A
Sbjct:  840 GFNQQRAYIAAQGPLKSSTVDFWRMVWEQNVGVIVMITNLVENGRRKCDQYWPLETQEEYGCFLVTVKSTEVMAYYTQRTFTIRNTHVKKGSQKGRANERTVTHYHYTQWPDMGVPEYVLPVISFIRRSSRARTQDMGPVVVHCSAGVGRTGTYIVLDSMMKQISEQGLVNILGFLKHIRTQRNYLVQTEEQYVFIHDALVEAILSKETEVPTSRVHNYVNELLTTGPSCRTRLEKQFKLVNQSSAKQCDYSSALKDCNREKNRSSSLIPVERSRICLSTSAD-ETTDYINASYILGYRKSSEYIITQNPLPATVKDFWRMIWDHNAQVIVSLPDTSSLTEEPEPMIFWPKRD-QPISCSMFTVSLGREERVCMSNEEMLIVQDYILEATKDDYVLEVRHYRAPRWPNPDAPISNTFELINIIQRERSLKEGPIVVHDDYGGVTAGTFCALHTLLQQLETDSSVDVYLVAKMINLMRPGVFTDIEQYQFLYKAILSLVGTQEDEKALQSSDNNGAVPGGPA 1358          

HSP 2 Score: 94.7449 bits (234), Expect = 1.800e-19
Identity = 68/256 (26.56%), Postives = 122/256 (47.66%), Query Frame = 3
Query:  855 NLVKNRSDTIMPIESRRINLSCEPGVEGSN---YINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSN--EN----MHQFWPGPDNNA-----LTFRWFKVHCNSEKTEFSVQYSFLISSSREDYALDCTMHCLKY--WPNTVSECSELLRLLFDINSKKYS----GPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELLEFVILNQHLYTFFSR 1562
            N  KNR   I+  +  R+ LS +   +G N   YINA+ + G+ Q + +I  Q PL  +  DFW+MVW++N  +I++++N  EN      Q+WP           +T +  +V     +  F+++ + +   S++  A + T+    Y  WP+       L  + F   S +      GP+VV    G  R G ++ + S++ Q+ +  +VN+   +K I  +R Y   +    +FI++ L   IL++      SR
Sbjct:  799 NKTKNRYVNILAYDHSRVRLSAQSDKDGKNEGDYINANFVDGFNQQRAYIAAQGPLKSSTVDFWRMVWEQNVGVIVMITNLVENGRRKCDQYWPLETQEEYGCFLVTVKSTEVMAYYTQRTFTIRNTHVKKGSQKGRANERTVTHYHYTQWPDMGVPEYVLPVISFIRRSSRARTQDMGPVVVHCSAGVGRTGTYIVLDSMMKQISEQGLVNILGFLKHIRTQRNYLVQTEEQYVFIHDALVEAILSKETEVPTSR 1054          
BLAST of Receptor type tyrosine protein phosphatase zeta vs. Ensembl Cavefish
Match: ca16b (carbonic anhydrase XVI b [Source:ZFIN;Acc:ZDB-GENE-080818-1])

HSP 1 Score: 288.5 bits (737), Expect = 1.366e-82
Identity = 175/489 (35.79%), Postives = 260/489 (53.17%), Query Frame = 3
Query:   96 GFKRPYAYIATQGPLTETVADFWQMVWEQNSEIIVMISNFVERGRSKCEIYWSPNKTLNCGNISVHQIYQKEMAFYTERAFRIRNIRLKKNIK----DRTVYHYQYTDWRDFDXXXXXXXXXXFVRATTKHWSESSGPIIVHCSAGVGRTGTYICIESQIRQLDQEHHINVRGFLEHIRQQRMKLVQTESQYTFIHDALYEYYLYPDREIHKLELSIYISKLKEFDASGCMKLDTQFKKCINFEPSDYDYMESKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSN-----ENMHQFWPGPDN--NALTFRWFKVH----CNSEKTEFSVQYSFLISSSREDYALDCTMHCLKYWPNTVSECSELLRLLFDINSKKYS--GPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYE 1511
            G+ RP AYIA QGPL  T  DFW+M+WEQN+ +IVMI+N VE+GR KC+ YW    +   G+I V     K  A+YT R F IRN R+KK  K     R V  Y YT W D  VP  +LPVL F+  ++   + +SGPI+VHC AGVGRTGTYI I+S ++Q+  +  +NV GFL+HIR QR  LVQTE                                         M+ +  + +C +          ++K  N  KNR+ +++P E  R+ L+  PG++G++YINAS I GY++  EFI+TQHP+  T  DFW+M+WD N  +I++L +     E+   +WP  +   N + F    ++    C S + +  +    L ++ ++DY L+        WP   +  S    L+  I  +  +  GP +V D +G   AG+  A+++L  QL  +  V+VY V KMI++ RP  F+      ++Y+
Sbjct:  844 GYNRPRAYIAAQGPLKSTFEDFWRMIWEQNTSVIVMITNLVEKGRRKCDQYWPSENSEEYGSILVTLKSTKVHAWYTLRHFLIRNTRVKKGQKGRHNSRIVVQYHYTQWPDMGVPEYTLPVLTFISRSSSARTPNSGPIVVHC-AGVGRTGTYIVIDSMLQQIKDKGTVNVLGFLKHIRTQRNYLVQTEL---------------------------------------VMQCNAHYMECFS----------AQKDCNKEKNRNSSVVP-ERARVTLAPLPGMKGTDYINASYIMGYYRSNEFIVTQHPMPHTTTDFWRMIWDHNAQVIVMLPDNLGITEDEFVYWPSREEAMNCVAFTVTLINTDKLCLSNEEQLIIHDFILEATQQDDYVLEVRHFQCPNWPELNAPISSTFELINIIKEEAMTRDGPTIVHD-FGGVSAGMLCALTTLSQQLENESAVDVYQVAKMINLMRPGVFTDIEHYQYLYK 1280          

HSP 2 Score: 83.5741 bits (205), Expect = 5.484e-16
Identity = 71/261 (27.20%), Postives = 119/261 (45.59%), Query Frame = 3
Query:  750 KEFDASGCMKLDTQFKKCINFEPSDYDYMESKKRY-NLVKNRSDTIMPIESRRINLSCEPGVEG--SNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSN------ENMHQFWPGPDNNA-----LTFRWFKVHCNSEKTEFSVQYSFLISS--SREDYALDCTMHCLKYWPNTVSECSELLRLLFDINSKKY----SGPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPY 1472
            +EFD     +     K  I  E +++   + K RY N+V + S         R+ L   PG +   ++YINA+ + GY + + +I  Q PL  T +DFW+M+W++N S+I++++N          Q+WP  ++       +T +  KVH       F ++ + +      R +  +    H  + WP+       L  L F   S       SGPIVV    G  R G ++ + S+L Q++    VNV   +K I  +R Y
Sbjct:  779 QEFDLQEVQRSAADVK--ITAEHTNHPENKHKNRYINIVADHS---------RVKLLPLPGKDSKHTDYINANYVDGYNRPRAYIAAQGPLKSTFEDFWRMIWEQNTSVIVMITNLVEKGRRKCDQYWPSENSEEYGSILVTLKSTKVHAWYTLRHFLIRNTRVKKGQKGRHNSRIVVQYHYTQ-WPDMGVPEYTLPVLTFISRSSSARTPNSGPIVV-HCAGVGRTGTYIVIDSMLQQIKDKGTVNVLGFLKHIRTQRNY 1026          

HSP 3 Score: 68.1662 bits (165), Expect = 2.767e-11
Identity = 49/199 (24.62%), Postives = 89/199 (44.72%), Query Frame = 3
Query:   96 GFKRPYAYIATQGPLTETVADFWQMVWEQNSEIIVMISNFVERGRSKCE-IYW-SPNKTLNCGNISVHQIYQKEMAFYTERAFRIRNIRLKKNIKDR---TVYHYQYTDWRDFDXXXXXXXXXXFVRATTKHWSESSGPIIVHCSAGVGRTGTYICIESQIRQLDQEHHINVRGFLEHIRQQRMKLVQTESQYTFIHDA 677
            G+ R   +I TQ P+  T  DFW+M+W+ N+++IVM+ + +  G ++ E +YW S  + +NC   +V  I   ++    E    I +  L+   +D     V H+Q  +W + +           +    +      GP IVH   GV   G    + +  +QL+ E  ++V    + I   R  +      Y +++ A
Sbjct: 1088 GYYRSNEFIVTQHPMPHTTTDFWRMIWDHNAQVIVMLPDNL--GITEDEFVYWPSREEAMNCVAFTVTLINTDKLCLSNEEQLIIHDFILEATQQDDYVLEVRHFQCPNWPELN--APISSTFELINIIKEEAMTRDGPTIVHDFGGVS-AGMLCALTTLSQQLENESAVDVYQVAKMINLMRPGVFTDIEHYQYLYKA 1281          
BLAST of Receptor type tyrosine protein phosphatase zeta vs. Ensembl Cavefish
Match: ENSAMXT00000022449.2 (pep primary_assembly:Astyanax_mexicanus-2.0:21:17434140:17476836:-1 gene:ENSAMXG00000021796.2 transcript:ENSAMXT00000022449.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 284.263 bits (726), Expect = 7.844e-81
Identity = 168/501 (33.53%), Postives = 266/501 (53.09%), Query Frame = 3
Query:   96 GFKRPYAYIATQGPLTETVADFWQMVWEQNSEIIVMISNFVERGRSKCEIYWSPNKTLNCGNISVHQIYQKEMAFYTERAFRIRNIRLKKNIKDR-TVYHYQYTDWRDFDXXXXXXXXXXFVRATTKHWSESSGPIIVHCSAGVGRTGTYICIESQIRQLDQEHHINVRGFLEHIRQQRMKLVQTESQYTFIHDALYEYYLYPDREIHKLELSIYISKLKEFDASGCMK-LDTQFKKCINFEPSDYDYMESKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSN------ENMHQFWPGPDNNALTFRWFKVHCNSE-KTEFSVQYSFLISSSREDYALDCTMHCLKYWP-NTVSECSE-LLRLLFDINSKK----YSGPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYE-LLEFVILNQHLYT 1550
            G++R  AYIATQGP+ ET++DFW+MVWEQ++  I+MI+   E+ R+KC+ YW    T   G + V  +   E+A Y  R F +     K    +R  V  +Q+T W D  VP    P L F+R         +GPI+VHCSAGVGRTG +I I+  + ++ QE  I+V G +  +R QR  +VQTE QY FI+DAL E     + E+    L  YI +L + +    +  ++ +FK+  N    +  ++ +    N  KNR   IMP E+ R++L    GVEGS+Y+NAS I GY Q + +I TQ PL ET +D+W+M+W+ N +++++L+       E  HQ+W  P   +  +++F V   +E      +   F ++ +R+  +          WP   V +  E  +  +  ++  K      GPI V    G  R G+F+ +S +L ++R + VV+++  +KM+  +RP    +     F Y   LE++    H  T
Sbjct: 1018 GYRRQGAYIATQGPMPETISDFWRMVWEQHTANIIMITKLEEKSRNKCDQYWPSRGTETYGLMQVSVLDTVELATYCVRTFAL----FKSGCSERREVRQFQFTAWPDHGVPEHPTPFLAFLRRVKACNPPDAGPIVVHCSAGVGRTGCFIVIDGMLERVKQEKTIDVYGHVTLMRSQRNYMVQTEEQYVFIYDALMEAVTCGNTEVPARNLYAYIQRLTQAEPPDNISGMEQEFKRLANARAHNSRFVSANLPCNKFKNRLVNIMPYETTRVSLQPIRGVEGSDYVNASFIDGYRQQRAYIATQGPLAETAEDYWRMLWEHNSTIVVMLTKLREMGREKCHQYW--PSERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEEQYQFCYRAALEYLGSFDHYAT 1512          

HSP 2 Score: 102.064 bits (253), Expect = 1.305e-21
Identity = 81/326 (24.85%), Postives = 147/326 (45.09%), Query Frame = 3
Query:  723 ELSIYISKLKEFDASGCMKLDTQFKKCINFEPSD-YDYMESKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILL------SNENMHQFWPGPDNNALTFRWFKVHCNSEKTEFSVQYSFLISSSREDYALDCTMHCLKYWPN--TVSECSELLRLLFDINS--KKYSGPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYE-LLEFV------ILNQHLYTFFSRSQQDFIPNGIAHLPVSQKPILNNNTSSS 1646
            EL  YI ++K   A+  ++   +++   + +P   + +  S    N  KNR   ++  +  R+ LS   G  GS+YINA+ I GY +   +I TQ P+ ET  DFW+MVW+++ + II++      S     Q+WP             V    E   + V+ +F +  S      +        WP+       +  L  L  + +     +GPIVV    G  R G F+ +  +L +++++  ++VY  + ++  +R Y   +    +FIY+ L+E V      +  ++LY +  R  Q   P+ I+ +    K + N    +S
Sbjct:  941 ELPNYIERMK---ANENLRFSQEYE---SIDPGQQFSWEHSNLEINKPKNRYANVIAYDHTRVVLSNNDGQPGSDYINANFIDGYRRQGAYIATQGPMPETISDFWRMVWEQHTANIIMITKLEEKSRNKCDQYWPSRGTETYGLMQVSVLDTVELATYCVR-TFALFKSGCSERREVRQFQFTAWPDHGVPEHPTPFLAFLRRVKACNPPDAGPIVVHCSAGVGRTGCFIVIDGMLERVKQEKTIDVYGHVTLMRSQRNYMVQTEEQYVFIYDALMEAVTCGNTEVPARNLYAYIQRLTQAEPPDNISGMEQEFKRLANARAHNS 1259          
BLAST of Receptor type tyrosine protein phosphatase zeta vs. Ensembl Sea Lamprey
Match: ca16b (carbonic anhydrase XVI b [Source:ZFIN;Acc:ZDB-GENE-080818-1])

HSP 1 Score: 340.887 bits (873), Expect = 1.360e-106
Identity = 193/506 (38.14%), Postives = 284/506 (56.13%), Query Frame = 3
Query:   96 GFKRPYAYIATQGPLTETVADFWQMVWEQNSEIIVMISNFVERGRSKCEIYWSPNKTLNCGNISVHQIYQKEMAFYTERAFRIRNIRLKKNIK----------DRTVYHYQYTDWRDFDXXXXXXXXXXFVRATTKHWSESSGPIIVHC--SAGVGRTGTYICIESQIRQLDQEHHINVRGFLEHIRQQRMKLVQTESQYTFIHDALYEYYLYPDREIHKLELSIYISKLKEFDASGCMK----------LDTQFKKCINFEPSDYDYMESKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSN-----ENMHQFWPGPDNNALTFRWFKVHCNSE------KTEFSVQYSFLISSSREDYALDCTMHCLKYWPNTVSECSELLRLLFDINSKKYS--GPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIY 1508
            G+ R  AYIA QGPL  T ADFW+MVWEQN+ IIVMI+N VE+GR KC+ YW        GNI V     + +A YT R F IRN +L+K             +R V  + YT W D   P  +LPVL FVR ++   ++  GP++VHC  SAGVGRTGTYI ++S ++Q+     +NV GFL+HIR QR  LVQ + QYTFIH++L E  L  + E+   +L  Y + +    A+   +          L+ QF+          ++  + K  N  KNR+ +I+P+E  R+ LS   G+EG++YINAS I GY++  EFI+TQHPL  T +DFW+M+WD N  +I++L +     E+   +WPG +  A+    F V   +E        E  V + F++   ++DY L+   +    WP+T    S    ++  I  +  +  GP ++ DE+G   AG F A+++LLHQL + + V+V+ V KM+++ RP  F+      F+Y
Sbjct:  157 GYNRQKAYIAAQGPLKATFADFWRMVWEQNTGIIVMITNLVEKGRRKCDQYWPSESNEEYGNILVTLKSTRTLACYTVRHFTIRNTKLRKGTSQKSSARGRQNERLVVQFHYTQWPDMGTPDYALPVLTFVRKSSATRTDLMGPVVVHCRRSAGVGRTGTYIVLDSMLQQIRDSGTVNVLGFLKHIRTQRNYLVQPQEQYTFIHESLLEAVLTGETEVAPGQLHAYYTSILSPAATDVTRPVVTATENTHLEKQFRLVTQCSVRQSEFFSATKHCNKEKNRNSSIVPVERSRVGLSSLSGLEGTDYINASYITGYYRSNEFIVTQHPLPHTTRDFWRMIWDHNAQIIVMLPDGQGLAEDESVYWPGRE-EAMNCDDFTVTLINEDRLCLANEEQLVIHDFILECLQDDYVLEVRHYQCPRWPDTEGPLSNAFEIINVIREEATTRDGPTILHDEFGGVSAGTFCALTTLLHQLEEQESVDVFQVCKMVNLMRPGVFTDIEQYHFVY 661          

HSP 2 Score: 93.2041 bits (230), Expect = 7.558e-20
Identity = 73/256 (28.52%), Postives = 111/256 (43.36%), Query Frame = 3
Query:  864 KNRSDTIMPIESRRINLSCEPGVEG--SNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSN------ENMHQFWPGPDNN----------------ALTFRWFKVHCNSEKTEFSVQYSFLISSSREDYALDCTMHCLKYWPNTVSECSELLRLLFDINSKK----YSGPIVV--IDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYE-LLEFVILNQ 1538
            KNR   I+  +  R+ L   PG +   S+YINA+ + GY + K +I  Q PL  T  DFW+MVW++N  +I++++N          Q+WP   N                   T R F +     +   S + S   +  R++  L    H  + WP+  +    L  L F   S        GP+VV      G  R G ++ + S+L Q+R    VNV   +K I  +R Y         FI+E LLE V+  +
Sbjct:  120 KNRYVNIVAYDHSRVRLRPLPGKDSKHSDYINANYVDGYNRQKAYIAAQGPLKATFADFWRMVWEQNTGIIVMITNLVEKGRRKCDQYWPSESNEEYGNILVTLKSTRTLACYTVRHFTIRNTKLRKGTSQKSS---ARGRQNERLVVQFHYTQ-WPDMGTPDYALPVLTFVRKSSATRTDLMGPVVVHCRRSAGVGRTGTYIVLDSMLQQIRDSGTVNVLGFLKHIRTQRNYLVQPQEQYTFIHESLLEAVLTGE 371          

HSP 3 Score: 76.2554 bits (186), Expect = 1.525e-14
Identity = 53/198 (26.77%), Postives = 94/198 (47.47%), Query Frame = 3
Query:   96 GFKRPYAYIATQGPLTETVADFWQMVWEQNSEIIVMISNFVERGRSKCE-IYW-SPNKTLNCGNISVHQIYQKEMAFYTERAFRIRNIRLKKNIKDRT--VYHYQYTDWRDFDXXXXXXXXXXFVRATTKHWSESSGPIIVHCSAGVGRTGTYICIESQIRQLDQEHHINVRGFLEHIRQQRMKLVQTESQYTFIHDA 677
            G+ R   +I TQ PL  T  DFW+M+W+ N++IIVM+ +   +G ++ E +YW    + +NC + +V  I +  +    E    I +  L+    D    V HYQ   W D + P S+      +    +  +   GP I+H   G    GT+  + + + QL+++  ++V    + +   R  +     QY F++ A
Sbjct:  470 GYYRSNEFIVTQHPLPHTTRDFWRMIWDHNAQIIVMLPD--GQGLAEDESVYWPGREEAMNCDDFTVTLINEDRLCLANEEQLVIHDFILECLQDDYVLEVRHYQCPRWPDTEGPLSNAFE--IINVIREEATTRDGPTILHDEFGGVSAGTFCALTTLLHQLEEQESVDVFQVCKMVNLMRPGVFTDIEQYHFVYRA 663          
BLAST of Receptor type tyrosine protein phosphatase zeta vs. Ensembl Sea Lamprey
Match: ptpra (protein tyrosine phosphatase receptor type A [Source:ZFIN;Acc:ZDB-GENE-020107-1])

HSP 1 Score: 250.366 bits (638), Expect = 2.290e-72
Identity = 151/491 (30.75%), Postives = 255/491 (51.93%), Query Frame = 3
Query:   96 GFKRPYAYIATQG--PLTETVADFWQMVWEQNSEIIVMISNFVERGRSKCEIYWSPNKTLNCGNISVHQIYQKEMAFYTERAFRIRNIRLKKNIKD-RTVYHYQYTDWRDFDXXXXXXXXXXFVRATTKHWSESSGPIIVHCSAGVGRTGTYICIESQIRQLDQEHHINVRGFLEHIRQQRMKLVQTESQYTFIHDALYEYYLYPDREIHKLELSIYISKL-KEFDASGCMKLDTQFKKCINFEPSDYDYMESKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWD-ENCSLIILL-----SNENMHQFWPGPDNNALTFRWFKVHCNSEKTEFSVQY-SFLISSSREDYALDCTMHCLKYWP--NTVSECSELLRLLFDINS-KKYSG--PIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELLE 1520
            G++    +IA QG  P  ET+ D+W+M+WE N+  IVM++N  ER   KC  YW        GN+ V       +  YT R F I+ +    N K  R +  + +T W DF VP + + +L F++         +GPI+VHCSAGVGRTGT+I I++ +  +  E  ++V GF+  IR QR ++VQT+ QY FI+ AL E+ LY D E+    L  ++ KL  +   +GC  L+ +FKK    +  +          N+ KNR   I+P +  R+ +  + G E ++YIN S I GY Q   F+  Q PL +T +DFW+MVW+  +CS+++L        E   ++W  P    +T+    +    E +  S     F +S++RE+ +          WP      +   ++ L+  +   ++++G  PI V    G+ R G F A+ ++L +++ + +++V+  +K +  +RP+   +     F Y++++
Sbjct:  249 GYQEKNKFIAAQGKGPKEETLNDYWRMIWELNTATIVMVTNLKERKECKCAQYWPDQGCWTYGNLRVSVEDVTVLVDYTIRKFLIQVVGDIPNKKPPRLITQFHFTSWPDFGVPFAPIGMLKFLKKVKTCNPPYAGPIVVHCSAGVGRTGTFIVIDAMLDMIQTERKVDVFGFVTRIRAQRCQMVQTDMQYVFIYQALLEFQLYGDTELEVTSLESHLQKLYNKNTPTGCTGLEDEFKKLTTVKIQNEKMRTGNLPANMKKNRVLQIIPYDFNRVIIPMKRGEEFTDYINGSFIDGYRQKDAFLAGQGPLQQTVEDFWRMVWEWRSCSIVMLTELEERGQEKCARYW--PTEGTITYGDIIIELKQENSHDSYTVRDFSVSNTRENKSRQIRQFHFHGWPEIGIPEDGKGMISLIAAVQKQQQHTGNHPITVHCSAGAGRTGTFCALCTILERVKTEGILDVFQTVKSLRTQRPHMVQTLEQYEFCYKVVQ 737          

HSP 2 Score: 125.946 bits (315), Expect = 4.490e-30
Identity = 68/199 (34.17%), Postives = 107/199 (53.77%), Query Frame = 3
Query:   96 GFKRPYAYIATQGPLTETVADFWQMVWEQNSEIIVMISNFVERGRSKCEIYWSPNKTLNCGNISVHQIYQKEMAFYTERAFRIRNIRLKKNIKDRTVYHYQYTDWRDFDXXXXXXXXXXFVRATTKHWSESSG-PIIVHCSAGVGRTGTYICIESQIRQLDQEHHINVRGFLEHIRQQRMKLVQTESQYTFIHDALYEY 689
            G+++  A++A QGPL +TV DFW+MVWE  S  IVM++   ERG+ KC  YW    T+  G+I +    +     YT R F + N R  K+   R +  + +  W +  +P     ++  + A  K    +   PI VHCSAG GRTGT+  + + + ++  E  ++V   ++ +R QR  +VQT  QY F +  + EY
Sbjct:  544 GYRQKDAFLAGQGPLQQTVEDFWRMVWEWRSCSIVMLTELEERGQEKCARYWPTEGTITYGDIIIELKQENSHDSYTVRDFSVSNTRENKS---RQIRQFHFHGWPEIGIPEDGKGMISLIAAVQKQQQHTGNHPITVHCSAGAGRTGTFCALCTILERVKTEGILDVFQTVKSLRTQRPHMVQTLEQYEFCYKVVQEY 739          

HSP 3 Score: 94.3597 bits (233), Expect = 3.535e-20
Identity = 73/249 (29.32%), Postives = 120/249 (48.19%), Query Frame = 3
Query:  840 SKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQ--HPLDETEQDFWKMVWDENCSLIILLSNENMH------QFWPGPDNNALTFRWFKVHCNSEKTEFSVQYS---FLIS-----SSREDYALDCTMHCLKYWPNTVSECSELLRLLFDINSKK----YSGPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYE-LLEF 1523
            + K  N  KNR   I+P ++ R++L+   GV  S+YINAS + GY +  +FI  Q   P +ET  D+W+M+W+ N + I++++N          Q+W  PD    T+   +V  + E     V Y+   FLI       +++   L    H    WP+     + +  L F    K     Y+GPIVV    G  R G F+ + ++L  ++ +  V+V+  +  I  +R     +    +FIY+ LLEF
Sbjct:  206 ASKEENKEKNRYVNILPYDNFRVHLTSLEGVPDSDYINASYVNGYQEKNKFIAAQGKGPKEETLNDYWRMIWELNTATIVMVTNLKERKECKCAQYW--PDQGCWTYGNLRV--SVEDVTVLVDYTIRKFLIQVVGDIPNKKPPRLITQFH-FTSWPDFGVPFAPIGMLKFLKKVKTCNPPYAGPIVVHCSAGVGRTGTFIVIDAMLDMIQTERKVDVFGFVTRIRAQRCQMVQTDMQYVFIYQALLEF 449          
BLAST of Receptor type tyrosine protein phosphatase zeta vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002738.1 (pep scaffold:Pmarinus_7.0:GL477626:22501:55781:-1 gene:ENSPMAG00000002497.1 transcript:ENSPMAT00000002738.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 204.142 bits (518), Expect = 3.078e-57
Identity = 153/486 (31.48%), Postives = 233/486 (47.94%), Query Frame = 3
Query:   96 GFKRPYAYIATQGPLTETVADFWQMVWEQNSEIIVMISNFVERGRSKCEIYWSPNKTLNCGNISVHQIYQKEMAFYTERAFRIRNIRLKKNIKDRTVYHYQYTDWRDFDXXXXXXXXXXFVRATTKHWSESSGPIIVHC--SAGVGRTGTYICIESQIRQLDQEHHINVRGFLEHIRQQRMKLVQTESQYTFIHDALYEYYLYPDREIHKLELSIYISKLKEFDA-SGCMKLDTQFKKCINFEPS--DYDYMESKKRYNLVKNRSDTIMPIESRRINLSCEP---GVEG--SNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLS----NENMHQFWPGPDNNALTFRWFKVH---CNSEKTEFSVQYSFL-ISSSREDYALDCTMHCLKY--WPNTVSECSELLRLL--------FDINSKKYSGPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERP 1469
            G+++   YIATQGPL ET  DFW+MVW++ S  IVM++N VE GR KC  YW P+ T   G+I+V  ++ + +A Y  R F   +++ K       V  + +T W D  VP  +  +L FVR         +GPII HC  SAG GRTG Y+ I+  +    +E  I+V   +  +R QR+ +VQTE QY FIHD L E  L  D  I          +L   D  +    L  +F       P+    D   +    N  KNR    +P +       C P    +EG  SNYINA+ +  Y +   FI+TQHPL  T +DFW++V+D +C+ +I+L+    +E   Q+W  P+  +L +    V    C  +    S  +    IS  ++ +     +  L+Y  WP+     +  L  L        +     +  G  +V    G  R+G + A+S L   ++   VV+V+  +K +   +P
Sbjct:   85 GYQKQRQYIATQGPLQETAVDFWRMVWQEKSSSIVMVTNLVEVGRVKCFKYW-PDDTQQLGDIAVTLLHTELLAEYVIRTF---SVKRKGYFDALEVRQFHFTGWPDHGVPAFATGLLSFVRRVKASNPPEAGPIITHCRDSAGAGRTGCYVVIDVMLEMAGREGVIDVYNCVRELRLQRVNMVQTEEQYVFIHDVLLEACLCGDTAIPAANFRSAYLELTRLDPQTHSTPLKEEFMTLNTVTPALRAEDCSIALLPRNSSKNRVKEALPPD------RCLPFLLTLEGDSSNYINAALLDSYHRPSAFIVTQHPLPNTVKDFWRLVFDYHCTSVIMLNEMRPSETCPQYW--PEEGSLQYGAVHVETLSCCRDGDIISRIFRIHNISRPQDGHREVQHVQHLQYLGWPSHRDAPASPLSFLRVAGRVRRWHAELAEEEGRTLVHCLSGGGRSGTYCAVSVLCDMVKGQSVVDVFTAVKTLRNNKP 558          

HSP 2 Score: 77.7962 bits (190), Expect = 3.926e-15
Identity = 51/188 (27.13%), Postives = 85/188 (45.21%), Query Frame = 3
Query:   99 FKRPYAYIATQGPLTETVADFWQMVWEQNSEIIVMISNFVERGRSKCEIYWSPNKTLNCGNISVHQIYQKEMAFYTERAFRIRNIRLKKNIKDRT--VYHYQYTDWRDFDXXXXXXXXXXFVRATTKHW----SESSGPIIVHCSAGVGRTGTYICIESQIRQLDQEHHINVRGFLEHIRQQRMKLVQ 644
            + RP A+I TQ PL  TV DFW++V++ +   ++M++    R    C  YW    +L  G + V  +          R FRI NI   ++       V H QY  W      P+S    + V    + W    +E  G  +VHC +G GR+GTY  +      +  +  ++V   ++ +R  +  +V+
Sbjct:  377 YHRPSAFIVTQHPLPNTVKDFWRLVFDYHCTSVIMLNEM--RPSETCPQYWPEEGSLQYGAVHVETLSCCRDGDIISRIFRIHNISRPQDGHREVQHVQHLQYLGWPSHRDAPASPLSFLRVAGRVRRWHAELAEEEGRTLVHCLSGGGRSGTYCAVSVLCDMVKGQSVVDVFTAVKTLRNNKPDMVE 562          

HSP 3 Score: 74.3294 bits (181), Expect = 4.136e-14
Identity = 61/243 (25.10%), Postives = 113/243 (46.50%), Query Frame = 3
Query:  840 SKKRYNLVKNRSDTIMPIE-SRRINLSCEPGVEGSNYINASAIQ-GYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSN------ENMHQFWPGPDNNALTFRWFKVHCNSEKTEFSVQYSF-LISSSREDY--ALDCTMHCLKYWPN--TVSECSELLRLLFDINSKK--YSGPIVV--IDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELL 1517
            +KK  N  +NR   I+ ++ S+++ +  +  V   +Y  A   Q GY + +++I TQ PL ET  DFW+MVW E  S I++++N          ++WP             +H     TE   +Y     S  R+ Y  AL+        WP+    +  + LL  +  + +     +GPI+    D  G+ R G +V +  +L    ++ V++VY  ++ + ++R     +    +FI+++L
Sbjct:   41 AKKDENRGRNRYGNIIALKHSQKLKVR-KQRVLSQDYTEAYVEQHGYQKQRQYIATQGPLQETAVDFWRMVWQEKSSSIVMVTNLVEVGRVKCFKYWPDDTQQLGDIAVTLLH-----TELLAEYVIRTFSVKRKGYFDALEVRQFHFTGWPDHGVPAFATGLLSFVRRVKASNPPEAGPIITHCRDSAGAGRTGCYVVIDVMLEMAGREGVIDVYNCVRELRLQRVNMVQTEEQYVFIHDVL 277          
BLAST of Receptor type tyrosine protein phosphatase zeta vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006943.1 (pep scaffold:Pmarinus_7.0:GL476401:102791:181294:1 gene:ENSPMAG00000006261.1 transcript:ENSPMAT00000006943.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 211.46 bits (537), Expect = 3.154e-57
Identity = 146/440 (33.18%), Postives = 215/440 (48.86%), Query Frame = 3
Query:   96 GFKRPYAYIATQGPLTETVADFWQMVWEQNSEIIVMISNFVERGRSKCEIYW-SPNKTLNCGNISVHQIYQKEMAFYTERAFRIRNIRLKKNIKDR-----TVYHYQYTDWRDFDXXXXXXXXXXFVRATTKHWSESSGPIIV-HCSAGVGRTGTYICIESQIRQ-LDQEHHINVRGFLEHIRQQRMKLVQTESQYTFIHDALYEYYLYPDREIHKLELSIYISKLKEFDASGCMKLDTQFKKCINFEPSDYDYMESKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSNENMHQ------FWPGPDNNALTFRWFKVHCNSE------KTEFSVQYSFLISSSREDYALDCTMHCLKYWPNTVSECSELLRLLFDINSKKYS--GPIVVID 1349
            G+ +P AYIATQGPL  T  DFW+MVWEQN  ++VMI+N VE+GR KC+ YW S   +   G + V     K +AFYT R F +RN + ++  + R     T   +  T +      P + P L   R     +S     I   HC+  +  +    C   ++ Q L  +   NV G   HI  +    +  + QY FIH+AL E     + E+    L  Y++ +     SG  +++  FK  +       D+  ++K  N  KNRS  ++P+ES R+ L+    VEGS+YINAS I GY    E+I+TQHPL  T +DFW+M+WD N  LII+L   N  +      +WP  D  A+    F V   SE        E  V    ++ ++++DY L+        WPN     S +  L+  +  +  +  GP VV D
Sbjct:  890 GYNKPRAYIATQGPLKGTFEDFWRMVWEQNVRVVVMITNLVEKGRRKCDQYWPSDGSSEEYGGVLVSLKSSKTLAFYTVRRFALRNTKQRRVTRRRRPARCTCLLFHSTSYPGMGGAPIAKPSLPVHRLIPAAYSSMWHAIKPKHCNPSLLHSPVIFCAFHRLLQRLHHQQIYNVFGKKWHISVKPNHFLAVQEQYVFIHEALLEAIQGRETEVASSSLHAYVNGILTPGPSGLTRVEKHFKLILQ-SGLHSDFTSAQKPCNQNKNRSTAVLPVESSRVELASLGDVEGSDYINASYIMGYSSSTEYIMTQHPLPNTIKDFWRMIWDYNVQLIIMLPGPNQDKDGEEFAYWPRRD-QAMHCEGFGVSLISEDRLCLSSEEQVVIRELILEATQDDYVLEVKHFQCPRWPNPDGPISSVFELVNIVAKEALTRDGPTVVHD 1327          

HSP 2 Score: 66.2402 bits (160), Expect = 2.176e-11
Identity = 38/114 (33.33%), Postives = 62/114 (54.39%), Query Frame = 3
Query:  855 NLVKNRSDTIMPIESRRINLSCEPGVEG--SNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSN------ENMHQFWPGPDNNALTFRWFKVHCNSEKT 1172
            N  KNR   I+  +  R+ L    G +   S+YINA+ I+GY + + +I TQ PL  T +DFW+MVW++N  ++++++N          Q+WP  D ++  +    V   S KT
Sbjct:  850 NKSKNRYINIVAYDHSRVRLRVLSGKDSKHSDYINANYIEGYNKPRAYIATQGPLKGTFEDFWRMVWEQNVRVVVMITNLVEKGRRKCDQYWPS-DGSSEEYGGVLVSLKSSKT 962          
BLAST of Receptor type tyrosine protein phosphatase zeta vs. Ensembl Sea Lamprey
Match: ptprk (protein tyrosine phosphatase receptor type K [Source:ZFIN;Acc:ZDB-GENE-030131-9834])

HSP 1 Score: 196.823 bits (499), Expect = 2.409e-52
Identity = 121/345 (35.07%), Postives = 186/345 (53.91%), Query Frame = 3
Query:   96 GFKRPYAYIATQGPLTETVADFWQMVWEQNSEIIVMISNFVERGRSKCEIYWSPNKTLNCGNISVHQIYQKEMAFYTERAFRIRNIRLKKNIKDRTVYHYQYTDWRDFDXXXXXXXXXXFVRATTKHWSESSGPIIVHCSAGVGRTGTYICIESQIRQLDQEHHINVRGFLEHIRQQRMKLVQTESQYTFIHDALYEYYLYPDREIHKLEL-SIYISKLKEFDASGCMKLDTQFKKCINFEPSDY--DYMESKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILL----SNENMHQFWP 1109
            G+ R + YIATQGPL +TV  FW+M+W++ S  I+M++N VE GR KC  YW P+ +   G+I V     + ++ Y  R FR+     +++I  R V  + +T W D  VP  +  +L F+R         +GP++VHCSAG GRTG Y+ I+  +   + E  I++   +  +R +R+ +VQTE QY FIHDA+ E  L  D  I   +  + Y   L+    S    +  +F+      P     D   +    N  KNR   ++P + R +        + SNYINA+ +  Y Q   FI+TQHPL  T +DFW++V+D +C+ I++L    SN+   Q+WP
Sbjct:  979 GYYRTHHYIATQGPLPDTVGGFWRMIWQERSASIIMVTNLVEVGRIKCCKYW-PDGSDVYGDIKVTLADTEMLSEYIIRTFRVERAG-QEDI--REVRQFHFTGWPDHGVPYHATGLLAFIRRIKALDPPHAGPLVVHCSAGAGRTGCYMVIDIMLDMAESEGVIDIYNCVRELRTRRVNMVQTEEQYVFIHDAMLEACLCGDTCIPAGDFRAAYAEMLRPDPQSSSNHIKDEFQTLNMVTPPLRVEDCSIALLPRNHEKNRYHDVLPPD-RCLPFLITINGDSSNYINAALMDSYRQPSAFIVTQHPLPNTVKDFWRLVFDYHCTSIVMLNELDSNKYCPQYWP 1318          

HSP 2 Score: 80.8777 bits (198), Expect = 6.910e-16
Identity = 56/249 (22.49%), Postives = 114/249 (45.78%), Query Frame = 3
Query:  810 FEPSDYDYMESKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSNE------NMHQFWPGPDNNALTFRWFKVHCNSEKTEFSVQY---SFLISSSREDYALDCTMHCLKYWPN--TVSECSELLRLLFDINS--KKYSGPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELL 1517
            FE     +  +K+  N  KNR   I+  +  R+ L+     + S+YINA+ + GY++   +I TQ PL +T   FW+M+W E  + II+++N          ++W  PD + +   +  +      TE   +Y   +F +  + ++   +        WP+       + LL  +  I +    ++GP+VV    G+ R G ++ +  +L     + V+++Y  ++ +   R     +    +FI++ +
Sbjct:  926 FEGQSAPWDVAKRDENRAKNRYGNIIAYDHSRVMLNVLDEEQNSDYINANYVDGYYRTHHYIATQGPLPDTVGGFWRMIWQERSASIIMVTNLVEVGRIKCCKYW--PDGSDV---YGDIKVTLADTEMLSEYIIRTFRVERAGQEDIREVRQFHFTGWPDHGVPYHATGLLAFIRRIKALDPPHAGPLVVHCSAGAGRTGCYMVIDIMLDMAESEGVIDIYNCVRELRTRRVNMVQTEEQYVFIHDAM 1169          
BLAST of Receptor type tyrosine protein phosphatase zeta vs. Ensembl Yeast
Match: PTP1 (Phosphotyrosine-specific protein phosphatase; dephosphorylates a broad range of substrates in vivo, including Fpr3p; localized to the cytoplasm and the mitochondria; proposed to be a negative regulator of filamentation [Source:SGD;Acc:S000002389])

HSP 1 Score: 88.1965 bits (217), Expect = 2.771e-19
Identity = 68/230 (29.57%), Postives = 107/230 (46.52%), Query Frame = 3
Query:  108 PYAYIATQGPLTETVADFWQMVWEQ---NSEIIVMISNFVERGRSKCEIYWS----------PNKTLNCGNISVHQIYQKEMAFYTERAFRIRNIRLKKNIK----------DRTVYHYQYTDWRDFDXXXXXXXXXXFVRATTKHWSESSGPIIVHCSAGVGRTGTYICIESQI-------------RQLDQEHHINVRGFLEHI----RQQRMKLVQTESQYTFIHDA 677
            P  YIATQGP  +T   FWQM +     ++ +IVM++  VE  R KC  YW            +K  + G  +    +  ++        ++++     +IK           +TV+H+ +  W+D + P   +P++    A +   +    PIIVHCSAGVGRTGT+I ++  +             R  D+      R  +E I    R QRMK+VQT+ Q+ FI+ A
Sbjct:   96 PGYYIATQGPTRKTWDQFWQMCYHNCPLDNIVIVMVTPLVEYNREKCYQYWPRGGVDDTVRIASKWESPGGANDMTQFPSDLKIEFVNVHKVKDYYTVTDIKLTPTDPLVGPVKTVHHFYFDLWKDMNKPEEVVPIMELC-AHSHSLNSRGNPIIVHCSAGVGRTGTFIALDHLMHDTLDFKNITERSRHSDRATEEYTRDLIEQIVLQLRSQRMKMVQTKDQFLFIYHA 324          

HSP 2 Score: 52.7582 bits (125), Expect = 1.057e-7
Identity = 61/230 (26.52%), Postives = 97/230 (42.17%), Query Frame = 3
Query:  855 NLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQ----------GYWQMKEFIITQHPLDETEQDFWKMVWDENCSL----IILLS------NENMHQFWP--GPDNNA-LTFRWFKVHCNSEKTEF--SVQYSFLISSSREDY--ALDC-------------TMHCLKY--W-----PNTVSECSELLRLLFDINSKKYSGPIVVIDEYGSSRAGIFVAMSSLLH 1403
            N  +NR   IMP E  R++L     + G++YINAS ++          GY     +I TQ P  +T   FW+M +  NC L    I++++       E  +Q+WP  G D+   +  +W      ++ T+F   ++  F+     +DY    D              T+H   +  W     P  V    EL      +NS+    PI+V    G  R G F+A+  L+H
Sbjct:   52 NDARNRYVNIMPYERNRVHLKT---LSGNDYINASYVKVNVPGQSIEPGY-----YIATQGPTRKTWDQFWQMCY-HNCPLDNIVIVMVTPLVEYNREKCYQYWPRGGVDDTVRIASKWESPGGANDMTQFPSDLKIEFVNVHKVKDYYTVTDIKLTPTDPLVGPVKTVHHFYFDLWKDMNKPEEVVPIMELCAHSHSLNSR--GNPIIVHCSAGVGRTGTFIALDHLMH 270          
BLAST of Receptor type tyrosine protein phosphatase zeta vs. Ensembl Yeast
Match: PTP2 (Nuclear phosphotyrosine-specific phosphatase involved in osmosensing; involved in the inactivation of mitogen-activated protein kinase (MAPK) during osmolarity sensing; dephosporylates Hog1p MAPK and regulates its localization; with Msg5p co-regulates the calcium signaling pathway [Source:SGD;Acc:S000005734])

HSP 1 Score: 50.447 bits (119), Expect = 9.281e-7
Identity = 25/83 (30.12%), Postives = 45/83 (54.22%), Query Frame = 3
Query:  480 SESSGPIIVHCSAGVGRTGTYICIESQIRQLDQ-EHHIN-----------VRGFLEHIRQQRMKLVQTESQYTFIHDALYEYY 692
            + +S P++VHCSAG GRTG ++ ++  +  L    +H N           +   +  +R+QR+ +VQ  +QY   ++AL  Y+
Sbjct:  656 TANSSPLLVHCSAGCGRTGVFVTLDFLLSILSPTTNHSNKIDVWNMTQDLIFIIVNELRKQRISMVQNLTQYIACYEALLNYF 738          
BLAST of Receptor type tyrosine protein phosphatase zeta vs. Ensembl Nematostella
Match: EDO48187 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK45])

HSP 1 Score: 286.574 bits (732), Expect = 3.388e-87
Identity = 174/495 (35.15%), Postives = 270/495 (54.55%), Query Frame = 3
Query:   96 GFKRPYAYIATQGPLTETVADFWQMVWEQNSEIIVMISNFVERGRSKCEIYWSPNKTLNCGNISVHQIYQKEMAFYTERAFRIRNIRLKKNIKD-RTVYHYQYTDWRDFDXXXXXXXXXXFVRATTKHWSESSGPIIVHCSAGVGRTGTYICIESQIRQLDQEHHINVRGFLEHIRQQRMKLVQTESQYTFIHDALYEYYLYPDREIHKLELSIYISKLKEFDA-SGCMKLDTQFKK---CINFEPSDYDYMESKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSNE------NMHQFWPGPDNNALTFRWFKVHCNSE-KTEFSVQYSFLISSSREDYALDCTMHCLKYWP------NTVSECSELLRLLFDI---NSKKYSGPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELL 1517
            G++R  AYIA QGPL ET  DFW+MVWEQNS  I+M++N  ER R KC  YW    +L+  +I+V      E+  Y  R   ++    ++   D R V  + +T W D  VP S   +L FVR +T+     +GP++VHCSAGVGRTGT+I I+  ++Q+ +E  +++ GF+  +R+ R  +VQTE QY FIHDAL +  +  + E    +L  +I +L+E D  SG   + T+F+K   CIN   S      +    N  KNR   ++P +  R+ LS + GVEGS+YINA+ I GY   + FI TQ P+ ET  DFW+MVW++NC  I+ L+ E       MH++WPG     +TF    V    + K+   V   F ++++    + D        W       + +S C +L+ L+  +    ++    PI+V    G  R G+F A+S L+ +L+ + +V+V+  +K +  +RP    +     F Y+++
Sbjct:   82 GYRRDNAYIAAQGPLAETCRDFWRMVWEQNSRTIIMLTNLKERCRDKCAQYWPSRGSLSYEDITVTLDSVTELTPYIVRTLSVQ----REGCDDVRQVKQFHFTSWPDHGVPTSVCNLLAFVRDSTRADPPGAGPMVVHCSAGVGRTGTFIVIDVMLQQIHEEKTVDILGFVSTLRRHRNLMVQTEQQYIFIHDALLDAIISGETETSASDLRSHIRRLQEQDPESGYTPMFTEFQKLSRCIN---SSLSLNAATHPVNKRKNRYANVLPYDVTRVRLSMQVGVEGSDYINANYIDGYMAKRTFIATQAPIPETIPDFWRMVWEQNCCTIVTLAQEVEQAKAKMHRYWPG--KQPITFGSLVVEMQDKVKSGHLVVRIFKLTNTEVSASRDVRQFHYTSWTEENPLEDGLSRC-QLIDLIGQVQYWQAESGRHPIIVHCSAGVGRTGVFCAVSILIERLKAEAMVDVFQTVKQLREQRPAMVQTKGQYDFCYQVV 566          

HSP 2 Score: 124.405 bits (311), Expect = 1.158e-29
Identity = 67/202 (33.17%), Postives = 106/202 (52.48%), Query Frame = 3
Query:   96 GFKRPYAYIATQGPLTETVADFWQMVWEQNSEIIVMISNFVERGRSKCEIYWSPNKTLNCGNISVHQIYQKEMAFYTERAFRIRNIRLKKNIKDRTVYHYQYTDWRDFDXXXXXXXXXXFVR--ATTKHWSESSG--PIIVHCSAGVGRTGTYICIESQIRQLDQEHHINVRGFLEHIRQQRMKLVQTESQYTFIHDALYEY 689
            G+     +IATQ P+ ET+ DFW+MVWEQN   IV ++  VE+ ++K   YW   + +  G++ V    + +      R F++ N  +  +   R V  + YT W + +     L     +      ++W   SG  PIIVHCSAGVGRTG +  +   I +L  E  ++V   ++ +R+QR  +VQT+ QY F +  + EY
Sbjct:  371 GYMAKRTFIATQAPIPETIPDFWRMVWEQNCCTIVTLAQEVEQAKAKMHRYWPGKQPITFGSLVVEMQDKVKSGHLVVRIFKLTNTEVSAS---RDVRQFHYTSWTEENPLEDGLSRCQLIDLIGQVQYWQAESGRHPIIVHCSAGVGRTGVFCAVSILIERLKAEAMVDVFQTVKQLREQRPAMVQTKGQYDFCYQVVLEY 569          

HSP 3 Score: 87.4261 bits (215), Expect = 5.939e-18
Identity = 65/236 (27.54%), Postives = 108/236 (45.76%), Query Frame = 3
Query:  864 KNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSN------ENMHQFWPGPDNNALTFRWFKVHCNSEKTEFSVQYSFLISSSRE--DYALDCTMHCLKYWPNTVSECSELLRLLFDINSKKY----SGPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELLEFVILN 1535
            KNR   I+  +  R+ L       GS+YINA+ + GY +   +I  Q PL ET +DFW+MVW++N   II+L+N      +   Q+WP     +L++    V  +S  TE +      +S  RE  D            WP+     S    L F  +S +     +GP+VV    G  R G F+ +  +L Q+ ++  V++   +  +   R     +    +FI++ L   I++
Sbjct:   47 KNRYINIVAYDHSRVKLQDFEDEPGSDYINANFLPGYRRDNAYIAAQGPLAETCRDFWRMVWEQNSRTIIMLTNLKERCRDKCAQYWPS--RGSLSYEDITVTLDS-VTELTPYIVRTLSVQREGCDDVRQVKQFHFTSWPDHGVPTSVCNLLAFVRDSTRADPPGAGPMVVHCSAGVGRTGTFIVIDVMLQQIHEEKTVDILGFVSTLRRHRNLMVQTEQQYIFIHDALLDAIIS 279          
BLAST of Receptor type tyrosine protein phosphatase zeta vs. Ensembl Nematostella
Match: EDO45382 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RT25])

HSP 1 Score: 279.256 bits (713), Expect = 2.040e-84
Identity = 163/499 (32.67%), Postives = 274/499 (54.91%), Query Frame = 3
Query:   96 GFKRPYAYIATQGPLTETVADFWQMVWEQNSEIIVMISNFVERGRSKCEIYWSPNKTLNCGNISVHQIYQKEMAFYTERAFRIRNIRLKKNIKDRTVYHYQYTDWRDFDXXXXXXXXXXFVRATTK-HWSESSGPIIVHCSAGVGRTGTYICIESQIRQLDQEHHINVRGFLEHIRQQRMKLVQTESQYTFIHDALYEYYLYPDREIHKLELSIYISKL-KEFDASGCMKLDTQFKKCINFEPSDYDYMESKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSNE------NMHQFWPGPDNNALTFRWFKVHCNSEKTEFSVQYSFLISSSREDYALDCTMHCLKYWPNTVSECS--ELLRLLFDIN--SKKYSGPIVVID-EYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELLEFVILNQHLYTF 1553
            G+++   YIA QGPL ET  DFW+MVWEQNS +IVM++N  ERGR KC  YW  + + N G I V+ +   E++ YT R+F    ++   + ++R V  Y YT W D  VP S   VL FVR ++  + +E  GP++VHCSAGVGRTGTY+ I++Q++++  E  ++V  ++  +R QR  +VQ E QY  IHD L E     D EI   +L   I +L +    +G  ++D +F++    +     +  +    N  KNR   ++P +  R+ L+ +   EGS+YINA+ I GY   K FI TQ P+ +T  DFW+M+W+++C  I++LS E       +H++WPG    ++     ++  + +  ++ +   F +++++E  +     +    WP+  S  S   L+ L+  +    +K    +  +    G  R G+F A+S L+ +L+ + +V+V+  +K +  +RP    +     F Y+      L ++L++F
Sbjct:   82 GYRKQREYIAAQGPLPETCHDFWRMVWEQNSRVIVMVTNCEERGRIKCHQYWPSSGSQNYGVIHVNMMSTVELSDYTIRSF---GVKRSGSPEERMVLQYHYTAWPDHGVPNSVTSVLNFVRKSSAVNLTEDYGPMVVHCSAGVGRTGTYVVIDAQLKRIQAEATVDVYNYVMMLRGQRNLMVQVEDQYVLIHDVLLEAIACGDTEIQARDLRQRIKELMRPSTDTGQTEMDAEFQRLSRNKAPPSKFQSANLPVNKHKNRYANVLPYDDTRVRLTMQAVTEGSDYINANYIDGYMSKKAFIATQAPIPDTIPDFWRMIWEQDCCTIVMLSQEMESGKVKVHRYWPGKQPTSIGNLVVEMLHDKQFDDY-IMREFKVTNTKESASRVVRQYQFTAWPDIGSPDSGGGLIDLIGQVQRWQQKCGVQLTAVHCSAGVGRTGVFCAVSILIERLKAEAMVDVFQTVKQLREQRPAMVQTKEQYEFCYQ-----TLGEYLHSF 571          

HSP 2 Score: 95.5153 bits (236), Expect = 1.890e-20
Identity = 61/232 (26.29%), Postives = 110/232 (47.41%), Query Frame = 3
Query:  855 NLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSN------ENMHQFWPGPDNNALTFRWFKVHCNSEKTEFSVQYSFLISSSREDYALDCTMHCLKYW-----PNTVSECSELLRLLFDINSKKYSGPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELL 1517
            N  KNR + I   +  R+ L    G   S+YINA+ + GY + +E+I  Q PL ET  DFW+MVW++N  +I++++N         HQ+WP   +         +    E ++++++ SF +  S          +    W     PN+V+     +R    +N  +  GP+VV    G  R G +V + + L +++ +  V+VY  + M+  +R          + I+++L
Sbjct:   44 NRFKNRYNNITAFDHCRVLLQPIEGDPTSDYINANYLDGYRKQREYIAAQGPLPETCHDFWRMVWEQNSRVIVMVTNCEERGRIKCHQYWPSSGSQNYGVIHVNMMSTVELSDYTIR-SFGVKRSGSPEERMVLQYHYTAWPDHGVPNSVTSVLNFVRKSSAVNLTEDYGPMVVHCSAGVGRTGTYVVIDAQLKRIQAEATVDVYNYVMMLRGQRNLMVQVEDQYVLIHDVL 274          
BLAST of Receptor type tyrosine protein phosphatase zeta vs. Ensembl Nematostella
Match: EDO43854 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXI9])

HSP 1 Score: 273.863 bits (699), Expect = 2.770e-82
Identity = 173/506 (34.19%), Postives = 272/506 (53.75%), Query Frame = 3
Query:   96 GFKRPYAYIATQGPLTETVADFWQMVWEQNSEIIVMISNFVERGRSKCEIYWSPNKTLNCGNISVHQIYQKEMAFYTERAFRIRNIRLKKNIKDRTVYHYQYTDWRDFDXXXXXXXXXXFVRATTKHWSESSGPIIVHCSAGVGRTGTYICIESQIRQLDQEHHINVRGFLEHIRQQRMKLVQTESQYTFIHDALYEYYLYPDREIHKLELSIYISKLKEFDAS-GCMKLDTQFKKCINFEPSDYDYMESKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSNE------NMHQFWPGPDNNALTFRWFKVHCNSEKT-------EFSVQYSFLISSSREDYALDCTMHCLKYWPNTVSECS--ELLRLLFDINS-KKYSGP--IVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELLEFVILNQHLYTFF 1556
            G+ R  A+IA+QGPL ET  DFW+MVWEQ S IIVM++   ERGR KC+ YW    T N G + V       M++Y  R F + +  +++  + R V  Y YT W D  VP    P+L  VR  +     ++GP+IVHCSAGVGRTGT+I ++S +++  QE  I+V GF+  +R +R  +VQTESQY FIHDAL E  +    E+   +L+  I +L+E D + G   +D +F++    E     +  +    N  KNR   I+P E  R+ L   PG  GS+YINAS I G  ++K +I TQ P+  T +DFW+M+W++  ++I++L+ E        H++WP   + +  +    V    E T       +FS+ ++    SSR      CT      WP++    S   L+ L+  +   ++ SG   I V    G  R G+F A+S L+ +++ + +++V+  ++ + ++RP    +     F Y  ++  + +  LY  F
Sbjct:   84 GYNRSGAFIASQGPLPETFDDFWRMVWEQGSAIIVMLTQLEERGRRKCDQYWPDRGTRNYGALRVTANETFHMSYYVLRTFLVSH--MQEEEEPRQVRQYHYTSWPDHGVPAHPAPLLSMVRTVSSANPPTAGPMIVHCSAGVGRTGTFITLDSMLQRAAQEGTIDVFGFVRQMRNKRNLMVQTESQYVFIHDALVEAVICGVTEVDANKLASRIRELREVDPNIGTTYMDLEFERLTRDERHPTQFKSAMLSCNAAKNRYANILPYERTRVALHMRPGEVGSDYINASFIDGNHRLKAYIATQAPVPRTFEDFWRMLWEQESAVIVMLTREEEAGKLKCHRYWPS--DGSRLYDKILVELTEELTYSDYVLRQFSLTHT-EEKSSRIVRQFQCTD-----WPDSGLPESGVGLIDLIGQVEKWQQQSGNTCITVHCSGGVGRTGVFCAVSILIERVKAEGLIDVFQTVQHLRLQRPAMVQTKDQYEFCYTTIQEYLESFDLYANF 579          

HSP 2 Score: 95.9005 bits (237), Expect = 1.364e-20
Identity = 66/238 (27.73%), Postives = 118/238 (49.58%), Query Frame = 3
Query:  855 NLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSN------ENMHQFWPGPDNNALTFRWFKVHCNSE-KTEFSVQYSFLISS-SREDYALDCTMHCLKYWPN--TVSECSELLRLLFDINSKK--YSGPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYE-LLEFVI 1529
            N  KNR   I+  +  R+ L+   GV  S+YINA+ I GY +   FI +Q PL ET  DFW+MVW++  ++I++L+           Q+W  PD     +   +V  N      + V  +FL+S    E+       +    WP+    +  + LL ++  ++S     +GP++V    G  R G F+ + S+L +  ++  ++V+  ++ +  +R     + S  +FI++ L+E VI
Sbjct:   46 NKYKNRYANIVAYDHSRVLLTPLEGVLESDYINANYIDGYNRSGAFIASQGPLPETFDDFWRMVWEQGSAIIVMLTQLEERGRRKCDQYW--PDRGTRNYGALRVTANETFHMSYYVLRTFLVSHMQEEEEPRQVRQYHYTSWPDHGVPAHPAPLLSMVRTVSSANPPTAGPMIVHCSAGVGRTGTFITLDSMLQRAAQEGTIDVFGFVRQMRNKRNLMVQTESQYVFIHDALVEAVI 281          
BLAST of Receptor type tyrosine protein phosphatase zeta vs. Ensembl Nematostella
Match: EDO46961 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNP0])

HSP 1 Score: 280.026 bits (715), Expect = 9.068e-80
Identity = 170/492 (34.55%), Postives = 257/492 (52.24%), Query Frame = 3
Query:   90 C*GFKRPYAYIATQGPLTETVADFWQMVWEQNSEIIVMISNFVERGRSKCEIYWSPNKTLNCGNISVHQIYQKEMAFYTERAFRIRNIRLKKNIKDRTVYHYQYTDWRDFDXXXXXXXXXXFVRATTKHWSESSGPIIVHCSAGVGRTGTYICIESQIRQLDQEHHINVRGFLEHIRQQRMKLVQTESQYTFIHDALYEYYLYPDREIHKLELSIYISKLKEFDASGCMKLDTQFKKCINFEPSDYDYMESKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSN------ENMHQFWPGPDNNALTFRWFKVHCNSEKTEFSVQYSFLISSSREDYALDCTMHCLKYWPNT-VSECSELLRLLFDINSKKY-----SGPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYE-LLEFV 1526
            C G+++  AYIATQGP+  T ADFW+MVWEQ +  IVM++   ERGR KC+ YW  + T     I V  +   E+A YT    +I     +   + R V H+Q+T W D  VP    P L F+R    +    +GPI+VHCSAGVGRTG +I I+S + +L  E  +++ G +  +R QR  +VQT+ QY F HDA+ E     + E+H   L  +I KL E        L+ +FK     +   + Y  +    N  KNR   I+P E+ R+++S   GVEGS+YINAS I GY Q   FI TQ PL +T  DFW+M+ ++N ++I++L+       E  +++WP   +    +         E  +F ++  F +  +R D   +        WP T V +  E +  L     + Y      GPI V    G  R G+F A+  +L ++R + VV+++  +K++  +RP    S    LF Y+  LE++
Sbjct: 1379 CDGYRKERAYIATQGPMQHTAADFWRMVWEQRTFTIVMLTREEERGRVKCDQYWPTDGTDVYEGIEVSLVDWVELANYTISTLQICK---EGASQPREVKHFQFTGWPDHGVPAHPTPFLAFLRRVKFYNPPDAGPIVVHCSAGVGRTGCFIVIDSMLERLRHEETVDIYGHVTVLRTQRNYMVQTQEQYIFSHDAILEAVSCGNTEVHARNLLHHIKKLTELGKGEVTGLEEEFKVVDPSQAKKHKYGAATLAINRPKNRLANILPYETTRVHISPVRGVEGSDYINASFIDGYRQRGLFIATQGPLQDTVDDFWRMLMEQNSNIIVMLTQLHEGEWEKCYKYWPTDRSARHQYYIVDPIAEHEYPQFVIR-DFKVKDARSDTVRNIKQFHFLGWPETGVPKSGEGIIDLIGQVQRAYEQQEEEGPITVHCSDGVGRTGVFTALFIVLERMRSEGVVDLFQTVKLLRTQRPAMVQSQEQYLFCYKTALEYL 1866          

HSP 2 Score: 92.4337 bits (228), Expect = 4.160e-19
Identity = 64/235 (27.23%), Postives = 106/235 (45.11%), Query Frame = 3
Query:  855 NLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSNENMH------QFWPGPDNNALTFRWFKVHCNSEKTEFSVQYSFLISSSREDYALDCTMHCLKYWPNTVSECSELLRLLFDINSKKY----SGPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYE-LLEFV 1526
            N  KNR   I   +  R+ LS   G+EGS+YINA+   GY + + +I TQ P+  T  DFW+MVW++    I++L+ E         Q+WP    +        +    E   +++  +  I         +        WP+          L F    K Y    +GPIVV    G  R G F+ + S+L +LR ++ V++Y  + ++  +R Y   +    +F ++ +LE V
Sbjct: 1343 NKGKNRYPNIHAYDHSRVRLSYINGIEGSDYINANFCDGYRKERAYIATQGPMQHTAADFWRMVWEQRTFTIVMLTREEERGRVKCDQYWPTDGTDVYEGIEVSLVDWVELANYTIS-TLQICKEGASQPREVKHFQFTGWPDHGVPAHPTPFLAFLRRVKFYNPPDAGPIVVHCSAGVGRTGCFIVIDSMLERLRHEETVDIYGHVTVLRTQRNYMVQTQEQYIFSHDAILEAV 1576          
BLAST of Receptor type tyrosine protein phosphatase zeta vs. Ensembl Nematostella
Match: EDO33995 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQN6])

HSP 1 Score: 242.276 bits (617), Expect = 5.191e-71
Identity = 159/477 (33.33%), Postives = 236/477 (49.48%), Query Frame = 3
Query:   96 GFKRPYAYIATQGPLTETVADFWQMVWEQNSEIIVMISNFVERGRSKCEIYWSPNKTLNCGNISVHQIYQKEMAFYTERAFRIRNIRLKKNIKDRTVYHYQYTDWRDFDXXXXXXXXXXFVRATTKHW-SESSGPIIVHCSAGVGRTGTYICIESQIRQLDQEHHINVRGFLEHIRQQRMKLVQTESQYTFIHDALYEYYLYPDREIHKLELSIYISKLKE-FDASGCMKLDTQFKKCINFEPSDY-DYMESKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSNENMHQFWPGPDNNALTFRWFKVHCNSEKTEFSVQYSFLISSSREDYALDCTMHCLKYWPNTVSECSELLRLLFDINSKKYSGPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELL 1517
            GFK+   YIAT GP  ET +DFW+M+WE  S I+VM++  VE+G+ KC  YW P +    G I V    ++E+A +  R F +R  +L   ++ R V H+ +T W D DVP  +  +L F +     W    SGPI VHCSAGVGRTGT+I I++ + Q+ +E+ ++V  ++  IR QR  +VQ  SQY+FIH AL E   + D EI    L + + +L E    +G   L+ +F+      P +  D+  + +  N  KNR   I+P E  R+ L   P  E + YINAS ++GY +   FI TQ PLD T +DFW+MVW E    I++L   N      G       F +       E TE +V                         P  +    +L+  L     K    P+VV    G  R G F  + + L +++ + V++V+   +M+  +RP   S        YE +
Sbjct:   91 GFKQEKKYIATIGPKAETTSDFWRMMWEHKSSIVVMLTKLVEKGKVKCHKYW-PEENEQYGEIIVTLEEKEELADFEIRKFFLR--KLSNQMETRMVKHFYFTSWPDHDVPEYATGLLEFWKRVRNSWEGPQSGPITVHCSAGVGRTGTFIVIDAMMEQIKEENLLDVYSYVSRIRAQRNFMVQRPSQYSFIHYALLEAVTFGDTEIEVQNLRMRLMQLAEKVAGTGMTGLEREFQLLNGAVPDELSDFYTATQPKNSKKNRYPNILPCERCRVVLPAIPDKEDTTYINASYLEGYQEKVAFIATQAPLDNTIEDFWRMVWHEEVFCIVMLCGLN-EPLETGEVRQISHFMYL------EWTEHAV-------------------------PTKLLTIIDLIGDLQKARRKHLDRPVVVHCSDGVGRTGAFCTLFATLERVKLEGVLDVFITARMLRTQRPGMVSHLDQYRLCYEAI 532          

HSP 2 Score: 85.8853 bits (211), Expect = 1.865e-17
Identity = 67/237 (28.27%), Postives = 111/237 (46.84%), Query Frame = 3
Query:  855 NLVKNRSDTIMPIESRRINLSCEPG-VEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLS------NENMHQFWPGPDNNALTFRWFKVHCNSEKTEFSVQYSFLISSSREDYALDCTMHCLKYWPN-TVSE-CSELLRLLFDINSK---KYSGPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFI-YELLEFV 1526
            N  KNR   I   +  R+ LS   G  E ++YINA+ I G+ Q K++I T  P  ET  DFW+M+W+   S++++L+          H++WP  +N         +    E  +F ++  FL   S +             WP+  V E  + LL     + +      SGPI V    G  R G F+ + +++ Q++++++++VY  +  I  +R +     S   FI Y LLE V
Sbjct:   52 NKPKNRYGNIKAYDHSRVILSSVQGDSESTDYINANWIDGFKQEKKYIATIGPKAETTSDFWRMMWEHKSSIVVMLTKLVEKGKVKCHKYWP-EENEQYGEIIVTLEEKEELADFEIRKFFLRKLSNQMETRMVKHFYFTSWPDHDVPEYATGLLEFWKRVRNSWEGPQSGPITVHCSAGVGRTGTFIVIDAMMEQIKEENLLDVYSYVSRIRAQRNFMVQRPSQYSFIHYALLEAV 287          

HSP 3 Score: 72.0182 bits (175), Expect = 4.634e-13
Identity = 52/202 (25.74%), Postives = 84/202 (41.58%), Query Frame = 3
Query:   96 GFKRPYAYIATQGPLTETVADFWQMVWEQNSEIIVMISNFVERGRSKCEIYWSPNKTLNCGNISVHQIYQKEMAFYTERAFRIRNIRLKKNIKDRTVYHYQYTDWRDFDXXXXXXXXXXFV----RATTKHWSESSGPIIVHCSAGVGRTGTYICIESQIRQLDQEHHINVRGFLEHIRQQRMKLVQTESQYTFIHDALYEY 689
            G++   A+IATQ PL  T+ DFW+MVW +    IVM+                 N+ L  G +                               R + H+ Y +W +  VP   L ++  +    +A  KH      P++VHCS GVGRTG +  + + + ++  E  ++V      +R QR  +V    QY   ++A+  Y
Sbjct:  382 GYQEKVAFIATQAPLDNTIEDFWRMVWHEEVFCIVMLCGL--------------NEPLETGEV-------------------------------RQISHFMYLEWTEHAVPTKLLTIIDLIGDLQKARRKHLDR---PVVVHCSDGVGRTGAFCTLFATLERVKLEGVLDVFITARMLRTQRPGMVSHLDQYRLCYEAILAY 535          
BLAST of Receptor type tyrosine protein phosphatase zeta vs. Ensembl Medaka
Match: ptprz1a (protein tyrosine phosphatase receptor type Z1 [Source:NCBI gene;Acc:101160456])

HSP 1 Score: 357.836 bits (917), Expect = 2.089e-107
Identity = 207/515 (40.19%), Postives = 294/515 (57.09%), Query Frame = 3
Query:   96 GFKRPYAYIATQGPLTETVADFWQMVWEQNSEIIVMISNFVERGRSKCEIYWSPNKTLNCGNISVHQIYQKEMAFYTERAFRI-----RNIRLKKNIKDRTVYHYQYTDWRDFDXXXXXXXXXXFVRATTKHWSESSGPIIVHCSAGVGRTGTYICIESQIRQLDQEHHINVRGFLEHIRQQRMKLVQTESQYTFIHDALYEYYLYPDREIHKLELSIYISKLKEFDASGCMKLDTQFKKCINFEPSDYDYMESKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSN-ENMHQFWPGPDNNALTFRWFKVHCNSE------KTEFSVQYSFLISSSREDYALDCTMHCLKYWPN---TVSECSELLRLLFDINSKKYSGPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELLEFVILNQHLYTFFSRSQQDFIPNGIA 1595
            GF++P AYIA QGP+  T  DFW+M+WE++   IVMI+N VE+GR KC+ YW      + GN+ V     K +AFYT R F +     + +  K   K+RT+  Y YT W D  VP  +LP+L F+R +++   E  GP++VHCSAGVGRTGTYI ++S ++Q+ +E  +N+ GFL+HIR QR  LVQT+ QY FIHD L E  L  + E+    L  Y+ +L     SG   LD QF+  +  +P       S       +NRS +++P+E  R+ LS   G E S+YINAS I GY    EFIITQHPL  T +DFW+MVW+ N  +I+ L   E +  FWP        +  F V   SE        +  V   +++ ++++DY L+   +    WPN   ++S+  E+LRL+ + NS K  GPI+V D+ G   AG F A+SSL+HQL  DD V+V+ V KMI++ RP  FS+    L+   +L  +   +   TF S +    I  G A
Sbjct:  770 GFQKPGAYIAAQGPVKSTTEDFWRMIWEKDVRTIVMITNLVEKGRRKCDQYWPLELQEDYGNLLVTLKSSKALAFYTVRTFSVWDTLGKKVSQKGRGKERTITQYHYTQWPDMGVPEFTLPILSFIRKSSRAGQEGPGPMLVHCSAGVGRTGTYIALDSMLKQIQEEGKVNITGFLKHIRTQRNYLVQTKEQYIFIHDTLVEAILSGETEVAAAHLHRYVGELLTPGPSGKTGLDKQFE--LLCQPVVQQRDPSSALQESSRNRSSSVLPVERSRVCLSTAAG-ETSDYINASYISGYRSRNEFIITQHPLPSTIRDFWRMVWEHNAPVIVSLPGAEELCAFWPH-KGQPYNYGVFTVSHKSENHVCLSNEDILVVQDYMLEATQDDYVLEVRHYQAACWPNPNTSISQTFEVLRLVKEENSLK-DGPIIVHDDVGGVTAGTFCALSSLMHQLEVDDSVDVFQVAKMINLMRPGVFSNIFQFLY-KAMLSLIGTQEDQKTFQSSNSNGTIVVGAA 1278          

HSP 2 Score: 89.3521 bits (220), Expect = 8.859e-18
Identity = 63/244 (25.82%), Postives = 113/244 (46.31%), Query Frame = 3
Query:  855 NLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSN------ENMHQFWPGP-----DNNALTFRWFKVHCNSEKTEFSVQYSFLISSSREDYALDCTMHCLKY--WPNTVSECSELLRLLFDINSKKYS----GPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELLEFVILN 1535
            N VKNR   I+  +  R+ L      + ++YINA+ + G+ +   +I  Q P+  T +DFW+M+W+++   I++++N          Q+WP        N  +T +  K         FSV  +     S++    + T+    Y  WP+       L  L F   S +      GP++V    G  R G ++A+ S+L Q++++  VN+   +K I  +R Y   +    +FI++ L   IL+
Sbjct:  732 NKVKNRYSNILAYDHSRVRLQAHKDGKTTDYINANFVDGFQKPGAYIAAQGPVKSTTEDFWRMIWEKDVRTIVMITNLVEKGRRKCDQYWPLELQEDYGNLLVTLKSSKALAFYTVRTFSVWDTLGKKVSQKGRGKERTITQYHYTQWPDMGVPEFTLPILSFIRKSSRAGQEGPGPMLVHCSAGVGRTGTYIALDSMLKQIQEEGKVNITGFLKHIRTQRNYLVQTKEQYIFIHDTLVEAILS 975          
BLAST of Receptor type tyrosine protein phosphatase zeta vs. Ensembl Medaka
Match: PTPRD (receptor-type tyrosine-protein phosphatase delta [Source:NCBI gene;Acc:101165944])

HSP 1 Score: 283.108 bits (723), Expect = 1.912e-80
Identity = 168/500 (33.60%), Postives = 264/500 (52.80%), Query Frame = 3
Query:   96 GFKRPYAYIATQGPLTETVADFWQMVWEQNSEIIVMISNFVERGRSKCEIYWSPNKTLNCGNISVHQIYQKEMAFYTERAFRIRNIRLKKNIKDRTVYHYQYTDWRDFDXXXXXXXXXXFVRATTKHWSESSGPIIVHCSAGVGRTGTYICIESQIRQLDQEHHINVRGFLEHIRQQRMKLVQTESQYTFIHDALYEYYLYPDREIHKLELSIYISKLKEFD-ASGCMKLDTQFKKCINFEPSDYDYMESKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSN------ENMHQFWPGPDNNALTFRWFKVHCNSE-KTEFSVQYSFLISSSREDYALDCTMHCLKYWP-NTVSECSE-LLRLLFDINSKK----YSGPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYEL-LEFVILNQHLYT 1550
            G++R  AYIATQG L ET  DFW+MVWEQ+S  I+M++   E+ R KC+ YW    T   G I V  +   E+A Y+ R F +   ++  + + R V H+Q+T W D  VP    P L F+R         +GP++VHCSAGVGRTG +I I++   ++  E  I+V G +  +R QR  +VQTE QY FIHDA+ E     + E+    L  YI +L + +       ++ +FK+  + +     ++ +    N  KNR   IMP E+ R+ L    GVEGS+YINAS I GY Q + +I TQ PL ET +D+W+M+W+ N +++++L+       E  HQ+WP     +  +++F V   +E      +   F ++ +R+  +          WP   V +  E  +  +  ++  K      GPI V    G  R G+F+ +S +L ++R + VV+++  +KM+  +RP T  +     F Y   LE++    H  T
Sbjct: 1003 GYRRQNAYIATQGALPETFGDFWRMVWEQHSANIIMMTKLEEKSRVKCDQYWPTRGTETYGLIQVTLLDTVELATYSVRTFAL--YKVNGSNEKREVRHFQFTAWPDHGVPEHPTPFLAFLRRVKACNPPDAGPMVVHCSAGVGRTGCFIVIDAMTERIKHEKTIDVYGHVTLMRSQRNYMVQTEDQYIFIHDAVLEAVTCGNTEVPARNLYSYIQRLTQIEPGENVTGMELEFKRLASAKAHTSRFVSANLPCNKFKNRLVNIMPYETTRVCLQPIRGVEGSDYINASFIDGYRQQRAYIATQGPLAETTEDYWRMLWEHNSTIVVMLTKLREMGREKCHQYWPA--ERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPATVQTEDQYQFCYRASLEYLGSFDHYAT 1498          

HSP 2 Score: 93.2041 bits (230), Expect = 5.579e-19
Identity = 74/301 (24.58%), Postives = 138/301 (45.85%), Query Frame = 3
Query:  723 ELSIYISKLKEFDASGCMKLDTQFKKCINFEPSD-YDYMESKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILL------SNENMHQFWPGPDNNALTFRWFKVHCNSEKTEFSVQYSFLISSSREDYALDCTMHCLKYWPN--TVSECSELLRLLFDINS--KKYSGPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYE-LLEFV------ILNQHLYTFFSRSQQ 1571
            EL+ +I +LK   A+  +K   +++   + +P   + +  S    N  KNR   ++  +  R+ LS   GV GS+YINA+ I GY +   +I TQ  L ET  DFW+MVW+++ + II++      S     Q+WP             +    E   +SV+   L   +  +   +        WP+       +  L  L  + +     +GP+VV    G  R G F+ + ++  +++ +  ++VY  + ++  +R Y   +    +FI++ +LE V      +  ++LY++  R  Q
Sbjct:  926 ELTDHIERLK---ANDNLKFSQEYE---SVDPGQQFTWENSNLEVNKPKNRYANVIAYDHSRVVLSSIEGVPGSDYINANYIDGYRRQNAYIATQGALPETFGDFWRMVWEQHSANIIMMTKLEEKSRVKCDQYWPTRGTETYGLIQVTLLDTVELATYSVRTFALYKVNGSNEKREVRHFQFTAWPDHGVPEHPTPFLAFLRRVKACNPPDAGPMVVHCSAGVGRTGCFIVIDAMTERIKHEKTIDVYGHVTLMRSQRNYMVQTEDQYIFIHDAVLEAVTCGNTEVPARNLYSYIQRLTQ 1220          
BLAST of Receptor type tyrosine protein phosphatase zeta vs. Ensembl Medaka
Match: PTPRD (receptor-type tyrosine-protein phosphatase delta [Source:NCBI gene;Acc:101165843])

HSP 1 Score: 283.108 bits (723), Expect = 2.542e-80
Identity = 171/501 (34.13%), Postives = 261/501 (52.10%), Query Frame = 3
Query:   96 GFKRPYAYIATQGPLTETVADFWQMVWEQNSEIIVMISNFVERGRSKCEIYWSPNKTLNCGNISVHQIYQKEMAFYTERAFRI-RNIRLKKNIKDRTVYHYQYTDWRDFDXXXXXXXXXXFVRATTKHWSESSGPIIVHCSAGVGRTGTYICIESQIRQLDQEHHINVRGFLEHIRQQRMKLVQTESQYTFIHDALYEYYLYPDREIHKLELSIYISKLKEFDAS-GCMKLDTQFKKCINFEPSDYDYMESKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSN------ENMHQFWPGPDNNALTFRWFKVHCNSE-KTEFSVQYSFLISSSREDYALDCTMHCLKYWP-NTVSECSE-LLRLLFDINSKK----YSGPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYEL-LEFVILNQHLYT 1550
            G+++  AYIATQGPL ET  +FW+M+WEQ S ++VM++   ER R KC+ YW    T   G I V  +   E+A Y  R F + +N   +K    R V  +Q+T W D  VP    P L F+R         +GP++VHCSAGVGRTG +I I++ + +   E  +++ G +  +R QR  +VQTE QY FIHDAL E       E+    L  YI KL + +       ++ +FK+  N +     ++ +    N  KNR   IMP ES R+ L    GVEGS+YINAS I GY Q K +I TQ PL ET +DFW+M+W+ N +++++L+       E  HQ+WP     +  +++F V   +E      +   F ++ +R+  +          WP   V +  E  +  +  ++  K      GPI V    G  R G+F+ +S +L ++R + VV+++  +KM+  +RP    +     F Y   LE++    H  T
Sbjct: 1427 GYRKQNAYIATQGPLPETFGEFWRMIWEQRSAVVVMMTKLEERSRVKCDQYWPTRGTETYGLIQVSLLDTVELATYCVRTFSLFKNGSSEK----REVRQFQFTAWPDHGVPEHPTPFLAFLRRVKACNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERNKHEKTVDIYGHVTLMRAQRNYMVQTEDQYVFIHDALLEAVNCGTTEVPARNLYAYIQKLTQIEGGENVTGMELEFKRLANTKAHTSRFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPA--ERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDQYQFCYRAGLEYLGSFDHYAT 1921          

HSP 2 Score: 93.2041 bits (230), Expect = 6.269e-19
Identity = 72/302 (23.84%), Postives = 140/302 (46.36%), Query Frame = 3
Query:  723 ELSIYISKLKEFDASGCMKLDTQFKKCINFEPSD-YDYMESKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILL------SNENMHQFWPGPDNNALTFRWFKVHCNSEKTEFSVQ-YSFLISSSREDYALDCTMHCLKYWPN--TVSECSELLRLLFDINS--KKYSGPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYE-LLEFV------ILNQHLYTFFSRSQQ 1571
            EL+ ++ +LK   A+  +K   +++   + +P+  + +  S    N  KNR   ++  +  RI LS   G+ GS+YINA+ I GY +   +I TQ PL ET  +FW+M+W++  ++++++      S     Q+WP             +    E   + V+ +S   + S E    +        WP+       +  L  L  + +     +GP+VV    G  R G F+ + ++L + + +  V++Y  + ++  +R Y   +    +FI++ LLE V      +  ++LY +  +  Q
Sbjct: 1350 ELADHLERLK---ANDNLKFSQEYE---SIDPAQQFTWEHSNLEVNKPKNRYANVIAYDHSRILLSAIDGIPGSDYINANYIDGYRKQNAYIATQGPLPETFGEFWRMIWEQRSAVVVMMTKLEERSRVKCDQYWPTRGTETYGLIQVSLLDTVELATYCVRTFSLFKNGSSEKR--EVRQFQFTAWPDHGVPEHPTPFLAFLRRVKACNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERNKHEKTVDIYGHVTLMRAQRNYMVQTEDQYVFIHDALLEAVNCGTTEVPARNLYAYIQKLTQ 1643          
BLAST of Receptor type tyrosine protein phosphatase zeta vs. Ensembl Medaka
Match: PTPRD (receptor-type tyrosine-protein phosphatase delta [Source:NCBI gene;Acc:101165843])

HSP 1 Score: 283.108 bits (723), Expect = 2.881e-80
Identity = 171/501 (34.13%), Postives = 261/501 (52.10%), Query Frame = 3
Query:   96 GFKRPYAYIATQGPLTETVADFWQMVWEQNSEIIVMISNFVERGRSKCEIYWSPNKTLNCGNISVHQIYQKEMAFYTERAFRI-RNIRLKKNIKDRTVYHYQYTDWRDFDXXXXXXXXXXFVRATTKHWSESSGPIIVHCSAGVGRTGTYICIESQIRQLDQEHHINVRGFLEHIRQQRMKLVQTESQYTFIHDALYEYYLYPDREIHKLELSIYISKLKEFDAS-GCMKLDTQFKKCINFEPSDYDYMESKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSN------ENMHQFWPGPDNNALTFRWFKVHCNSE-KTEFSVQYSFLISSSREDYALDCTMHCLKYWP-NTVSECSE-LLRLLFDINSKK----YSGPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYEL-LEFVILNQHLYT 1550
            G+++  AYIATQGPL ET  +FW+M+WEQ S ++VM++   ER R KC+ YW    T   G I V  +   E+A Y  R F + +N   +K    R V  +Q+T W D  VP    P L F+R         +GP++VHCSAGVGRTG +I I++ + +   E  +++ G +  +R QR  +VQTE QY FIHDAL E       E+    L  YI KL + +       ++ +FK+  N +     ++ +    N  KNR   IMP ES R+ L    GVEGS+YINAS I GY Q K +I TQ PL ET +DFW+M+W+ N +++++L+       E  HQ+WP     +  +++F V   +E      +   F ++ +R+  +          WP   V +  E  +  +  ++  K      GPI V    G  R G+F+ +S +L ++R + VV+++  +KM+  +RP    +     F Y   LE++    H  T
Sbjct: 1441 GYRKQNAYIATQGPLPETFGEFWRMIWEQRSAVVVMMTKLEERSRVKCDQYWPTRGTETYGLIQVSLLDTVELATYCVRTFSLFKNGSSEK----REVRQFQFTAWPDHGVPEHPTPFLAFLRRVKACNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERNKHEKTVDIYGHVTLMRAQRNYMVQTEDQYVFIHDALLEAVNCGTTEVPARNLYAYIQKLTQIEGGENVTGMELEFKRLANTKAHTSRFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPA--ERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDQYQFCYRAGLEYLGSFDHYAT 1935          

HSP 2 Score: 93.2041 bits (230), Expect = 6.840e-19
Identity = 72/302 (23.84%), Postives = 140/302 (46.36%), Query Frame = 3
Query:  723 ELSIYISKLKEFDASGCMKLDTQFKKCINFEPSD-YDYMESKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILL------SNENMHQFWPGPDNNALTFRWFKVHCNSEKTEFSVQ-YSFLISSSREDYALDCTMHCLKYWPN--TVSECSELLRLLFDINS--KKYSGPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYE-LLEFV------ILNQHLYTFFSRSQQ 1571
            EL+ ++ +LK   A+  +K   +++   + +P+  + +  S    N  KNR   ++  +  RI LS   G+ GS+YINA+ I GY +   +I TQ PL ET  +FW+M+W++  ++++++      S     Q+WP             +    E   + V+ +S   + S E    +        WP+       +  L  L  + +     +GP+VV    G  R G F+ + ++L + + +  V++Y  + ++  +R Y   +    +FI++ LLE V      +  ++LY +  +  Q
Sbjct: 1364 ELADHLERLK---ANDNLKFSQEYE---SIDPAQQFTWEHSNLEVNKPKNRYANVIAYDHSRILLSAIDGIPGSDYINANYIDGYRKQNAYIATQGPLPETFGEFWRMIWEQRSAVVVMMTKLEERSRVKCDQYWPTRGTETYGLIQVSLLDTVELATYCVRTFSLFKNGSSEKR--EVRQFQFTAWPDHGVPEHPTPFLAFLRRVKACNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERNKHEKTVDIYGHVTLMRAQRNYMVQTEDQYVFIHDALLEAVNCGTTEVPARNLYAYIQKLTQ 1657          
BLAST of Receptor type tyrosine protein phosphatase zeta vs. Ensembl Medaka
Match: PTPRD (receptor-type tyrosine-protein phosphatase delta [Source:NCBI gene;Acc:101165843])

HSP 1 Score: 282.722 bits (722), Expect = 3.394e-80
Identity = 171/501 (34.13%), Postives = 261/501 (52.10%), Query Frame = 3
Query:   96 GFKRPYAYIATQGPLTETVADFWQMVWEQNSEIIVMISNFVERGRSKCEIYWSPNKTLNCGNISVHQIYQKEMAFYTERAFRI-RNIRLKKNIKDRTVYHYQYTDWRDFDXXXXXXXXXXFVRATTKHWSESSGPIIVHCSAGVGRTGTYICIESQIRQLDQEHHINVRGFLEHIRQQRMKLVQTESQYTFIHDALYEYYLYPDREIHKLELSIYISKLKEFDAS-GCMKLDTQFKKCINFEPSDYDYMESKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSN------ENMHQFWPGPDNNALTFRWFKVHCNSE-KTEFSVQYSFLISSSREDYALDCTMHCLKYWP-NTVSECSE-LLRLLFDINSKK----YSGPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYEL-LEFVILNQHLYT 1550
            G+++  AYIATQGPL ET  +FW+M+WEQ S ++VM++   ER R KC+ YW    T   G I V  +   E+A Y  R F + +N   +K    R V  +Q+T W D  VP    P L F+R         +GP++VHCSAGVGRTG +I I++ + +   E  +++ G +  +R QR  +VQTE QY FIHDAL E       E+    L  YI KL + +       ++ +FK+  N +     ++ +    N  KNR   IMP ES R+ L    GVEGS+YINAS I GY Q K +I TQ PL ET +DFW+M+W+ N +++++L+       E  HQ+WP     +  +++F V   +E      +   F ++ +R+  +          WP   V +  E  +  +  ++  K      GPI V    G  R G+F+ +S +L ++R + VV+++  +KM+  +RP    +     F Y   LE++    H  T
Sbjct: 1288 GYRKQNAYIATQGPLPETFGEFWRMIWEQRSAVVVMMTKLEERSRVKCDQYWPTRGTETYGLIQVSLLDTVELATYCVRTFSLFKNGSSEK----REVRQFQFTAWPDHGVPEHPTPFLAFLRRVKACNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERNKHEKTVDIYGHVTLMRAQRNYMVQTEDQYVFIHDALLEAVNCGTTEVPARNLYAYIQKLTQIEGGENVTGMELEFKRLANTKAHTSRFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPA--ERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDQYQFCYRAGLEYLGSFDHYAT 1782          

HSP 2 Score: 92.8189 bits (229), Expect = 7.739e-19
Identity = 72/302 (23.84%), Postives = 140/302 (46.36%), Query Frame = 3
Query:  723 ELSIYISKLKEFDASGCMKLDTQFKKCINFEPSD-YDYMESKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILL------SNENMHQFWPGPDNNALTFRWFKVHCNSEKTEFSVQ-YSFLISSSREDYALDCTMHCLKYWPN--TVSECSELLRLLFDINS--KKYSGPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYE-LLEFV------ILNQHLYTFFSRSQQ 1571
            EL+ ++ +LK   A+  +K   +++   + +P+  + +  S    N  KNR   ++  +  RI LS   G+ GS+YINA+ I GY +   +I TQ PL ET  +FW+M+W++  ++++++      S     Q+WP             +    E   + V+ +S   + S E    +        WP+       +  L  L  + +     +GP+VV    G  R G F+ + ++L + + +  V++Y  + ++  +R Y   +    +FI++ LLE V      +  ++LY +  +  Q
Sbjct: 1211 ELADHLERLK---ANDNLKFSQEYE---SIDPAQQFTWEHSNLEVNKPKNRYANVIAYDHSRILLSAIDGIPGSDYINANYIDGYRKQNAYIATQGPLPETFGEFWRMIWEQRSAVVVMMTKLEERSRVKCDQYWPTRGTETYGLIQVSLLDTVELATYCVRTFSLFKNGSSEKR--EVRQFQFTAWPDHGVPEHPTPFLAFLRRVKACNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERNKHEKTVDIYGHVTLMRAQRNYMVQTEDQYVFIHDALLEAVNCGTTEVPARNLYAYIQKLTQ 1504          
BLAST of Receptor type tyrosine protein phosphatase zeta vs. Planmine SMEST
Match: SMESG000041505.1 (SMESG000041505.1)

HSP 1 Score: 1327.38 bits (3434), Expect = 0.000e+0
Identity = 660/662 (99.70%), Postives = 661/662 (99.85%), Query Frame = 3
Query:   96 GFKRPYAYIATQGPLTETVADFWQMVWEQNSEIIVMISNFVERGRSKCEIYWSPNKTLNCGNISVHQIYQKEMAFYTERAFRIRNIRLKKNIKDRTVYHYQYTDWRDFDXXXXXXXXXXFVRATTKHWSESSGPIIVHCSAGVGRTGTYICIESQIRQLDQEHHINVRGFLEHIRQQRMKLVQTESQYTFIHDALYEYYLYPDREIHKLELSIYISKLKEFDASGCMKLDTQFKKCINFEPSDYDYMESKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSNENMHQFWPGPDNNALTFRWFKVHCNSEKTEFSVQYSFLISSSREDYALDCTMHCLKYWPNTVSECSELLRLLFDINSKKYSGPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELLEFVILNQHLYTFFSRSQQDFIPNGIAHLPVSQKPILNNNTSSSLIHYSTLGTMXXXXXXXXXXXXXXXVDSEPYGLPTPSPNRKENFGNRISWNAGESRQIGTPLLTESFGEWPTVNCNGHAGGGPNTTNSGSFENPQISDLPVAKIVNLSSSTTNSQIPQSSIYNLTNYGALDNGSNSSGVVWCPQK 2081
            GFKRPYAYIATQGPLTETVADFWQMVWEQNSEIIVMISNFVERGRSKCEIYWSPNKTLNCGNISVHQIYQKEMAFYTERAFRIRNIRLKKNIKDRTVYHYQYTDWRDFDVPPSSLPVLVFVRATTKHWSESSGPIIVHCSAGVGRTGTYICIESQIRQLDQEHHINVRGFLEHIRQQRMKLVQTESQYTFIHDALYEYYLYPDREIHKLELS YISKLKEFDASGCMKLDTQFKKCINFEPSDYDYMESKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSNENMHQFWPGPDNNALTFRWFKVHCNSEKTEFSVQYSFLISSSREDYALDCTMHCLKYWPNTVSECSELLRLLFDINSKKYSGPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELLEFVILNQHLYTFFSRSQQDFIPNGIAHLPVSQKPILNNNTSSSLIHYSTLGTMRSKSSTSTSRRRASSVDSEPYGLPTPSPNRKENFGNRISWNAGESRQIGTPLLTESFGEWPTVNCNGHAGGGPNTTNSGSFENPQISDLPVAKIVNLSSSTTNSQIPQSSIYNLTNYGALD+GSNSSGVVWCPQK
Sbjct:  707 GFKRPYAYIATQGPLTETVADFWQMVWEQNSEIIVMISNFVERGRSKCEIYWSPNKTLNCGNISVHQIYQKEMAFYTERAFRIRNIRLKKNIKDRTVYHYQYTDWRDFDVPPSSLPVLVFVRATTKHWSESSGPIIVHCSAGVGRTGTYICIESQIRQLDQEHHINVRGFLEHIRQQRMKLVQTESQYTFIHDALYEYYLYPDREIHKLELSTYISKLKEFDASGCMKLDTQFKKCINFEPSDYDYMESKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSNENMHQFWPGPDNNALTFRWFKVHCNSEKTEFSVQYSFLISSSREDYALDCTMHCLKYWPNTVSECSELLRLLFDINSKKYSGPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELLEFVILNQHLYTFFSRSQQDFIPNGIAHLPVSQKPILNNNTSSSLIHYSTLGTMRSKSSTSTSRRRASSVDSEPYGLPTPSPNRKENFGNRISWNAGESRQIGTPLLTESFGEWPTVNCNGHAGGGPNTTNSGSFENPQISDLPVAKIVNLSSSTTNSQIPQSSIYNLTNYGALDSGSNSSGVVWCPQK 1368          

HSP 2 Score: 85.8853 bits (211), Expect = 8.766e-17
Identity = 78/287 (27.18%), Postives = 132/287 (45.99%), Query Frame = 3
Query:  699 PDREIHKLELSIYISKLKEFDASGCMKLDTQFKKCINFEPSDYDYMESKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSN------ENMHQFWPGPDNNALTFRWFKVHCNSEK-TEFSVQYSFLISSSREDYAL-DCTMHCLKY--WPNTVSECSELLRLLFDINSKKY----SGPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELL 1517
            P   I    L  +I+  +  D +G      +F+   + + + +    + ++ N  KNR   I P +  R+ +   P    S+YINAS I G+ +   +I TQ PL ET  DFW+MVW++N  +I+++SN           +W    N  L      VH   +K   F  + +F I + R    + D T++  +Y  W +     S L  L+F   + K+    SGPI+V    G  R G ++ + S + QL ++  +NV   ++ I  +R     + S   FI++ L
Sbjct:  621 PYPPIPMTNLVDHINSHRADDGAG---FQAEFEAIESMDTTKWVISAAIQKENKSKNRYTNIFPYDHSRVIIQ-SPPFGKSDYINASFIDGFKRPYAYIATQGPLTETVADFWQMVWEQNSEIIVMISNFVERGRSKCEIYW--SPNKTLNCGNISVHQIYQKEMAFYTERAFRIRNIRLKKNIKDRTVYHYQYTDWRDFDVPPSSLPVLVFVRATTKHWSESSGPIIVHCSAGVGRTGTYICIESQIRQLDQEHHINVRGFLEHIRQQRMKLVQTESQYTFIHDAL 901          
BLAST of Receptor type tyrosine protein phosphatase zeta vs. Planmine SMEST
Match: SMESG000041505.1 (SMESG000041505.1)

HSP 1 Score: 1327.38 bits (3434), Expect = 0.000e+0
Identity = 660/662 (99.70%), Postives = 661/662 (99.85%), Query Frame = 3
Query:   96 GFKRPYAYIATQGPLTETVADFWQMVWEQNSEIIVMISNFVERGRSKCEIYWSPNKTLNCGNISVHQIYQKEMAFYTERAFRIRNIRLKKNIKDRTVYHYQYTDWRDFDXXXXXXXXXXFVRATTKHWSESSGPIIVHCSAGVGRTGTYICIESQIRQLDQEHHINVRGFLEHIRQQRMKLVQTESQYTFIHDALYEYYLYPDREIHKLELSIYISKLKEFDASGCMKLDTQFKKCINFEPSDYDYMESKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSNENMHQFWPGPDNNALTFRWFKVHCNSEKTEFSVQYSFLISSSREDYALDCTMHCLKYWPNTVSECSELLRLLFDINSKKYSGPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELLEFVILNQHLYTFFSRSQQDFIPNGIAHLPVSQKPILNNNTSSSLIHYSTLGTMXXXXXXXXXXXXXXXVDSEPYGLPTPSPNRKENFGNRISWNAGESRQIGTPLLTESFGEWPTVNCNGHAGGGPNTTNSGSFENPQISDLPVAKIVNLSSSTTNSQIPQSSIYNLTNYGALDNGSNSSGVVWCPQK 2081
            GFKRPYAYIATQGPLTETVADFWQMVWEQNSEIIVMISNFVERGRSKCEIYWSPNKTLNCGNISVHQIYQKEMAFYTERAFRIRNIRLKKNIKDRTVYHYQYTDWRDFDVPPSSLPVLVFVRATTKHWSESSGPIIVHCSAGVGRTGTYICIESQIRQLDQEHHINVRGFLEHIRQQRMKLVQTESQYTFIHDALYEYYLYPDREIHKLELS YISKLKEFDASGCMKLDTQFKKCINFEPSDYDYMESKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSNENMHQFWPGPDNNALTFRWFKVHCNSEKTEFSVQYSFLISSSREDYALDCTMHCLKYWPNTVSECSELLRLLFDINSKKYSGPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELLEFVILNQHLYTFFSRSQQDFIPNGIAHLPVSQKPILNNNTSSSLIHYSTLGTMRSKSSTSTSRRRASSVDSEPYGLPTPSPNRKENFGNRISWNAGESRQIGTPLLTESFGEWPTVNCNGHAGGGPNTTNSGSFENPQISDLPVAKIVNLSSSTTNSQIPQSSIYNLTNYGALD+GSNSSGVVWCPQK
Sbjct:  717 GFKRPYAYIATQGPLTETVADFWQMVWEQNSEIIVMISNFVERGRSKCEIYWSPNKTLNCGNISVHQIYQKEMAFYTERAFRIRNIRLKKNIKDRTVYHYQYTDWRDFDVPPSSLPVLVFVRATTKHWSESSGPIIVHCSAGVGRTGTYICIESQIRQLDQEHHINVRGFLEHIRQQRMKLVQTESQYTFIHDALYEYYLYPDREIHKLELSTYISKLKEFDASGCMKLDTQFKKCINFEPSDYDYMESKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSNENMHQFWPGPDNNALTFRWFKVHCNSEKTEFSVQYSFLISSSREDYALDCTMHCLKYWPNTVSECSELLRLLFDINSKKYSGPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELLEFVILNQHLYTFFSRSQQDFIPNGIAHLPVSQKPILNNNTSSSLIHYSTLGTMRSKSSTSTSRRRASSVDSEPYGLPTPSPNRKENFGNRISWNAGESRQIGTPLLTESFGEWPTVNCNGHAGGGPNTTNSGSFENPQISDLPVAKIVNLSSSTTNSQIPQSSIYNLTNYGALDSGSNSSGVVWCPQK 1378          

HSP 2 Score: 85.5001 bits (210), Expect = 9.572e-17
Identity = 78/287 (27.18%), Postives = 132/287 (45.99%), Query Frame = 3
Query:  699 PDREIHKLELSIYISKLKEFDASGCMKLDTQFKKCINFEPSDYDYMESKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSN------ENMHQFWPGPDNNALTFRWFKVHCNSEK-TEFSVQYSFLISSSREDYAL-DCTMHCLKY--WPNTVSECSELLRLLFDINSKKY----SGPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELL 1517
            P   I    L  +I+  +  D +G      +F+   + + + +    + ++ N  KNR   I P +  R+ +   P    S+YINAS I G+ +   +I TQ PL ET  DFW+MVW++N  +I+++SN           +W    N  L      VH   +K   F  + +F I + R    + D T++  +Y  W +     S L  L+F   + K+    SGPI+V    G  R G ++ + S + QL ++  +NV   ++ I  +R     + S   FI++ L
Sbjct:  631 PYPPIPMTNLVDHINSHRADDGAG---FQAEFEAIESMDTTKWVISAAIQKENKSKNRYTNIFPYDHSRVIIQ-SPPFGKSDYINASFIDGFKRPYAYIATQGPLTETVADFWQMVWEQNSEIIVMISNFVERGRSKCEIYW--SPNKTLNCGNISVHQIYQKEMAFYTERAFRIRNIRLKKNIKDRTVYHYQYTDWRDFDVPPSSLPVLVFVRATTKHWSESSGPIIVHCSAGVGRTGTYICIESQIRQLDQEHHINVRGFLEHIRQQRMKLVQTESQYTFIHDAL 911          
BLAST of Receptor type tyrosine protein phosphatase zeta vs. Planmine SMEST
Match: SMESG000025325.1 (SMESG000025325.1)

HSP 1 Score: 271.552 bits (693), Expect = 1.725e-76
Identity = 176/524 (33.59%), Postives = 273/524 (52.10%), Query Frame = 3
Query:   96 GFKRPYAYIATQGPLTETVADFWQMVWEQNSEIIVMISNFVERGRSKCEIYWSPNKT---LNCGNISVHQIYQKEMAFYTERAFRIRNIRLKKNIKDRTVYHYQYTDWRDFDXXXXXXXXXXFVRATTKHWSESSGPIIVHCSAGVGRTGTYICIESQIRQLDQEHHINVRGFLEHIRQQRMKLVQTESQYTFIHDALYEYYLYPDREIHKLELSIYISKLK--EFDASGCMKL----------------------------DTQFKKCINFEP--SDYDYMESKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSN-ENMHQFWPGPDNNALTFRWFKVHCNSE-KTEFSVQYSFLISSSREDYALDCTMHCLKYWPNTVS---ECSELLRLLFDINSKK----YSGPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIY-ELLEFVIL 1532
            G+++  AYIATQGPL ET+ DFW+M+WEQ S IIVM++  +ER R KCE YW  +        G I V     +E A++  R+F ++ I    + + R + H+Q+T W D  VP  ++P L+F+    K     SGP++VHCSAGVGRTG YI +++ + Q+  E  ++V  ++ HIR QR  +VQTE QY FIHD L +Y+   + +I   +L  +I KL   E++ +G ++                              T+  + I  +P  S  +Y  S    N  KNRS   +P ++ R+ L    GVEGS+Y NAS I G+   + +I TQ PL ET +DFW+M+W++NC ++I L      +Q+W  P++ +  +++F V    E +    V   F ++ +R+  +          W +          LL L+  +   K      GP+ V    GS R GIF+ +S LL +L+ D+ VNV+   K++  +RP    S     F +  LLE++ L
Sbjct: 1557 GYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGIMVTVNLVQEFAYFICRSFVVQKI---GSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVNTDIACSQLFSHIEKLSKIEYEKAGLLQFTGFQLEYRRLLRWSSLFSHMTPSTKSECSTKSSESIGCQPDFSTNNYETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPECNQYW--PNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYLTL 2075          

HSP 2 Score: 108.227 bits (269), Expect = 1.033e-23
Identity = 66/209 (31.58%), Postives = 108/209 (51.67%), Query Frame = 3
Query:   96 GFKRPYAYIATQGPLTETVADFWQMVWEQNSEIIVMISNFVERGRSKCEIYWSPNKTLNCGNISVHQIYQKEMAFYTERAFRIRNIRLKKNIKDRTVYHYQYTDWRDFDXXXXXXXXXXF-----VRATTKHWSESSGPIIVHCSAGVGRTGTYICIESQIRQLDQEHHINVRGFLEHIRQQRMKLVQTESQYTFIHDALYEYY-LYPD 704
            GFK   AYIATQ PL ET  DFW+M+WEQN  I++ +    E     C  YW  +++       V  I + +M+ +  R F++ + R   + + R +  +Q+T+W D D         +      V+ T + + +  GP+ VHC+ G  RTG ++ +   + +L  ++ +NV    + ++ QR  L+++E QY F   AL EY  LY D
Sbjct: 1880 GFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPE-----CNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDAR---DGQSRVMRQFQFTNWID-DSCIPISIEHLLELIDQVQKTKEQFGQ-KGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYLTLYSD 2078          

HSP 3 Score: 95.1301 bits (235), Expect = 1.347e-19
Identity = 79/293 (26.96%), Postives = 140/293 (47.78%), Query Frame = 3
Query:  714 HKLELSI---YISKLKEFDASGCMKLDTQFKKC-----INFEPSDYDYMESKKRY-NLVKNRSDTIMPIESRRINLSCEP--GVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILL------SNENMHQFWPGPDNNA-LTFRWFKVHCN-SEKTEFSVQYSFLISSSREDYALDCTMHCLKYWPN-TVSECSELLRLLFDINSKKY-----SGPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELL 1517
            HK+ +++   YIS LK  +  G     T+F+        ++E S+    +SK RY N+V      ++   S+ +N  C+       ++YINA+ I GY +   +I TQ PL ET  DFW+M+W++   +I++L      S     Q+WP  +     T+    V  N  ++  + +  SF++         +        WP+  V +C+  +  L  IN  K      SGP+VV    G  R G+++A+ ++L Q++ +  V+VY  +  I  +R Y   +    +FI+++L
Sbjct: 1464 HKVPIALLQEYISNLKTNENRG---FSTEFESIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGIMVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCT--IPFLMFINRIKKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVL 1751          
BLAST of Receptor type tyrosine protein phosphatase zeta vs. Planmine SMEST
Match: SMESG000025325.1 (SMESG000025325.1)

HSP 1 Score: 270.781 bits (691), Expect = 2.495e-76
Identity = 176/524 (33.59%), Postives = 273/524 (52.10%), Query Frame = 3
Query:   96 GFKRPYAYIATQGPLTETVADFWQMVWEQNSEIIVMISNFVERGRSKCEIYWSPNKT---LNCGNISVHQIYQKEMAFYTERAFRIRNIRLKKNIKDRTVYHYQYTDWRDFDXXXXXXXXXXFVRATTKHWSESSGPIIVHCSAGVGRTGTYICIESQIRQLDQEHHINVRGFLEHIRQQRMKLVQTESQYTFIHDALYEYYLYPDREIHKLELSIYISKLK--EFDASGCMKL----------------------------DTQFKKCINFEP--SDYDYMESKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSN-ENMHQFWPGPDNNALTFRWFKVHCNSE-KTEFSVQYSFLISSSREDYALDCTMHCLKYWPNTVS---ECSELLRLLFDINSKK----YSGPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIY-ELLEFVIL 1532
            G+++  AYIATQGPL ET+ DFW+M+WEQ S IIVM++  +ER R KCE YW  +        G I V     +E A++  R+F ++ I    + + R + H+Q+T W D  VP  ++P L+F+    K     SGP++VHCSAGVGRTG YI +++ + Q+  E  ++V  ++ HIR QR  +VQTE QY FIHD L +Y+   + +I   +L  +I KL   E++ +G ++                              T+  + I  +P  S  +Y  S    N  KNRS   +P ++ R+ L    GVEGS+Y NAS I G+   + +I TQ PL ET +DFW+M+W++NC ++I L      +Q+W  P++ +  +++F V    E +    V   F ++ +R+  +          W +          LL L+  +   K      GP+ V    GS R GIF+ +S LL +L+ D+ VNV+   K++  +RP    S     F +  LLE++ L
Sbjct: 1542 GYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGIMVTVNLVQEFAYFICRSFVVQKI---GSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVNTDIACSQLFSHIEKLSKIEYEKAGLLQFTGFQLEYRRLLRWSSLFSHMTPSTKSECSTKSSESIGCQPDFSTNNYETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPECNQYW--PNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYLTL 2060          

HSP 2 Score: 108.227 bits (269), Expect = 1.133e-23
Identity = 66/209 (31.58%), Postives = 108/209 (51.67%), Query Frame = 3
Query:   96 GFKRPYAYIATQGPLTETVADFWQMVWEQNSEIIVMISNFVERGRSKCEIYWSPNKTLNCGNISVHQIYQKEMAFYTERAFRIRNIRLKKNIKDRTVYHYQYTDWRDFDXXXXXXXXXXF-----VRATTKHWSESSGPIIVHCSAGVGRTGTYICIESQIRQLDQEHHINVRGFLEHIRQQRMKLVQTESQYTFIHDALYEYY-LYPD 704
            GFK   AYIATQ PL ET  DFW+M+WEQN  I++ +    E     C  YW  +++       V  I + +M+ +  R F++ + R   + + R +  +Q+T+W D D         +      V+ T + + +  GP+ VHC+ G  RTG ++ +   + +L  ++ +NV    + ++ QR  L+++E QY F   AL EY  LY D
Sbjct: 1865 GFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPE-----CNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDAR---DGQSRVMRQFQFTNWID-DSCIPISIEHLLELIDQVQKTKEQFGQ-KGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYLTLYSD 2063          

HSP 3 Score: 94.7449 bits (234), Expect = 1.489e-19
Identity = 79/293 (26.96%), Postives = 140/293 (47.78%), Query Frame = 3
Query:  714 HKLELSI---YISKLKEFDASGCMKLDTQFKKC-----INFEPSDYDYMESKKRY-NLVKNRSDTIMPIESRRINLSCEP--GVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILL------SNENMHQFWPGPDNNA-LTFRWFKVHCN-SEKTEFSVQYSFLISSSREDYALDCTMHCLKYWPN-TVSECSELLRLLFDINSKKY-----SGPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELL 1517
            HK+ +++   YIS LK  +  G     T+F+        ++E S+    +SK RY N+V      ++   S+ +N  C+       ++YINA+ I GY +   +I TQ PL ET  DFW+M+W++   +I++L      S     Q+WP  +     T+    V  N  ++  + +  SF++         +        WP+  V +C+  +  L  IN  K      SGP+VV    G  R G+++A+ ++L Q++ +  V+VY  +  I  +R Y   +    +FI+++L
Sbjct: 1449 HKVPIALLQEYISNLKTNENRG---FSTEFESIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGIMVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCT--IPFLMFINRIKKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVL 1736          
BLAST of Receptor type tyrosine protein phosphatase zeta vs. Planmine SMEST
Match: SMESG000025325.1 (SMESG000025325.1)

HSP 1 Score: 270.781 bits (691), Expect = 2.538e-76
Identity = 176/524 (33.59%), Postives = 273/524 (52.10%), Query Frame = 3
Query:   96 GFKRPYAYIATQGPLTETVADFWQMVWEQNSEIIVMISNFVERGRSKCEIYWSPNKT---LNCGNISVHQIYQKEMAFYTERAFRIRNIRLKKNIKDRTVYHYQYTDWRDFDXXXXXXXXXXFVRATTKHWSESSGPIIVHCSAGVGRTGTYICIESQIRQLDQEHHINVRGFLEHIRQQRMKLVQTESQYTFIHDALYEYYLYPDREIHKLELSIYISKLK--EFDASGCMKL----------------------------DTQFKKCINFEP--SDYDYMESKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSN-ENMHQFWPGPDNNALTFRWFKVHCNSE-KTEFSVQYSFLISSSREDYALDCTMHCLKYWPNTVS---ECSELLRLLFDINSKK----YSGPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIY-ELLEFVIL 1532
            G+++  AYIATQGPL ET+ DFW+M+WEQ S IIVM++  +ER R KCE YW  +        G I V     +E A++  R+F ++ I    + + R + H+Q+T W D  VP  ++P L+F+    K     SGP++VHCSAGVGRTG YI +++ + Q+  E  ++V  ++ HIR QR  +VQTE QY FIHD L +Y+   + +I   +L  +I KL   E++ +G ++                              T+  + I  +P  S  +Y  S    N  KNRS   +P ++ R+ L    GVEGS+Y NAS I G+   + +I TQ PL ET +DFW+M+W++NC ++I L      +Q+W  P++ +  +++F V    E +    V   F ++ +R+  +          W +          LL L+  +   K      GP+ V    GS R GIF+ +S LL +L+ D+ VNV+   K++  +RP    S     F +  LLE++ L
Sbjct: 1547 GYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGIMVTVNLVQEFAYFICRSFVVQKI---GSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVNTDIACSQLFSHIEKLSKIEYEKAGLLQFTGFQLEYRRLLRWSSLFSHMTPSTKSECSTKSSESIGCQPDFSTNNYETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPECNQYW--PNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYLTL 2065          

HSP 2 Score: 109.383 bits (272), Expect = 5.712e-24
Identity = 70/232 (30.17%), Postives = 115/232 (49.57%), Query Frame = 3
Query:   96 GFKRPYAYIATQGPLTETVADFWQMVWEQNSEIIVMISNFVERGRSKCEIYWSPNKTLNCGNISVHQIYQKEMAFYTERAFRIRNIRLKKNIKDRTVYHYQYTDWRDFDXXXXXXXXXXF-----VRATTKHWSESSGPIIVHCSAGVGRTGTYICIESQIRQLDQEHHINVRGFLEHIRQQRMKLVQTESQYTFIHDALYEYY-LYPDREIHKLELSIYISKLKEFDASGC 773
            GFK   AYIATQ PL ET  DFW+M+WEQN  I++ +    E     C  YW  +++       V  I + +M+ +  R F++ + R   + + R +  +Q+T+W D D         +      V+ T + + +  GP+ VHC+ G  RTG ++ +   + +L  ++ +NV    + ++ QR  L+++E QY F   AL EY  LY D   +   L +      EF  +G 
Sbjct: 1870 GFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPE-----CNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDAR---DGQSRVMRQFQFTNWID-DSCIPISIEHLLELIDQVQKTKEQFGQK-GPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYLTLYSDENTN---LKLRKGNFAEFVGAGA 2088          

HSP 3 Score: 95.1301 bits (235), Expect = 1.391e-19
Identity = 79/293 (26.96%), Postives = 140/293 (47.78%), Query Frame = 3
Query:  714 HKLELSI---YISKLKEFDASGCMKLDTQFKKC-----INFEPSDYDYMESKKRY-NLVKNRSDTIMPIESRRINLSCEP--GVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSLIILL------SNENMHQFWPGPDNNA-LTFRWFKVHCN-SEKTEFSVQYSFLISSSREDYALDCTMHCLKYWPN-TVSECSELLRLLFDINSKKY-----SGPIVVIDEYGSSRAGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELL 1517
            HK+ +++   YIS LK  +  G     T+F+        ++E S+    +SK RY N+V      ++   S+ +N  C+       ++YINA+ I GY +   +I TQ PL ET  DFW+M+W++   +I++L      S     Q+WP  +     T+    V  N  ++  + +  SF++         +        WP+  V +C+  +  L  IN  K      SGP+VV    G  R G+++A+ ++L Q++ +  V+VY  +  I  +R Y   +    +FI+++L
Sbjct: 1454 HKVPIALLQEYISNLKTNENRG---FSTEFESIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGIMVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCT--IPFLMFINRIKKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVL 1741          
The following BLAST results are available for this feature:
BLAST of Receptor type tyrosine protein phosphatase zeta vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PTPRZ11.166e-11141.38protein tyrosine phosphatase receptor type Z1 [Sou... [more]
PTPRZ11.342e-11141.38protein tyrosine phosphatase receptor type Z1 [Sou... [more]
PTPRZ11.519e-11141.38protein tyrosine phosphatase receptor type Z1 [Sou... [more]
PTPRZ11.536e-11141.38protein tyrosine phosphatase receptor type Z1 [Sou... [more]
PTPRZ12.300e-11141.38protein tyrosine phosphatase receptor type Z1 [Sou... [more]
back to top
BLAST of Receptor type tyrosine protein phosphatase zeta vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptp-38.172e-6930.85Tyrosine-protein phosphatase Lar-like [Source:Uni... [more]
ptp-31.775e-6830.85Tyrosine-protein phosphatase Lar-like [Source:Uni... [more]
ptp-32.185e-6830.85Tyrosine-protein phosphatase Lar-like [Source:Uni... [more]
ptp-34.800e-6830.85Tyrosine-protein phosphatase Lar-like [Source:Uni... [more]
ptp-35.013e-6830.85Tyrosine-protein phosphatase Lar-like [Source:Uni... [more]
back to top
BLAST of Receptor type tyrosine protein phosphatase zeta vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ptp99A1.580e-10439.55gene:FBgn0004369 transcript:FBtr0303454[more]
Ptp99A1.046e-10239.55gene:FBgn0004369 transcript:FBtr0085422[more]
Ptp99A1.117e-10239.55gene:FBgn0004369 transcript:FBtr0085424[more]
Ptp99A2.252e-10239.88gene:FBgn0004369 transcript:FBtr0085423[more]
Ptp99A7.641e-10239.55gene:FBgn0004369 transcript:FBtr0303148[more]
back to top
BLAST of Receptor type tyrosine protein phosphatase zeta vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptprga3.012e-10940.40protein tyrosine phosphatase receptor type Ga [Sou... [more]
ca16b1.349e-10840.12carbonic anhydrase XVI b [Source:ZFIN;Acc:ZDB-GENE... [more]
ca16b1.441e-10640.45carbonic anhydrase XVI b [Source:ZFIN;Acc:ZDB-GENE... [more]
BX663614.21.627e-10640.45carbonic anhydrase XVI b [Source:NCBI gene;Acc:569... [more]
ptprz1b3.012e-10538.25protein tyrosine phosphatase receptor type Z1b [So... [more]
back to top
BLAST of Receptor type tyrosine protein phosphatase zeta vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tfam6.047e-11039.16transcription factor A, mitochondrial [Source:Xenb... [more]
tfam6.260e-10938.80transcription factor A, mitochondrial [Source:Xenb... [more]
PTPRZ11.565e-10741.38protein tyrosine phosphatase receptor type Z1 [Sou... [more]
PTPRZ11.610e-10741.38protein tyrosine phosphatase receptor type Z1 [Sou... [more]
PTPRZ11.785e-10741.38protein tyrosine phosphatase receptor type Z1 [Sou... [more]
back to top
BLAST of Receptor type tyrosine protein phosphatase zeta vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ptprg9.035e-11239.40protein tyrosine phosphatase, receptor type, G [So... [more]
Ptprz13.075e-11141.38protein tyrosine phosphatase, receptor type Z, pol... [more]
Ptprz13.480e-11141.38protein tyrosine phosphatase, receptor type Z, pol... [more]
Ptprg1.833e-10639.40protein tyrosine phosphatase, receptor type, G [So... [more]
Ptprd6.168e-7933.33protein tyrosine phosphatase, receptor type, D [So... [more]
back to top
BLAST of Receptor type tyrosine protein phosphatase zeta vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P23471|PTPRZ_HUMAN7.375e-11141.38Receptor-type tyrosine-protein phosphatase zeta OS... [more]
sp|Q62656|PTPRZ_RAT2.074e-11041.58Receptor-type tyrosine-protein phosphatase zeta OS... [more]
sp|B9EKR1|PTPRZ_MOUSE2.435e-11041.38Receptor-type tyrosine-protein phosphatase zeta OS... [more]
sp|P23470|PTPRG_HUMAN1.069e-10539.92Receptor-type tyrosine-protein phosphatase gamma O... [more]
sp|Q05909|PTPRG_MOUSE6.464e-10539.20Receptor-type tyrosine-protein phosphatase gamma O... [more]
back to top
BLAST of Receptor type tyrosine protein phosphatase zeta vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5K3F3L26.166e-15952.39Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A0X3PVJ11.315e-15852.90Tyrosine-protein phosphatase 99A (Fragment) OS=Sch... [more]
A0A0X3PY591.535e-15851.80Tyrosine-protein phosphatase 99A (Fragment) OS=Sch... [more]
A0A087VZX32.357e-15852.95Receptor type tyrosine protein phosphatase zeta OS... [more]
A0A564YP232.554e-15451.63Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
back to top
BLAST of Receptor type tyrosine protein phosphatase zeta vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptprga3.238e-10940.32protein tyrosine phosphatase receptor type Ga [Sou... [more]
ptprz1a3.556e-10538.96protein tyrosine phosphatase receptor type Z1 [Sou... [more]
ptprz1a3.781e-10538.96protein tyrosine phosphatase receptor type Z1 [Sou... [more]
ca16b1.366e-8235.79carbonic anhydrase XVI b [Source:ZFIN;Acc:ZDB-GENE... [more]
ENSAMXT00000022449.27.844e-8133.53pep primary_assembly:Astyanax_mexicanus-2.0:21:174... [more]
back to top
BLAST of Receptor type tyrosine protein phosphatase zeta vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ca16b1.360e-10638.14carbonic anhydrase XVI b [Source:ZFIN;Acc:ZDB-GENE... [more]
ptpra2.290e-7230.75protein tyrosine phosphatase receptor type A [Sour... [more]
ENSPMAT00000002738.13.078e-5731.48pep scaffold:Pmarinus_7.0:GL477626:22501:55781:-1 ... [more]
ENSPMAT00000006943.13.154e-5733.18pep scaffold:Pmarinus_7.0:GL476401:102791:181294:1... [more]
ptprk2.409e-5235.07protein tyrosine phosphatase receptor type K [Sour... [more]
back to top
BLAST of Receptor type tyrosine protein phosphatase zeta vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
PTP12.771e-1929.57Phosphotyrosine-specific protein phosphatase; deph... [more]
PTP29.281e-730.12Nuclear phosphotyrosine-specific phosphatase invol... [more]
back to top
BLAST of Receptor type tyrosine protein phosphatase zeta vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO481873.388e-8735.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO453822.040e-8432.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO438542.770e-8234.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO469619.068e-8034.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO339955.191e-7133.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Receptor type tyrosine protein phosphatase zeta vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptprz1a2.089e-10740.19protein tyrosine phosphatase receptor type Z1 [Sou... [more]
PTPRD1.912e-8033.60receptor-type tyrosine-protein phosphatase delta [... [more]
PTPRD2.542e-8034.13receptor-type tyrosine-protein phosphatase delta [... [more]
PTPRD2.881e-8034.13receptor-type tyrosine-protein phosphatase delta [... [more]
PTPRD3.394e-8034.13receptor-type tyrosine-protein phosphatase delta [... [more]
back to top
BLAST of Receptor type tyrosine protein phosphatase zeta vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000041505.18.766e-1799.70SMESG000041505.1[more]
SMESG000041505.19.572e-1799.70SMESG000041505.1[more]
SMESG000025325.11.725e-7633.59SMESG000025325.1[more]
SMESG000025325.12.495e-7633.59SMESG000025325.1[more]
SMESG000025325.12.538e-7633.59SMESG000025325.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024560 ID=SMED30024560|Name=Receptor type tyrosine protein phosphatase zeta|organism=Schmidtea mediterranea sexual|type=transcript|length=2361bp
CATTAACGCAAGCTTTATCGATGTAAAGTACCAATTGTTGATTTTGATAA
TTTGATAGTGGTAAACTACTGTGAAAATTAATATCATCATGTTAGGGTTT
CAAACGTCCATATGCTTATATAGCCACACAAGGCCCATTGACAGAAACTG
TTGCCGATTTCTGGCAAATGGTTTGGGAGCAAAACTCGGAAATAATCGTC
ATGATTTCGAATTTTGTTGAACGTGGGCGGTCCAAGTGTGAAATATACTG
GTCACCGAATAAAACTCTGAATTGCGGAAATATTTCTGTTCATCAAATCT
ATCAGAAAGAAATGGCATTCTACACTGAAAGGGCTTTTAGAATCCGTAAT
ATTCGATTGAAAAAGAATATCAAAGATAGAACAGTTTATCATTATCAATA
TACTGATTGGCGTGATTTCGATGTTCCACCTTCATCATTGCCAGTTTTAG
TTTTCGTACGTGCTACAACCAAACATTGGTCAGAATCATCTGGTCCCATA
ATTGTACATTGCAGTGCCGGAGTCGGTAGAACTGGTACTTATATCTGTAT
TGAAAGCCAAATTAGACAATTGGATCAAGAACATCATATTAATGTTAGAG
GTTTCCTGGAGCATATTCGGCAACAGAGAATGAAATTGGTTCAAACTGAG
TCTCAGTACACATTTATTCACGACGCCTTATACGAATATTACCTGTATCC
AGATCGCGAGATCCACAAGTTGGAACTGTCAATCTACATATCGAAATTGA
AAGAATTCGATGCATCGGGATGTATGAAATTGGATACTCAATTTAAAAAA
TGTATAAATTTTGAACCGAGTGATTATGATTACATGGAATCAAAAAAAAG
ATATAATCTCGTTAAAAATAGATCTGATACAATTATGCCGATTGAATCCC
GTCGTATAAATCTATCTTGTGAGCCTGGAGTTGAAGGATCTAATTACATT
AATGCATCAGCTATTCAAGGTTATTGGCAAATGAAAGAATTTATTATTAC
ACAGCATCCGTTGGATGAAACAGAACAAGACTTTTGGAAAATGGTTTGGG
ATGAAAATTGCTCTTTGATTATCCTTCTGTCGAATGAAAATATGCATCAG
TTTTGGCCTGGGCCAGACAATAATGCTCTTACTTTTCGGTGGTTCAAGGT
TCATTGTAATTCTGAAAAAACCGAATTCTCTGTACAATACAGTTTTCTTA
TAAGCTCATCCAGAGAAGATTATGCTTTGGATTGTACAATGCATTGTTTG
AAATATTGGCCTAACACTGTGTCCGAGTGCAGTGAATTGTTGCGCTTACT
GTTTGACATAAACTCAAAGAAGTATAGCGGTCCGATCGTGGTTATTGATG
AATATGGCAGTAGTCGAGCCGGTATATTCGTGGCTATGAGTTCTCTCTTG
CATCAGCTACGAAAAGATGATGTTGTGAATGTTTATTTCGTCATGAAAAT
GATTCACATTGAACGCCCGTATACATTTTCAAGTAGTAGTGATCTTCTAT
TTATCTATGAGCTGCTGGAATTTGTCATTTTAAATCAGCACCTATACACT
TTCTTTTCCCGTTCTCAGCAGGACTTTATTCCCAATGGCATAGCGCATTT
ACCGGTGTCTCAAAAGCCAATTCTCAACAACAACACATCATCGTCTCTAA
TCCATTATTCTACTCTCGGAACAATGAGATCTAAATCATCCACGTCTACC
TCTCGTCGTAGGGCCTCATCTGTCGACTCTGAACCGTACGGTTTACCGAC
TCCATCTCCGAATAGAAAGGAAAATTTCGGCAATCGCATCAGCTGGAATG
CCGGTGAAAGCCGACAAATCGGAACTCCATTACTGACGGAAAGTTTCGGA
GAATGGCCGACAGTGAACTGCAATGGACATGCCGGTGGTGGACCAAATAC
TACAAACAGTGGATCGTTTGAAAATCCTCAGATTTCCGATTTGCCAGTTG
CGAAGATTGTCAATCTGTCATCATCGACAACCAACAGCCAAATTCCTCAG
TCTTCGATATACAATCTAACAAATTACGGTGCTCTTGATAACGGATCAAA
CTCCAGTGGCGTTGTTTGGTGCCCACAGAAATGACCGGTTGGGCTCCAGA
ATAAACACTCCAATAACCAGAGCACCCTATTCGCATTTCTTATTCAATAA
AATGTGCAATCAGATTGATTTAATCATTGCTTATAATCAGACAATATTTC
AGAGTTATTTATTATATCAATTTATTTATAAATTTTGATTGTTTCCCGAT
AATCTGTGTACAATTTAGATAAATACAATAATACACACACACATATACAC
AGCGCGTGCGCGGAAATATATAACGTCTATTGTTGTTGATGATTACTTCG
TTTCATCTTAT
back to top

protein sequence of SMED30024560-orf-1

>SMED30024560-orf-1 ID=SMED30024560-orf-1|Name=SMED30024560-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=639bp
MVWEQNSEIIVMISNFVERGRSKCEIYWSPNKTLNCGNISVHQIYQKEMA
FYTERAFRIRNIRLKKNIKDRTVYHYQYTDWRDFDVPPSSLPVLVFVRAT
TKHWSESSGPIIVHCSAGVGRTGTYICIESQIRQLDQEHHINVRGFLEHI
RQQRMKLVQTESQYTFIHDALYEYYLYPDREIHKLELSIYISKLKEFDAS
GCMKLDTQFKKCINFEPSDYDYMESKKRYNLVKNRSDTIMPIESRRINLS
CEPGVEGSNYINASAIQGYWQMKEFIITQHPLDETEQDFWKMVWDENCSL
IILLSNENMHQFWPGPDNNALTFRWFKVHCNSEKTEFSVQYSFLISSSRE
DYALDCTMHCLKYWPNTVSECSELLRLLFDINSKKYSGPIVVIDEYGSSR
AGIFVAMSSLLHQLRKDDVVNVYFVMKMIHIERPYTFSSSSDLLFIYELL
EFVILNQHLYTFFSRSQQDFIPNGIAHLPVSQKPILNNNTSSSLIHYSTL
GTMRSKSSTSTSRRRASSVDSEPYGLPTPSPNRKENFGNRISWNAGESRQ
IGTPLLTESFGEWPTVNCNGHAGGGPNTTNSGSFENPQISDLPVAKIVNL
SSSTTNSQIPQSSIYNLTNYGALDNGSNSSGVVWCPQK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0002056medial muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000242PTPase_domain
IPR003595Tyr_Pase_cat
IPR029021Prot-tyrosine_phosphatase-like
IPR016130Tyr_Pase_AS
IPR000387TYR_PHOSPHATASE_dom
Vocabulary: biological process
TermDefinition
GO:0006470protein dephosphorylation
GO:0016311dephosphorylation
GO:0035335peptidyl-tyrosine dephosphorylation
Vocabulary: molecular function
TermDefinition
GO:0004725protein tyrosine phosphatase activity
GO:0016791phosphatase activity
GO:0004721phosphoprotein phosphatase activity
GO:0016787hydrolase activity
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000242PTP type protein phosphatasePRINTSPR00700PRTYPHPHTASEcoord: 110..128
score: 72.51
coord: 71..88
score: 41.63
coord: 157..167
score: 58.5
coord: 141..156
score: 26.8
IPR000242PTP type protein phosphataseSMARTSM00194PTPc_3coord: 204..455
e-value: 5.1E-44
score: 162.2
coord: 1..176
e-value: 1.5E-23
score: 94.2
IPR000242PTP type protein phosphatasePFAMPF00102Y_phosphatasecoord: 230..450
e-value: 7.1E-43
score: 146.9
coord: 1..172
e-value: 3.2E-47
score: 161.1
IPR000242PTP type protein phosphatasePROSITEPS50055TYR_PHOSPHATASE_PTPcoord: 205..453
score: 32.395
IPR000242PTP type protein phosphatasePROSITEPS50055TYR_PHOSPHATASE_PTPcoord: 1..174
score: 32.301
IPR003595Protein-tyrosine phosphatase, catalyticSMARTSM00404ptp_7coord: 355..452
e-value: 3.2E-6
score: 36.7
coord: 72..173
e-value: 1.4E-34
score: 130.9
IPR029021Protein-tyrosine phosphatase-likeGENE3DG3DSA:3.90.190.10coord: 182..453
e-value: 2.6E-56
score: 193.0
IPR029021Protein-tyrosine phosphatase-likeGENE3DG3DSA:3.90.190.10coord: 1..181
e-value: 6.4E-63
score: 214.8
IPR029021Protein-tyrosine phosphatase-likeSUPERFAMILYSSF52799(Phosphotyrosine protein) phosphatases IIcoord: 1..176
IPR029021Protein-tyrosine phosphatase-likeSUPERFAMILYSSF52799(Phosphotyrosine protein) phosphatases IIcoord: 188..453
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 505..535
NoneNo IPR availablePANTHERPTHR19134PROTEIN-TYROSINE PHOSPHATASEcoord: 1..460
NoneNo IPR availablePANTHERPTHR19134:SF461RECEPTOR-TYPE TYROSINE-PROTEIN PHOSPHATASE ZETAcoord: 1..460
NoneNo IPR availableCDDcd14550R5-PTP-2coord: 260..448
e-value: 1.33422E-54
score: 182.906
NoneNo IPR availableCDDcd14549R5-PTPc-1coord: 1..169
e-value: 3.17268E-79
score: 248.035
IPR016130Protein-tyrosine phosphatase, active sitePROSITEPS00383TYR_PHOSPHATASE_1coord: 113..123
IPR000387Tyrosine specific protein phosphatases domainPROSITEPS50056TYR_PHOSPHATASE_2coord: 91..165
score: 19.289