Beta-amyloid-like protein

Overview
NameBeta-amyloid-like protein
Smed IDSMED30024538
Length (bp)1910
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Beta-amyloid-like protein (SMED30024538) t-SNE clustered cells

Violin plots show distribution of expression levels for Beta-amyloid-like protein (SMED30024538) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Beta-amyloid-like protein (SMED30024538) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Beta-amyloid-like protein (SMED30024538) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024538

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30024538SMESG000025222.1 SMESG000025214.1 SMESG000025213.1 dd_Smed_v4_2561_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30024538SMESG000025222.1 SMESG000025214.1 SMESG000025213.1 dd_Smed_v4_2561_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30024538SMESG000025222.1 SMESG000025214.1 SMESG000025213.1 dd_Smed_v4_2561_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30024538SMESG000025222.1 SMESG000025214.1 SMESG000025213.1 dd_Smed_v4_2561_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30024538SMESG000025222.1 SMESG000025214.1 SMESG000025213.1 dd_Smed_v4_2561_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30024538SMESG000025222.1 SMESG000025214.1 SMESG000025213.1 dd_Smed_v4_2561_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30024538SMESG000025222.1 SMESG000025214.1 SMESG000025213.1 dd_Smed_v4_2561_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30024538SMESG000025222.1 SMESG000025214.1 SMESG000025213.1 dd_Smed_v4_2561_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30024538SMESG000025222.1 SMESG000025214.1 SMESG000025213.1 dd_Smed_v4_2561_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30024538SMESG000025222.1 SMESG000025214.1 Contig16636newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30024538SMESG000025222.1 SMESG000025214.1 Contig16636uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30024538SMESG000025222.1 SMESG000025214.1 SMESG000025213.1 dd_Smed_v6_2561_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30024538SMESG000025222.1 SMESG000025214.1 SMESG000025213.1 dd_Smed_v4_2561_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Beta-amyloid-like protein vs. Ensembl Human
Match: APP (amyloid beta precursor protein [Source:HGNC Symbol;Acc:HGNC:620])

HSP 1 Score: 106.301 bits (264), Expect = 3.039e-23
Identity = 60/177 (33.90%), Postives = 95/177 (53.67%), Query Frame = 3
Query:  141 QVAFYCGR---PANVFRNKVWTLD--FQQDCLTNETKIVEFCQKSFPQWKILTSEPAVEKSKFKSWCDFKNQSCEVNVE-IRPFKCLDKNFQSDALILPRNCQFGHLFNETGCLLYKHWVKNAKEECIRKNNWHIKSYGMLFPCSINDNKIKPMFFKGVEFVCCP-NQEFKSVDNSD 650
            Q+A +CGR     NV +N  W  D    + C+  +  I+++CQ+ +P+ +I     A +    ++WC    + C+ +   + P++CL   F SDAL++P  C+F H      C  + HW   AKE C  K+  ++  YGML PC I+        F+GVEFVCCP  +E  +VD++D
Sbjct:   33 QIAMFCGRLNMHMNV-QNGKWDSDPSGTKTCIDTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHPHFVIPYRCLVGEFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKST-NLHDYGMLLPCGIDK-------FRGVEFVCCPLAEESDNVDSAD 200          
BLAST of Beta-amyloid-like protein vs. Ensembl Human
Match: APP (amyloid beta precursor protein [Source:HGNC Symbol;Acc:HGNC:620])

HSP 1 Score: 105.531 bits (262), Expect = 5.430e-23
Identity = 60/177 (33.90%), Postives = 95/177 (53.67%), Query Frame = 3
Query:  141 QVAFYCGR---PANVFRNKVWTLD--FQQDCLTNETKIVEFCQKSFPQWKILTSEPAVEKSKFKSWCDFKNQSCEVNVE-IRPFKCLDKNFQSDALILPRNCQFGHLFNETGCLLYKHWVKNAKEECIRKNNWHIKSYGMLFPCSINDNKIKPMFFKGVEFVCCP-NQEFKSVDNSD 650
            Q+A +CGR     NV +N  W  D    + C+  +  I+++CQ+ +P+ +I     A +    ++WC    + C+ +   + P++CL   F SDAL++P  C+F H      C  + HW   AKE C  K+  ++  YGML PC I+        F+GVEFVCCP  +E  +VD++D
Sbjct:   28 QIAMFCGRLNMHMNV-QNGKWDSDPSGTKTCIDTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHPHFVIPYRCLVGEFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKST-NLHDYGMLLPCGIDK-------FRGVEFVCCPLAEESDNVDSAD 195          
BLAST of Beta-amyloid-like protein vs. Ensembl Human
Match: APP (amyloid beta precursor protein [Source:HGNC Symbol;Acc:HGNC:620])

HSP 1 Score: 105.531 bits (262), Expect = 5.780e-23
Identity = 60/177 (33.90%), Postives = 95/177 (53.67%), Query Frame = 3
Query:  141 QVAFYCGR---PANVFRNKVWTLD--FQQDCLTNETKIVEFCQKSFPQWKILTSEPAVEKSKFKSWCDFKNQSCEVNVE-IRPFKCLDKNFQSDALILPRNCQFGHLFNETGCLLYKHWVKNAKEECIRKNNWHIKSYGMLFPCSINDNKIKPMFFKGVEFVCCP-NQEFKSVDNSD 650
            Q+A +CGR     NV +N  W  D    + C+  +  I+++CQ+ +P+ +I     A +    ++WC    + C+ +   + P++CL   F SDAL++P  C+F H      C  + HW   AKE C  K+  ++  YGML PC I+        F+GVEFVCCP  +E  +VD++D
Sbjct:   33 QIAMFCGRLNMHMNV-QNGKWDSDPSGTKTCIDTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHPHFVIPYRCLVGEFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKST-NLHDYGMLLPCGIDK-------FRGVEFVCCPLAEESDNVDSAD 200          
BLAST of Beta-amyloid-like protein vs. Ensembl Human
Match: APP (amyloid beta precursor protein [Source:HGNC Symbol;Acc:HGNC:620])

HSP 1 Score: 105.531 bits (262), Expect = 6.433e-23
Identity = 60/177 (33.90%), Postives = 95/177 (53.67%), Query Frame = 3
Query:  141 QVAFYCGR---PANVFRNKVWTLD--FQQDCLTNETKIVEFCQKSFPQWKILTSEPAVEKSKFKSWCDFKNQSCEVNVE-IRPFKCLDKNFQSDALILPRNCQFGHLFNETGCLLYKHWVKNAKEECIRKNNWHIKSYGMLFPCSINDNKIKPMFFKGVEFVCCP-NQEFKSVDNSD 650
            Q+A +CGR     NV +N  W  D    + C+  +  I+++CQ+ +P+ +I     A +    ++WC    + C+ +   + P++CL   F SDAL++P  C+F H      C  + HW   AKE C  K+  ++  YGML PC I+        F+GVEFVCCP  +E  +VD++D
Sbjct:   33 QIAMFCGRLNMHMNV-QNGKWDSDPSGTKTCIDTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHPHFVIPYRCLVGEFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKST-NLHDYGMLLPCGIDK-------FRGVEFVCCPLAEESDNVDSAD 200          
BLAST of Beta-amyloid-like protein vs. Ensembl Human
Match: APP (amyloid beta precursor protein [Source:HGNC Symbol;Acc:HGNC:620])

HSP 1 Score: 105.531 bits (262), Expect = 6.584e-23
Identity = 60/177 (33.90%), Postives = 95/177 (53.67%), Query Frame = 3
Query:  141 QVAFYCGR---PANVFRNKVWTLD--FQQDCLTNETKIVEFCQKSFPQWKILTSEPAVEKSKFKSWCDFKNQSCEVNVE-IRPFKCLDKNFQSDALILPRNCQFGHLFNETGCLLYKHWVKNAKEECIRKNNWHIKSYGMLFPCSINDNKIKPMFFKGVEFVCCP-NQEFKSVDNSD 650
            Q+A +CGR     NV +N  W  D    + C+  +  I+++CQ+ +P+ +I     A +    ++WC    + C+ +   + P++CL   F SDAL++P  C+F H      C  + HW   AKE C  K+  ++  YGML PC I+        F+GVEFVCCP  +E  +VD++D
Sbjct:   33 QIAMFCGRLNMHMNV-QNGKWDSDPSGTKTCIDTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHPHFVIPYRCLVGEFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKST-NLHDYGMLLPCGIDK-------FRGVEFVCCPLAEESDNVDSAD 200          
BLAST of Beta-amyloid-like protein vs. Ensembl Celegans
Match: apl-1 (Amyloid-beta-like protein [Source:UniProtKB/Swiss-Prot;Acc:Q10651])

HSP 1 Score: 105.145 bits (261), Expect = 2.610e-23
Identity = 85/414 (20.53%), Postives = 172/414 (41.55%), Query Frame = 3
Query:  144 VAFYCG-RPANVFRNKVWTLDFQQ--DCLTNETKIVEFCQKSFPQWKILTSEPAVEKSKFKSWCDFKNQSCEVNVEIRPFKCLDKNFQSDALILPRNCQFGHLFNETGCLLYKHWVKNAKEECIRKNNWH-----IKSYGMLFPCSINDNKIKPMFFKGVEFVCCPNQEFKSVD------------------------------NSDLSMYKTYLNNAVLDTEQGEQKFYEDAEKNLIKSEYEKEAEIINXXXXXXXXXXXXXXXDPEFAKKKEEDFLKGFKTQMNSIQTQFQENKEQLLNFHDNRLEFIFNTKFESAKRNLXXXXXXXXXX--XXEIFEAMKIILKALMDRKKYLMAEFEEAKRFNSKTADA----MYIRMELVDKLISDLFDTLKQVPNYEFILKERLMNYF 1253
            VAF CG R   +     W  D ++   C + +  I+++C+K++P   I        +     WC  +   C+    +RP+ C+D  F S+AL +P +CQF H+ +   C  Y+HW   A ++C  K +       ++S+ +L PC+++        F GVEFVCCPN +    D                                + S    Y   A    E  +   ++ AE  + +   +K  +++ E    E         DP+ A+K +      F+  ++S++ + +  ++++   H+ R++ + N K   A  +  + +           + +++K  ++A    + + +  +    + +SK A A    +  R+  +D  I+     L+  P+ E  ++   + Y+
Sbjct:   38 VAFSCGYRNQYMTEEGSWKTDDERYATCFSGKLDILKYCRKAYPSMNITNIVEYSHEVSISDWCREEGSPCKWTHSVRPYHCIDGEFHSEALQVPHDCQFSHVNSRDQCNDYQHWKDEAGKQCKTKKSKGNKDMIVRSFAVLEPCALD-------MFTGVEFVCCPNDQTNKTDVQKTKEDEDDDDDEDDAYEDDYSEESDEKDEEEPSSQDPYFKIANWTNEHDD---FKKAEMRMDEKHRKKVDKVMKEWGDLETRYNEQKAKDPKGAEKFKSQMNARFQKTVSSLEEEHKRMRKEIEAVHEERVQAMLNEKKRDATHDYRQALATHVNKPNKHSVLQSLKAYIRAEEKDRMHTLNRYRHLLKADSKEAAAYKPTVIHRLRYIDLRINGTLAMLRDFPDLEKYVRPIAVTYW 441          
BLAST of Beta-amyloid-like protein vs. Ensembl Celegans
Match: apl-1 (Amyloid-beta-like protein [Source:UniProtKB/Swiss-Prot;Acc:Q10651])

HSP 1 Score: 105.145 bits (261), Expect = 2.621e-23
Identity = 85/414 (20.53%), Postives = 172/414 (41.55%), Query Frame = 3
Query:  144 VAFYCG-RPANVFRNKVWTLDFQQ--DCLTNETKIVEFCQKSFPQWKILTSEPAVEKSKFKSWCDFKNQSCEVNVEIRPFKCLDKNFQSDALILPRNCQFGHLFNETGCLLYKHWVKNAKEECIRKNNWH-----IKSYGMLFPCSINDNKIKPMFFKGVEFVCCPNQEFKSVD------------------------------NSDLSMYKTYLNNAVLDTEQGEQKFYEDAEKNLIKSEYEKEAEIINXXXXXXXXXXXXXXXDPEFAKKKEEDFLKGFKTQMNSIQTQFQENKEQLLNFHDNRLEFIFNTKFESAKRNLXXXXXXXXXX--XXEIFEAMKIILKALMDRKKYLMAEFEEAKRFNSKTADA----MYIRMELVDKLISDLFDTLKQVPNYEFILKERLMNYF 1253
            VAF CG R   +     W  D ++   C + +  I+++C+K++P   I        +     WC  +   C+    +RP+ C+D  F S+AL +P +CQF H+ +   C  Y+HW   A ++C  K +       ++S+ +L PC+++        F GVEFVCCPN +    D                                + S    Y   A    E  +   ++ AE  + +   +K  +++ E    E         DP+ A+K +      F+  ++S++ + +  ++++   H+ R++ + N K   A  +  + +           + +++K  ++A    + + +  +    + +SK A A    +  R+  +D  I+     L+  P+ E  ++   + Y+
Sbjct:   38 VAFSCGYRNQYMTEEGSWKTDDERYATCFSGKLDILKYCRKAYPSMNITNIVEYSHEVSISDWCREEGSPCKWTHSVRPYHCIDGEFHSEALQVPHDCQFSHVNSRDQCNDYQHWKDEAGKQCKTKKSKGNKDMIVRSFAVLEPCALD-------MFTGVEFVCCPNDQTNKTDVQKTKEDEDDDDDEDDAYEDDYSEESDEKDEEEPSSQDPYFKIANWTNEHDD---FKKAEMRMDEKHRKKVDKVMKEWGDLETRYNEQKAKDPKGAEKFKSQMNARFQKTVSSLEEEHKRMRKEIEAVHEERVQAMLNEKKRDATHDYRQALATHVNKPNKHSVLQSLKAYIRAEEKDRMHTLNRYRHLLKADSKEAAAYKPTVIHRLRYIDLRINGTLAMLRDFPDLEKYVRPIAVTYW 441          
BLAST of Beta-amyloid-like protein vs. Ensembl Fly
Match: Appl (gene:FBgn0000108 transcript:FBtr0307293)

HSP 1 Score: 100.138 bits (248), Expect = 1.977e-21
Identity = 62/220 (28.18%), Postives = 103/220 (46.82%), Query Frame = 3
Query:   81 YLVLVKFSISLIVASSNDDLQVAFYCG-----RPANVFRNKVWTLDFQQ-----DCLTNETKIVEFCQKSFPQWKILTSEPAVEKSKFKSWC---DFKNQSCEVNVE-IRPFKCLDKNFQSDALILPRNCQFGHLFNETGCLLYKHWVKNAKEECIRKNNWHIKSYGMLFPCSINDNKIKPMFFKGVEFVCCPNQEFKS----VDNSDLS-MYKTYLNNA 683
            ++VL   +  +  AS   + Q+A  C      +P  +     W  D  +      CL ++  ++++C+K++P   I     +    K   WC         C+ +   I+PF+CL+  FQSDAL++P  C F H+ N + C  +  W +     C ++    ++S+ ML PC I+        F GVEFVCCP + FK+    V  +DL  M    +N+A
Sbjct:   15 WVVLAIGTAQVQAASPRWEPQIAVLCEAGQIYQPQYLSEEGRWVTDLSKKTTGPTCLRDKMDLLDYCKKAYPNRDITNIVESSHYQKIGGWCRQGALNAAKCKGSHRWIKPFRCLEGPFQSDALLVPEGCLFDHIHNASRCWPFVRWNQTGAAAC-QERGMQMRSFAMLLPCGIS-------VFSGVEFVCCP-KHFKTDEIHVKKTDLPVMPAAQINSA 225          
BLAST of Beta-amyloid-like protein vs. Ensembl Fly
Match: Appl (gene:FBgn0000108 transcript:FBtr0307295)

HSP 1 Score: 99.7525 bits (247), Expect = 2.029e-21
Identity = 62/220 (28.18%), Postives = 103/220 (46.82%), Query Frame = 3
Query:   81 YLVLVKFSISLIVASSNDDLQVAFYCG-----RPANVFRNKVWTLDFQQ-----DCLTNETKIVEFCQKSFPQWKILTSEPAVEKSKFKSWC---DFKNQSCEVNVE-IRPFKCLDKNFQSDALILPRNCQFGHLFNETGCLLYKHWVKNAKEECIRKNNWHIKSYGMLFPCSINDNKIKPMFFKGVEFVCCPNQEFKS----VDNSDLS-MYKTYLNNA 683
            ++VL   +  +  AS   + Q+A  C      +P  +     W  D  +      CL ++  ++++C+K++P   I     +    K   WC         C+ +   I+PF+CL+  FQSDAL++P  C F H+ N + C  +  W +     C ++    ++S+ ML PC I+        F GVEFVCCP + FK+    V  +DL  M    +N+A
Sbjct:   15 WVVLAIGTAQVQAASPRWEPQIAVLCEAGQIYQPQYLSEEGRWVTDLSKKTTGPTCLRDKMDLLDYCKKAYPNRDITNIVESSHYQKIGGWCRQGALNAAKCKGSHRWIKPFRCLEGPFQSDALLVPEGCLFDHIHNASRCWPFVRWNQTGAAAC-QERGMQMRSFAMLLPCGIS-------VFSGVEFVCCP-KHFKTDEIHVKKTDLPVMPAAQINSA 225          
BLAST of Beta-amyloid-like protein vs. Ensembl Fly
Match: Appl (gene:FBgn0000108 transcript:FBtr0307294)

HSP 1 Score: 95.5153 bits (236), Expect = 5.161e-20
Identity = 62/220 (28.18%), Postives = 102/220 (46.36%), Query Frame = 3
Query:   81 YLVLVKFSISLIVASSNDDLQVAFYCG-----RPANVFRNKVWTLDFQQ-----DCLTNETKIVEFCQKSFPQWKILTSEPAVEKSKFKSWC---DFKNQSCEVNVE-IRPFKCLDKNFQSDALILPRNCQFGHLFNETGCLLYKHWVKNAKEECIRKNNWHIKSYGMLFPCSINDNKIKPMFFKGVEFVCCPNQEFKS----VDNSDLS-MYKTYLNNA 683
            ++VL   +  +  AS   + Q+A  C      +P  +     W  D  +      CL ++  ++++C+K++P   I     +    K   WC         C+ +   I+PF+CL   FQSDAL++P  C F H+ N + C  +  W +     C ++    ++S+ ML PC I+        F GVEFVCCP + FK+    V  +DL  M    +N+A
Sbjct:   15 WVVLAIGTAQVQAASPRWEPQIAVLCEAGQIYQPQYLSEEGRWVTDLSKKTTGPTCLRDKMDLLDYCKKAYPNRDITNIVESSHYQKIGGWCRQGALNAAKCKGSHRWIKPFRCLGP-FQSDALLVPEGCLFDHIHNASRCWPFVRWNQTGAAAC-QERGMQMRSFAMLLPCGIS-------VFSGVEFVCCP-KHFKTDEIHVKKTDLPVMPAAQINSA 224          
BLAST of Beta-amyloid-like protein vs. Ensembl Fly
Match: Appl (gene:FBgn0000108 transcript:FBtr0070109)

HSP 1 Score: 95.5153 bits (236), Expect = 5.315e-20
Identity = 62/220 (28.18%), Postives = 102/220 (46.36%), Query Frame = 3
Query:   81 YLVLVKFSISLIVASSNDDLQVAFYCG-----RPANVFRNKVWTLDFQQ-----DCLTNETKIVEFCQKSFPQWKILTSEPAVEKSKFKSWC---DFKNQSCEVNVE-IRPFKCLDKNFQSDALILPRNCQFGHLFNETGCLLYKHWVKNAKEECIRKNNWHIKSYGMLFPCSINDNKIKPMFFKGVEFVCCPNQEFKS----VDNSDLS-MYKTYLNNA 683
            ++VL   +  +  AS   + Q+A  C      +P  +     W  D  +      CL ++  ++++C+K++P   I     +    K   WC         C+ +   I+PF+CL   FQSDAL++P  C F H+ N + C  +  W +     C ++    ++S+ ML PC I+        F GVEFVCCP + FK+    V  +DL  M    +N+A
Sbjct:   15 WVVLAIGTAQVQAASPRWEPQIAVLCEAGQIYQPQYLSEEGRWVTDLSKKTTGPTCLRDKMDLLDYCKKAYPNRDITNIVESSHYQKIGGWCRQGALNAAKCKGSHRWIKPFRCLGP-FQSDALLVPEGCLFDHIHNASRCWPFVRWNQTGAAAC-QERGMQMRSFAMLLPCGIS-------VFSGVEFVCCP-KHFKTDEIHVKKTDLPVMPAAQINSA 224          
BLAST of Beta-amyloid-like protein vs. Ensembl Fly
Match: Appl (gene:FBgn0000108 transcript:FBtr0307291)

HSP 1 Score: 95.5153 bits (236), Expect = 5.328e-20
Identity = 62/220 (28.18%), Postives = 102/220 (46.36%), Query Frame = 3
Query:   81 YLVLVKFSISLIVASSNDDLQVAFYCG-----RPANVFRNKVWTLDFQQ-----DCLTNETKIVEFCQKSFPQWKILTSEPAVEKSKFKSWC---DFKNQSCEVNVE-IRPFKCLDKNFQSDALILPRNCQFGHLFNETGCLLYKHWVKNAKEECIRKNNWHIKSYGMLFPCSINDNKIKPMFFKGVEFVCCPNQEFKS----VDNSDLS-MYKTYLNNA 683
            ++VL   +  +  AS   + Q+A  C      +P  +     W  D  +      CL ++  ++++C+K++P   I     +    K   WC         C+ +   I+PF+CL   FQSDAL++P  C F H+ N + C  +  W +     C ++    ++S+ ML PC I+        F GVEFVCCP + FK+    V  +DL  M    +N+A
Sbjct:   15 WVVLAIGTAQVQAASPRWEPQIAVLCEAGQIYQPQYLSEEGRWVTDLSKKTTGPTCLRDKMDLLDYCKKAYPNRDITNIVESSHYQKIGGWCRQGALNAAKCKGSHRWIKPFRCLGP-FQSDALLVPEGCLFDHIHNASRCWPFVRWNQTGAAAC-QERGMQMRSFAMLLPCGIS-------VFSGVEFVCCP-KHFKTDEIHVKKTDLPVMPAAQINSA 224          
BLAST of Beta-amyloid-like protein vs. Ensembl Zebrafish
Match: appb (amyloid beta (A4) precursor protein b [Source:ZFIN;Acc:ZDB-GENE-020220-1])

HSP 1 Score: 108.997 bits (271), Expect = 2.948e-24
Identity = 68/202 (33.66%), Postives = 100/202 (49.50%), Query Frame = 3
Query:   66 NCLILYLVLVKFSISLIVASSNDDLQVAFYCGR---PANVFRNKVWTLD--FQQDCLTNETKIVEFCQKSFPQWKILTSEPAVEKSKFKSWCDFKNQSCEVNVEIR-PFKCLDKNFQSDALILPRNCQFGHLFNETGCLLYKHWVKNAKEECI-RKNNWHIKSYGMLFPCSINDNKIKPMFFKGVEFVCCPNQEFKSVDNSD 650
            N  I  LV    S+ L+      + QVA +CG+     NV   K W  D    + C++ +  I+++CQ+ +P  +I     A +    ++WC    + C  +  I  P++CL   F SDAL++P  C+F H      C  + HW   AKE C  R  N H   YGML PC I+        F+GVEFVCCP +E K +D+ +
Sbjct:    4 NKTIFLLVPSDDSVGLLA-----EPQVAMFCGKLNMHINVQSGK-WEPDPTGTKSCISTKEGILQYCQEVYPDLQITNVVEANQPVSIQNWCKMGRRQCRSHTHIVVPYRCLVGEFVSDALLVPDKCKFLHQERMDMCESHLHWHTVAKESCGDRSMNLH--DYGMLLPCGID-------RFRGVEFVCCPMEEQKDLDSEE 190          
BLAST of Beta-amyloid-like protein vs. Ensembl Zebrafish
Match: appb (amyloid beta (A4) precursor protein b [Source:ZFIN;Acc:ZDB-GENE-020220-1])

HSP 1 Score: 107.457 bits (267), Expect = 8.748e-24
Identity = 68/202 (33.66%), Postives = 100/202 (49.50%), Query Frame = 3
Query:   66 NCLILYLVLVKFSISLIVASSNDDLQVAFYCGR---PANVFRNKVWTLD--FQQDCLTNETKIVEFCQKSFPQWKILTSEPAVEKSKFKSWCDFKNQSCEVNVEIR-PFKCLDKNFQSDALILPRNCQFGHLFNETGCLLYKHWVKNAKEECI-RKNNWHIKSYGMLFPCSINDNKIKPMFFKGVEFVCCPNQEFKSVDNSD 650
            N  I  LV    S+ L+      + QVA +CG+     NV   K W  D    + C++ +  I+++CQ+ +P  +I     A +    ++WC    + C  +  I  P++CL   F SDAL++P  C+F H      C  + HW   AKE C  R  N H   YGML PC I+        F+GVEFVCCP +E K +D+ +
Sbjct:    4 NKTIFLLVPSDDSVGLLA-----EPQVAMFCGKLNMHINVQSGK-WEPDPTGTKSCISTKEGILQYCQEVYPDLQITNVVEANQPVSIQNWCKMGRRQCRSHTHIVVPYRCLVGEFVSDALLVPDKCKFLHQERMDMCESHLHWHTVAKESCGDRSMNLH--DYGMLLPCGIDR-------FRGVEFVCCPMEEQKDLDSEE 190          
BLAST of Beta-amyloid-like protein vs. Ensembl Zebrafish
Match: appb (amyloid beta (A4) precursor protein b [Source:ZFIN;Acc:ZDB-GENE-020220-1])

HSP 1 Score: 107.071 bits (266), Expect = 1.220e-23
Identity = 62/177 (35.03%), Postives = 91/177 (51.41%), Query Frame = 3
Query:  141 QVAFYCGR---PANVFRNKVWTLD--FQQDCLTNETKIVEFCQKSFPQWKILTSEPAVEKSKFKSWCDFKNQSCEVNVEIR-PFKCLDKNFQSDALILPRNCQFGHLFNETGCLLYKHWVKNAKEECI-RKNNWHIKSYGMLFPCSINDNKIKPMFFKGVEFVCCPNQEFKSVDNSD 650
            QVA +CG+     NV   K W  D    + C++ +  I+++CQ+ +P  +I     A +    ++WC    + C  +  I  P++CL   F SDAL++P  C+F H      C  + HW   AKE C  R  N H   YGML PC I+        F+GVEFVCCP +E K +D+ +
Sbjct:   35 QVAMFCGKLNMHINVQSGK-WEPDPTGTKSCISTKEGILQYCQEVYPDLQITNVVEANQPVSIQNWCKMGRRQCRSHTHIVVPYRCLVGEFVSDALLVPDKCKFLHQERMDMCESHLHWHTVAKESCGDRSMNLH--DYGMLLPCGID-------RFRGVEFVCCPMEEQKDLDSEE 201          
BLAST of Beta-amyloid-like protein vs. Ensembl Zebrafish
Match: appb (amyloid beta (A4) precursor protein b [Source:ZFIN;Acc:ZDB-GENE-020220-1])

HSP 1 Score: 105.916 bits (263), Expect = 2.572e-23
Identity = 62/177 (35.03%), Postives = 91/177 (51.41%), Query Frame = 3
Query:  141 QVAFYCGR---PANVFRNKVWTLD--FQQDCLTNETKIVEFCQKSFPQWKILTSEPAVEKSKFKSWCDFKNQSCEVNVEIR-PFKCLDKNFQSDALILPRNCQFGHLFNETGCLLYKHWVKNAKEECI-RKNNWHIKSYGMLFPCSINDNKIKPMFFKGVEFVCCPNQEFKSVDNSD 650
            QVA +CG+     NV   K W  D    + C++ +  I+++CQ+ +P  +I     A +    ++WC    + C  +  I  P++CL   F SDAL++P  C+F H      C  + HW   AKE C  R  N H   YGML PC I+        F+GVEFVCCP +E K +D+ +
Sbjct:   35 QVAMFCGKLNMHINVQSGK-WEPDPTGTKSCISTKEGILQYCQEVYPDLQITNVVEANQPVSIQNWCKMGRRQCRSHTHIVVPYRCLVGEFVSDALLVPDKCKFLHQERMDMCESHLHWHTVAKESCGDRSMNLH--DYGMLLPCGID-------RFRGVEFVCCPMEEQKDLDSEE 201          
BLAST of Beta-amyloid-like protein vs. Ensembl Zebrafish
Match: appb (amyloid beta (A4) precursor protein b [Source:ZFIN;Acc:ZDB-GENE-020220-1])

HSP 1 Score: 105.916 bits (263), Expect = 2.992e-23
Identity = 62/177 (35.03%), Postives = 91/177 (51.41%), Query Frame = 3
Query:  141 QVAFYCGR---PANVFRNKVWTLD--FQQDCLTNETKIVEFCQKSFPQWKILTSEPAVEKSKFKSWCDFKNQSCEVNVEIR-PFKCLDKNFQSDALILPRNCQFGHLFNETGCLLYKHWVKNAKEECI-RKNNWHIKSYGMLFPCSINDNKIKPMFFKGVEFVCCPNQEFKSVDNSD 650
            QVA +CG+     NV   K W  D    + C++ +  I+++CQ+ +P  +I     A +    ++WC    + C  +  I  P++CL   F SDAL++P  C+F H      C  + HW   AKE C  R  N H   YGML PC I+        F+GVEFVCCP +E K +D+ +
Sbjct:   23 QVAMFCGKLNMHINVQSGK-WEPDPTGTKSCISTKEGILQYCQEVYPDLQITNVVEANQPVSIQNWCKMGRRQCRSHTHIVVPYRCLVGEFVSDALLVPDKCKFLHQERMDMCESHLHWHTVAKESCGDRSMNLH--DYGMLLPCGID-------RFRGVEFVCCPMEEQKDLDSEE 189          
BLAST of Beta-amyloid-like protein vs. Ensembl Xenopus
Match: gtf2e2 (general transcription factor IIE subunit 2 [Source:Xenbase;Acc:XB-GENE-962385])

HSP 1 Score: 103.605 bits (257), Expect = 2.376e-22
Identity = 60/183 (32.79%), Postives = 91/183 (49.73%), Query Frame = 3
Query:  108 SLIVASSNDDL----QVAFYCGR---PANVFRNKVWTLDFQ--QDCLTNETKIVEFCQKSFPQWKILTSEPAVEKSKFKSWCDFKNQSCEVNVEIR-PFKCLDKNFQSDALILPRNCQFGHLFNETGCLLYKHWVKNAKEECIRKNNWHIKSYGMLFPCSINDNKIKPMFFKGVEFVCCPNQE 626
            +L+ A  N  L    Q+A +CG+     NV +N  W  D    + C+  +  I+++CQ  +P+ +I     A +    ++WC    + C+    I  P++CL   F SDAL++P  C+F H      C  + HW   AKE C  K +  +  YGML PC I+        F+GVEFVCCP  +
Sbjct:   17 ALVPADGNAGLLAEPQIAMFCGKLNMHMNV-QNGKWETDVSGTKGCIGTKEGILQYCQDVYPELQITNVVEANQPVTIQNWCKRGRKQCKSRTHIVVPYRCLVGEFVSDALLVPDKCKFLHQERMDICETHLHWHTVAKESCSEK-SMSLHEYGMLLPCGIDK-------FRGVEFVCCPTAD 190          
BLAST of Beta-amyloid-like protein vs. Ensembl Xenopus
Match: gtf2e2 (general transcription factor IIE subunit 2 [Source:Xenbase;Acc:XB-GENE-962385])

HSP 1 Score: 103.605 bits (257), Expect = 2.429e-22
Identity = 60/183 (32.79%), Postives = 91/183 (49.73%), Query Frame = 3
Query:  108 SLIVASSNDDL----QVAFYCGR---PANVFRNKVWTLDFQ--QDCLTNETKIVEFCQKSFPQWKILTSEPAVEKSKFKSWCDFKNQSCEVNVEIR-PFKCLDKNFQSDALILPRNCQFGHLFNETGCLLYKHWVKNAKEECIRKNNWHIKSYGMLFPCSINDNKIKPMFFKGVEFVCCPNQE 626
            +L+ A  N  L    Q+A +CG+     NV +N  W  D    + C+  +  I+++CQ  +P+ +I     A +    ++WC    + C+    I  P++CL   F SDAL++P  C+F H      C  + HW   AKE C  K +  +  YGML PC I+        F+GVEFVCCP  +
Sbjct:   17 ALVPADGNAGLLAEPQIAMFCGKLNMHMNV-QNGKWETDVSGTKGCIGTKEGILQYCQDVYPELQITNVVEANQPVTIQNWCKRGRKQCKSRTHIVVPYRCLVGEFVSDALLVPDKCKFLHQERMDICETHLHWHTVAKESCSEK-SMSLHEYGMLLPCGIDK-------FRGVEFVCCPTAD 190          
BLAST of Beta-amyloid-like protein vs. Ensembl Xenopus
Match: gtf2e2 (general transcription factor IIE subunit 2 [Source:Xenbase;Acc:XB-GENE-962385])

HSP 1 Score: 103.219 bits (256), Expect = 2.544e-22
Identity = 60/183 (32.79%), Postives = 91/183 (49.73%), Query Frame = 3
Query:  108 SLIVASSNDDL----QVAFYCGR---PANVFRNKVWTLDFQ--QDCLTNETKIVEFCQKSFPQWKILTSEPAVEKSKFKSWCDFKNQSCEVNVEIR-PFKCLDKNFQSDALILPRNCQFGHLFNETGCLLYKHWVKNAKEECIRKNNWHIKSYGMLFPCSINDNKIKPMFFKGVEFVCCPNQE 626
            +L+ A  N  L    Q+A +CG+     NV +N  W  D    + C+  +  I+++CQ  +P+ +I     A +    ++WC    + C+    I  P++CL   F SDAL++P  C+F H      C  + HW   AKE C  K +  +  YGML PC I+        F+GVEFVCCP  +
Sbjct:   17 ALVPADGNAGLLAEPQIAMFCGKLNMHMNV-QNGKWETDVSGTKGCIGTKEGILQYCQDVYPELQITNVVEANQPVTIQNWCKRGRKQCKSRTHIVVPYRCLVGEFVSDALLVPDKCKFLHQERMDICETHLHWHTVAKESCSEK-SMSLHEYGMLLPCGIDK-------FRGVEFVCCPTAD 190          
BLAST of Beta-amyloid-like protein vs. Ensembl Xenopus
Match: gtf2e2 (general transcription factor IIE subunit 2 [Source:Xenbase;Acc:XB-GENE-962385])

HSP 1 Score: 103.219 bits (256), Expect = 2.925e-22
Identity = 60/183 (32.79%), Postives = 91/183 (49.73%), Query Frame = 3
Query:  108 SLIVASSNDDL----QVAFYCGR---PANVFRNKVWTLDFQ--QDCLTNETKIVEFCQKSFPQWKILTSEPAVEKSKFKSWCDFKNQSCEVNVEIR-PFKCLDKNFQSDALILPRNCQFGHLFNETGCLLYKHWVKNAKEECIRKNNWHIKSYGMLFPCSINDNKIKPMFFKGVEFVCCPNQE 626
            +L+ A  N  L    Q+A +CG+     NV +N  W  D    + C+  +  I+++CQ  +P+ +I     A +    ++WC    + C+    I  P++CL   F SDAL++P  C+F H      C  + HW   AKE C  K +  +  YGML PC I+        F+GVEFVCCP  +
Sbjct:   17 ALVPADGNAGLLAEPQIAMFCGKLNMHMNV-QNGKWETDVSGTKGCIGTKEGILQYCQDVYPELQITNVVEANQPVTIQNWCKRGRKQCKSRTHIVVPYRCLVGEFVSDALLVPDKCKFLHQERMDICETHLHWHTVAKESCSEK-SMSLHEYGMLLPCGIDK-------FRGVEFVCCPTAD 190          
BLAST of Beta-amyloid-like protein vs. Ensembl Xenopus
Match: gtf2e2 (general transcription factor IIE subunit 2 [Source:Xenbase;Acc:XB-GENE-962385])

HSP 1 Score: 102.834 bits (255), Expect = 3.663e-22
Identity = 59/195 (30.26%), Postives = 96/195 (49.23%), Query Frame = 3
Query:   72 LILYLVLVKFSISLIVASSNDDL----QVAFYCGR---PANVFRNKVWTLDFQ--QDCLTNETKIVEFCQKSFPQWKILTSEPAVEKSKFKSWCDFKNQSCEVNVEIR-PFKCLDKNFQSDALILPRNCQFGHLFNETGCLLYKHWVKNAKEECIRKNNWHIKSYGMLFPCSINDNKIKPMFFKGVEFVCCPNQE 626
            +++  + +   ++ + A  N  L    Q+A +CG+     NV +N  W  D    + C+  +  I+++CQ  +P+ +I     A +    ++WC    + C+    I  P++CL   F SDAL++P  C+F H      C  + HW   AKE C  K +  +  YGML PC I+        F+GVEFVCCP  +
Sbjct:   17 VMIGWISISPPLTCVPADGNAGLLAEPQIAMFCGKLNMHMNV-QNGKWETDVSGTKGCIGTKEGILQYCQDVYPELQITNVVEANQPVTIQNWCKRGRKQCKSRTHIVVPYRCLVGEFVSDALLVPDKCKFLHQERMDICETHLHWHTVAKESCSEK-SMSLHEYGMLLPCGIDK-------FRGVEFVCCPTAD 202          
BLAST of Beta-amyloid-like protein vs. Ensembl Mouse
Match: App (amyloid beta (A4) precursor protein [Source:MGI Symbol;Acc:MGI:88059])

HSP 1 Score: 108.227 bits (269), Expect = 5.607e-24
Identity = 61/177 (34.46%), Postives = 95/177 (53.67%), Query Frame = 3
Query:  141 QVAFYCGR---PANVFRNKVWTLD--FQQDCLTNETKIVEFCQKSFPQWKILTSEPAVEKSKFKSWCDFKNQSCEVNVEIR-PFKCLDKNFQSDALILPRNCQFGHLFNETGCLLYKHWVKNAKEECIRKNNWHIKSYGMLFPCSINDNKIKPMFFKGVEFVCCP-NQEFKSVDNSD 650
            Q+A +CG+     NV +N  W  D    + C+  +  I+++CQ+ +P+ +I     A +    ++WC    + C+ +  I  P++CL   F SDAL++P  C+F H      C  + HW   AKE C  K+  ++  YGML PC I+        F+GVEFVCCP  +E  SVD++D
Sbjct:   33 QIAMFCGKLNMHMNV-QNGKWESDPSGTKTCIGTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHTHIVIPYRCLVGEFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKST-NLHDYGMLLPCGIDK-------FRGVEFVCCPLAEESDSVDSAD 200          
BLAST of Beta-amyloid-like protein vs. Ensembl Mouse
Match: App (amyloid beta (A4) precursor protein [Source:MGI Symbol;Acc:MGI:88059])

HSP 1 Score: 107.457 bits (267), Expect = 1.127e-23
Identity = 61/177 (34.46%), Postives = 95/177 (53.67%), Query Frame = 3
Query:  141 QVAFYCGR---PANVFRNKVWTLD--FQQDCLTNETKIVEFCQKSFPQWKILTSEPAVEKSKFKSWCDFKNQSCEVNVEIR-PFKCLDKNFQSDALILPRNCQFGHLFNETGCLLYKHWVKNAKEECIRKNNWHIKSYGMLFPCSINDNKIKPMFFKGVEFVCCP-NQEFKSVDNSD 650
            Q+A +CG+     NV +N  W  D    + C+  +  I+++CQ+ +P+ +I     A +    ++WC    + C+ +  I  P++CL   F SDAL++P  C+F H      C  + HW   AKE C  K+  ++  YGML PC I+        F+GVEFVCCP  +E  SVD++D
Sbjct:   33 QIAMFCGKLNMHMNV-QNGKWESDPSGTKTCIGTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHTHIVIPYRCLVGEFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKST-NLHDYGMLLPCGIDK-------FRGVEFVCCPLAEESDSVDSAD 200          
BLAST of Beta-amyloid-like protein vs. Ensembl Mouse
Match: App (amyloid beta (A4) precursor protein [Source:MGI Symbol;Acc:MGI:88059])

HSP 1 Score: 107.071 bits (266), Expect = 1.142e-23
Identity = 61/177 (34.46%), Postives = 95/177 (53.67%), Query Frame = 3
Query:  141 QVAFYCGR---PANVFRNKVWTLD--FQQDCLTNETKIVEFCQKSFPQWKILTSEPAVEKSKFKSWCDFKNQSCEVNVEIR-PFKCLDKNFQSDALILPRNCQFGHLFNETGCLLYKHWVKNAKEECIRKNNWHIKSYGMLFPCSINDNKIKPMFFKGVEFVCCP-NQEFKSVDNSD 650
            Q+A +CG+     NV +N  W  D    + C+  +  I+++CQ+ +P+ +I     A +    ++WC    + C+ +  I  P++CL   F SDAL++P  C+F H      C  + HW   AKE C  K+  ++  YGML PC I+        F+GVEFVCCP  +E  SVD++D
Sbjct:   33 QIAMFCGKLNMHMNV-QNGKWESDPSGTKTCIGTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHTHIVIPYRCLVGEFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKST-NLHDYGMLLPCGIDK-------FRGVEFVCCPLAEESDSVDSAD 200          
BLAST of Beta-amyloid-like protein vs. Ensembl Mouse
Match: App (amyloid beta (A4) precursor protein [Source:MGI Symbol;Acc:MGI:88059])

HSP 1 Score: 107.071 bits (266), Expect = 1.190e-23
Identity = 61/177 (34.46%), Postives = 95/177 (53.67%), Query Frame = 3
Query:  141 QVAFYCGR---PANVFRNKVWTLD--FQQDCLTNETKIVEFCQKSFPQWKILTSEPAVEKSKFKSWCDFKNQSCEVNVEIR-PFKCLDKNFQSDALILPRNCQFGHLFNETGCLLYKHWVKNAKEECIRKNNWHIKSYGMLFPCSINDNKIKPMFFKGVEFVCCP-NQEFKSVDNSD 650
            Q+A +CG+     NV +N  W  D    + C+  +  I+++CQ+ +P+ +I     A +    ++WC    + C+ +  I  P++CL   F SDAL++P  C+F H      C  + HW   AKE C  K+  ++  YGML PC I+        F+GVEFVCCP  +E  SVD++D
Sbjct:   33 QIAMFCGKLNMHMNV-QNGKWESDPSGTKTCIGTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHTHIVIPYRCLVGEFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKST-NLHDYGMLLPCGIDK-------FRGVEFVCCPLAEESDSVDSAD 200          
BLAST of Beta-amyloid-like protein vs. Ensembl Mouse
Match: App (amyloid beta (A4) precursor protein [Source:MGI Symbol;Acc:MGI:88059])

HSP 1 Score: 107.071 bits (266), Expect = 1.236e-23
Identity = 61/177 (34.46%), Postives = 95/177 (53.67%), Query Frame = 3
Query:  141 QVAFYCGR---PANVFRNKVWTLD--FQQDCLTNETKIVEFCQKSFPQWKILTSEPAVEKSKFKSWCDFKNQSCEVNVEIR-PFKCLDKNFQSDALILPRNCQFGHLFNETGCLLYKHWVKNAKEECIRKNNWHIKSYGMLFPCSINDNKIKPMFFKGVEFVCCP-NQEFKSVDNSD 650
            Q+A +CG+     NV +N  W  D    + C+  +  I+++CQ+ +P+ +I     A +    ++WC    + C+ +  I  P++CL   F SDAL++P  C+F H      C  + HW   AKE C  K+  ++  YGML PC I+        F+GVEFVCCP  +E  SVD++D
Sbjct:   33 QIAMFCGKLNMHMNV-QNGKWESDPSGTKTCIGTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHTHIVIPYRCLVGEFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKST-NLHDYGMLLPCGIDK-------FRGVEFVCCPLAEESDSVDSAD 200          
BLAST of Beta-amyloid-like protein vs. UniProt/SwissProt
Match: sp|Q06BR2|A4_DORPE (Amyloid-beta precursor-like protein OS=Doryteuthis pealeii OX=1051067 PE=1 SV=2)

HSP 1 Score: 110.153 bits (274), Expect = 7.381e-24
Identity = 95/407 (23.34%), Postives = 177/407 (43.49%), Query Frame = 3
Query:   72 LILYLVLVKFSISLIVASSNDDLQVAFYCGRPANVFRNKVWTLD--FQQDCLTNETKIVEFCQKSFPQWKILTSEPAVEKSKFKSWCDFKNQSCE--VNVEIRPFKCLDKNFQSDALILPRNCQFGHLFNETGCLLYKHWVKNAKEECIRKNNWHIKSYGMLFPCSINDNKIKPMFFKGVEFVCCP--------------NQEFKSVDNSDLSMYKTYL--NNAVLDTEQGEQKFYEDAEKNLIKSEYEKEAEIINXXXXXXXXXXXXXXXDPEFAKKKEEDFLKGFKTQMNSIQTQFQENKEQLLNFHDNRLEFIFNTKFESAKRNLXXXXXXXXXXXXEIFEAMKIILKALMDRKKYLMAEFEEAKRFNSKTA----DAMYIRMELVDKLISDLFDTLKQVPNYE 1220
            L++ + L   + S+ V S   +  VAF C +PA       W  D    + C+    +I+E+C+K +P   I     A  K    +WC F    C    N  +RPF+CL   FQS+AL++P +C F H  +   C  +    + A  +C  +     +S+ ML+PC       +P  F GVEFVCCP              +    +   + L  Y  YL  ++  +     E + ++ AEK + + + E++ +++ + K +   +    K+DP+ A +  ++  + ++   ++ + +    K+QL+N H   ++   N + +     L   +        +I +A    +K     K +    F+  +  + + A    D +   + L+D  I  + D LK+ P  E
Sbjct:   10 LVVVIGLQFVAASMEVNSRKFEPMVAFICNKPAMHRVPSGWVPDDDPAKSCVKQPEEILEYCKKLYPDHDITNVLQASYKVTIPNWCGFNVTHCHKHGNHTVRPFRCLVGPFQSEALLVPEHCIFDHYHDPRVCNEFDQCNETAMSKCSAR-GMTTQSFAMLWPCQ------EPGHFSGVEFVCCPKVSLIPESTEAPKSSPPTPAKTENGLDDYTAYLKGDSKYMSKYANEHERFKAAEKVMQQFQRERDTKMMKDWKAARDSVREKKKTDPKKAMELNKELTERYQKIYHAYEQESIAEKKQLVNTHQQHIQSWLNNRKQVLMEKLQDALLAKPPKKSKIEKAATAYIKVEEKDKMHTYNHFQHLRDTDPEDAANIQDRVLEHLNLIDDRIRRVLDWLKRDPEIE 409          
BLAST of Beta-amyloid-like protein vs. UniProt/SwissProt
Match: sp|P12023|A4_MOUSE (Amyloid-beta A4 protein OS=Mus musculus OX=10090 GN=App PE=1 SV=3)

HSP 1 Score: 107.071 bits (266), Expect = 8.644e-23
Identity = 61/177 (34.46%), Postives = 95/177 (53.67%), Query Frame = 3
Query:  141 QVAFYCGR---PANVFRNKVWTLD--FQQDCLTNETKIVEFCQKSFPQWKILTSEPAVEKSKFKSWCDFKNQSCEVNVEIR-PFKCLDKNFQSDALILPRNCQFGHLFNETGCLLYKHWVKNAKEECIRKNNWHIKSYGMLFPCSINDNKIKPMFFKGVEFVCCP-NQEFKSVDNSD 650
            Q+A +CG+     NV +N  W  D    + C+  +  I+++CQ+ +P+ +I     A +    ++WC    + C+ +  I  P++CL   F SDAL++P  C+F H      C  + HW   AKE C  K+  ++  YGML PC I+        F+GVEFVCCP  +E  SVD++D
Sbjct:   33 QIAMFCGKLNMHMNV-QNGKWESDPSGTKTCIGTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHTHIVIPYRCLVGEFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKST-NLHDYGMLLPCGIDK-------FRGVEFVCCPLAEESDSVDSAD 200          
BLAST of Beta-amyloid-like protein vs. UniProt/SwissProt
Match: sp|P08592|A4_RAT (Amyloid-beta A4 protein OS=Rattus norvegicus OX=10116 GN=App PE=1 SV=2)

HSP 1 Score: 106.686 bits (265), Expect = 1.261e-22
Identity = 60/177 (33.90%), Postives = 95/177 (53.67%), Query Frame = 3
Query:  141 QVAFYCGR---PANVFRNKVWTLD--FQQDCLTNETKIVEFCQKSFPQWKILTSEPAVEKSKFKSWCDFKNQSCEVNVEIR-PFKCLDKNFQSDALILPRNCQFGHLFNETGCLLYKHWVKNAKEECIRKNNWHIKSYGMLFPCSINDNKIKPMFFKGVEFVCCP-NQEFKSVDNSD 650
            Q+A +CG+     NV +N  W  D    + C+  +  I+++CQ+ +P+ +I     A +    ++WC    + C+ +  I  P++CL   F SDAL++P  C+F H      C  + HW   AKE C  K+  ++  YGML PC I+        F+GVEFVCCP  +E  S+D++D
Sbjct:   33 QIAMFCGKLNMHMNV-QNGKWESDPSGTKTCIGTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHTHIVIPYRCLVGEFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKST-NLHDYGMLLPCGIDK-------FRGVEFVCCPLAEESDSIDSAD 200          
BLAST of Beta-amyloid-like protein vs. UniProt/SwissProt
Match: sp|O73683|A4_TETFL (Amyloid-beta A4 protein OS=Tetraodon fluviatilis OX=47145 GN=app PE=2 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 1.362e-22
Identity = 65/206 (31.55%), Postives = 103/206 (50.00%), Query Frame = 3
Query:   75 ILYLVLVKFSISLIVASSND-------DLQVAFYCGR---PANVFRNKVWTLD--FQQDCLTNETKIVEFCQKSFPQWKILTSEPAVEKSKFKSWCDFKNQSCEVNVEIR-PFKCLDKNFQSDALILPRNCQFGHLFNETGCLLYKHWVKNAKEECI-RKNNWHIKSYGMLFPCSINDNKIKPMFFKGVEFVCCPNQEFKSVDNSD 650
            + +L+LV  + +L      D       + QVA +CG+     NV   K W  D    + C+  +  I+++CQ+ +P+ +I     A +    ++WC    + C  ++ I  P++CL   F SDAL++P  C+F H      C  + HW   AKE C  R  N H   YGML PC I+        F+GVEFVCCP +  + +D+++
Sbjct:    5 VAWLLLVAAASTLAAEVPTDVSMGLLAEPQVAMFCGKINMHINVQSGK-WEPDPSGTKSCIGTKEGILQYCQEVYPELQITNVVEANQPVSIQNWCKKGRKQCRSHMHIVVPYRCLVGEFVSDALLVPDKCKFLHQERMNQCESHLHWHTVAKESCGDRAMNLH--DYGMLLPCGID-------RFRGVEFVCCPAEAERDMDSTE 200          
BLAST of Beta-amyloid-like protein vs. UniProt/SwissProt
Match: sp|P79307|A4_PIG (Amyloid-beta A4 protein OS=Sus scrofa OX=9823 GN=APP PE=2 SV=2)

HSP 1 Score: 105.916 bits (263), Expect = 2.194e-22
Identity = 60/177 (33.90%), Postives = 95/177 (53.67%), Query Frame = 3
Query:  141 QVAFYCGR---PANVFRNKVWTLD--FQQDCLTNETKIVEFCQKSFPQWKILTSEPAVEKSKFKSWCDFKNQSCEVNVEIR-PFKCLDKNFQSDALILPRNCQFGHLFNETGCLLYKHWVKNAKEECIRKNNWHIKSYGMLFPCSINDNKIKPMFFKGVEFVCCP-NQEFKSVDNSD 650
            QVA +CG+     NV +N  W  D    + C+  +  I+++CQ+ +P+ +I     A +    ++WC    + C+ +  I  P++CL   F SDAL++P  C+F H      C  + HW   AKE C  K+  ++  YGML PC I+        F+GVEFVCCP  +E  ++D++D
Sbjct:   33 QVAMFCGKLNMHMNV-QNGKWESDPSGTKTCIGTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRSRKQCKTHTHIVIPYRCLVGEFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKST-NLHDYGMLLPCGIDK-------FRGVEFVCCPLAEESDNIDSAD 200          
BLAST of Beta-amyloid-like protein vs. TrEMBL
Match: R7TD28 (A4_EXTRA domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_220772 PE=4 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 9.988e-31
Identity = 109/474 (23.00%), Postives = 204/474 (43.04%), Query Frame = 3
Query:  144 VAFYCGRPANVFRN-KVWTLDFQQDCLTNETKIVEFCQKSFPQWKILTSEPAVEKSKFKSWCDFKNQSCEVN---VEIRPFKCLDKNFQSDALILPRNCQFGHLFNETGCLLYKHWVKNAKEECIRKNNWHIKSYGMLFPCSINDNKIKPMFFKGVEFVCCPNQEFKSVDNSDL---------------------------------------------SMYKTYLNNAVLDTEQGEQKFYEDAEKNLIKSEYEKEAEIINXXXXXXXXXXXXXXXDPEFAKKKEEDFLKGFKTQMNSIQTQFQENKEQLLNFHDNRLEFIFNTKFESAKRNLXXXXXXXXXXXXEIFEAMKIILKALMDRKKYLMA------EFEEAKRFNSKTADAMYIRMELVDKLISDLFDTLKQVPNYEFILKERLMNYFTTVYPRDGVPVNTKQSLYDKTERINIEDIIAKYKHHTKNINTDDSEFAV 1400
            VAF CGRPA   ++   W  D   DCL+   +I+++C+K +P   I     A +K++  SWC F ++ C        +RPF+C    FQS+AL++P +C F HL+    C  ++ W   A+  C +      +S+ +L PC I+        F GVEFVCCP++     D  D+                                             S+Y+ YL N V +    E +++  A+  L K  ++K  +++ E   + + +  L + DP+ A +  +D    F+T   +++ +    K+Q+   H  R+E   N K  +A ++    + +       + + +K  +K  M++K  L +        +   R      D +   ++ +D+ + +  D L +VP YE  ++ + M+ F  +Y    + V+    L  +   +++ED +        +I  D   + +
Sbjct:   12 VAFVCGRPAMFLKDDGSWQKDDSTDCLSKPEEILDYCRKVYPDLDIRNVVEASKKARVPSWCGFNHEKCSATKHTYTVRPFRCWVGAFQSEALLVPEHCLFDHLYQPKSCKSFQKWNATARSIC-QDRGMEQQSFAILQPCGID-------RFNGVEFVCCPSEVDAVKDEVDVFIQEELKADPPVAPTTSSPSSTTSTTEAPLIIEEEEPVEIVPAAKSVYQDYLAN-VNNQFDNEHEYFVKAKAGLQKHHHDKVTKMMKEWSDARQRVLELKEIDPKAADQLNQDITSRFQTTYEALEQEGNSEKQQISGVHQQRIEADLNNKKRNAMKHYMDELSRDYIEAPRLLKTLKHYIK--MEQKDRLHSINHYKHLLDTDPRMAETMRDQILDHLKTIDQHMREALDMLNRVPQYEKKIRMQ-MDDFMKMY--HSIDVSITGLLSQEISDLSVEDALMPDLSEPSSIGMDTKAYTM 471          
BLAST of Beta-amyloid-like protein vs. TrEMBL
Match: T2MFP9 (Amyloid-like protein 1 OS=Hydra vulgaris OX=6087 GN=APLP1 PE=2 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 1.937e-29
Identity = 120/475 (25.26%), Postives = 220/475 (46.32%), Query Frame = 3
Query:   72 LILYLVLVKFSISLIVASSNDDLQVAFYCGR-PANV-FRNKVWTLDFQ--QDCLTNETKIVEFCQKSFPQWKILTSEPAVEKSKFKSWCDFKNQSCEVNVEIRPFKCLDKNFQSDALILPRNCQFGHLFNETGCLLYKHWVKNAKEECIRKNNWHIKSYGMLFPCSINDNKIKPMFFKGVEFVCCPNQEFKS--------VDNSDLSMYKTYLNN----AVLDTEQGEQKFYEDAEKNLIKSEYEKEAEIINXXXXXXXXXXXXXXXDPEFAKKKEEDFLKGFKTQMNSIQTQFQENKEQLLNFHDNRLEFIFNTKFESAKRNLXX----XXXXXXXXXXEIFEAMKIILKALMDRKKYLMAEFEEAKRFNSKTADAMYIRMELVDKL--ISDLFDTLKQVPNYEFILKERL-MNYFTTVYPRDGVPVNTKQSLYDKTERINIEDIIAKYKHHTKNINTDDSEFAVHYDLGLNDP 1427
            +IL  ++    I ++ A++  + +VA  CG+ P  V      W  D      C  ++ ++  +CQK++P+  I     A    KFK+WC    Q C V   + PF+CL   +++DAL++P  C+F H+ +   CL +K W + A+ EC RK +  +K YG+L  C  +       +F GVEFVCCP ++ +S        V+  D S +K  + N      L+T+  ++  Y   +  +      + A +++E  ++E+    L   DP  A++K +  L+ F+  + +++ + +  K++L   H +      NT+    KR+        ++      ++I +A++  ++     + + +  FE  +  N K A+A+  R EL+  L  ++ + +    + NY   + E+      + + PR  VP     S + + E I IE+   KY    K  N       V  D   NDP
Sbjct:   10 VILTSIINGSIIDVLEATNGHEPRVAINCGKVPFYVDLETGSWIADSNGVAVCDADKDEVKRYCQKTYPKLNISNVVEANTAVKFKNWCQPGIQQCSVTKRVVPFRCLVNEYEADALMVPDGCKFDHIHDPELCLTHKEWRRQAQRECSRKYSMKLKDYGILLSCKTD-------YFTGVEFVCCPKKQDRSQKVASKPKVEEIDNSGFKAAIKNFQQYLPLETKGCDRSNYLTQQTAMEDRHRNQIAAVVDEWDEAERRYNKLKAQDPSAAEEKMKRTLEVFRQTLAALEQESKVEKDRLRAEHAD----CINTQIAKDKRDAMAGYLNAIEAKPANAEQILKAVRKFIQVCEHDRVHSLRHFEHVRNQNEKKAEAL--RGELLQHLKDLNKVVNESMALLNYLPEIAEKFGFTGGSVLKPRIDVPTEEDHS-HSRVEEI-IEEASKKYTRTEKPNNE-----RVPTDAIPNDP 464          
BLAST of Beta-amyloid-like protein vs. TrEMBL
Match: A0A1I7ZKG7 (A4_EXTRA domain-containing protein OS=Steinernema glaseri OX=37863 PE=4 SV=1)

HSP 1 Score: 130.954 bits (328), Expect = 7.397e-28
Identity = 112/469 (23.88%), Postives = 208/469 (44.35%), Query Frame = 3
Query:  144 VAFYCGRPANVFRNK------VWTLDFQQ--DCLTNETKIVEFCQKSFPQWKILTSEPAVEKSKFKSWCDFKNQSCEVNVEIRPFKCLDKNFQSDALILPRNCQFGHLFNETGCLLYKHWVKNAKEECIRKNN---WHIKSYGMLFPCSINDNKIKPMFFKGVEFVCCPNQEF---KSVDNSDLSMYKTYLNNAV----------------------------------------LDTEQGEQKFYEDAEKNLIKSEYEKEAEIINXXXXXXXXXXXXXXXDPEFAKKKEEDFLKGFKTQMNSIQTQFQENKEQLLNFHDNRLEFIFNTKFESAKRNLXXXXXXXXXXXXE--IFEAMKIILKA-------LMDRKKYLM-AEFEEAKRFNSKTADAMYIRMELVDKLISDLFDTLKQVPNYEFILKERLMNYFTTVYPRDGVPVNTKQSLYDKTERINIEDIIAKYKH 1358
            VAF CG     +RN+       WT D  +   CLT +  I+++C+K +P   I            + WC    +SC+    +RPF+C+   F+S+AL +   C+FGH+   + C  Y HW   AK+EC++K+      ++S+ ML PC ++        F+GVEFVCCP  +    K V  + ++  KT + +                                          +D E    KF E A+K L K    K A++INE     +  + +  SD + A+K + + +  F+  + S++ + +E ++Q+ + H+ R++   N K   A  +    +       ++  + + +K  ++A       +++R ++L+ ++ +EA+ F     D +  R+  +D  I+     L+  P+ E  ++   + ++   Y R+  P  + + L    E  N E +I  YK 
Sbjct:  115 VAFNCG-----YRNQYQDVDGAWTTDADRYATCLTGKLDILKYCRKVYPGQNITNIVEYSHDMTIEKWCKEDGKSCKFTHTVRPFRCVVGEFRSEALQVSHGCRFGHVNGRSFCKDYGHWQGVAKDECVKKSEPKPMKVQSFAMLEPCGLD-------MFRGVEFVCCPGDDTTKPKDVKENIVTSSKTPVKSIADDDEDDDDEDDDEDEDDYEEYDDDHDSVDQSLMQDAYFKEIDLENEHDKFRE-AQKRLDKKHRAKVAKVINEWTALMERYKKMKVSDAKGAEKFKAEMVARFRKTVASLEEENREQRKQIEDVHEERVQASLNEKKRQATHDYRSALALQVGKPNKHNVLKTLKAYIRAEEKDRTHMLNRYRHLLRSDQDEAETFK----DILLYRLRYIDLRINGTLAMLRDFPDLEKQVRPIAVEFWRE-YRRENTPEISSEELLKIGESGNNEKLINLYKQ 565          
BLAST of Beta-amyloid-like protein vs. TrEMBL
Match: A0A0B2UNW5 (Beta-amyloid-like protein OS=Toxocara canis OX=6265 GN=apl-1 PE=4 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 3.673e-27
Identity = 93/402 (23.13%), Postives = 188/402 (46.77%), Query Frame = 3
Query:  144 VAFYCGRPANVFRNK------VWTLDFQQ--DCLTNETKIVEFCQKSFPQWKILTSEPAVEKSKFKSWCDFKNQSCEVNVEIRPFKCLDKNFQSDALILPRNCQFGHLFNETGCLLYKHWVKNAKEECIRK----NNWHIKSYGMLFPCSINDNKIKPMFFKGVEFVCCPNQEFKSVDNSDL----SMYKTYLNNAVLDTEQGEQKFYEDAEKNLIKSEYEKEAEIINXXXXXXXXXXXXXXXDPEFAKKKEEDFLKGFKTQMNSIQTQFQENKEQLLNFHDNRLEFIFNTKFESAKRNLXXXXXXXXXXXXE--IFEAMKIILKALMDRKKYLMAEFEEAKRFNSKTADA----MYIRMELVDKLISDLFDTLKQVPNYEFILKERLMNYFTTVYPRDGVP 1283
            VAF CG     FRNK       W  D  +   C + +  I+++C+K++P+  I        ++K  SWC  + + C+    +RP++C+   F S+AL +P  C+FGH+ +   C  Y HW   A+++C  K        ++S+ +L PC ++        F GVEFVCCP+ +  + D+ +L    S    Y     +     E + +++AE+ L K    K  +++ E    E   + + ++D + A+  + +    F+  + S++ + +E K+Q+ + H+ R++   N K   A  +    +     T ++  + + +K  ++A    + +++  +    R +   A+A    +  R+  +D  I+     L+  P  E  ++   + +++  Y R+  P
Sbjct:   48 VAFECG-----FRNKFMGEDGTWVNDVNRYATCQSGKLDILKYCRKAYPKLDITNIVEYSHETKIGSWCREEGKPCKWTHTVRPYQCIVGEFHSEALQVPHGCRFGHVNDRQSCDDYSHWKDEARKQCQSKVAESKRMSVRSFAVLEPCGLD-------LFTGVEFVCCPSDDKSAEDDKELNPKSSTQDPYFK---ISDPANEHERFKEAEQRLDKKHRAKIDKVMREWSDLEARYKKMKQTDEKGAEAFKLEMTARFQKTVASLEEENKEQKKQIEDVHEERVQANLNEKKRQATHDYRAALAMQVGTTNKHNVLKTLKTYIRAEEKDRTHMLNRYRHLLRTDQAEAEAFKPILLHRLRYIDLRINGTLAMLRDFPELERQVRPIAIEFWSD-YRRENTP 433          
BLAST of Beta-amyloid-like protein vs. TrEMBL
Match: A0A1I7SQ53 (A4_EXTRA domain-containing protein OS=Bursaphelenchus xylophilus OX=6326 PE=4 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 2.507e-26
Identity = 109/467 (23.34%), Postives = 202/467 (43.25%), Query Frame = 3
Query:  144 VAFYCGRPANVFRNKVW--TLDFQQD------CLTNETKIVEFCQKSFPQWKILTSEPAVEKSKFKSWCDF-KNQSCEVNVEIRPFKCLDKNFQSDALILPRNCQFGHLFNETGCLLYKHWVKNAKEEC----IRKNNWHIK--SYGMLFPCSINDNKIKPMFFKGVEFVCCP------------------------------------------NQEFKSVDNSDLSMYKTYLNNAVLDTEQGEQKFYEDAEKNLIKSEYEKEAEIINXXXXXXXXXXXXXXXDPEFAKKKEEDFLKGFKTQMNSIQTQFQENKEQLLNFHDNRLEFIFNTKFESAKRN--LXXXXXXXXXXXXEIFEAMKIILKALMDRKKYLMAEFEEAKRFNSKTADA----MYIRMELVDKLISDLFDTLKQVPNYEFILKERLMNYFTTVYPRDGVPVNTKQSLYDKTERINIEDIIAKYK 1355
            VAF CG     +RNK    + ++Q D      CL  +  I+++C++ +P  KI         S+   WCD    + C+ +  IRP++CL+  F +D+L +P  C+FGH+     C  ++ W +  +++C      K +  +K  S+G+L PC ++        F+GVE+VCCP                                          N E K VD  D      Y N    D E  E + Y+DA++ L K    K  ++INE  +  +   ++ + DP  A+K +++    F+  + +++ + ++ + QL   HD R++   N +   A  +  +   ++   K   ++ + +K  ++A    + Y++  +    R NS++A A    +  R+  +D  I+     L+  P+ E  L+  +   F   Y ++  P   +  + D       E +I  YK
Sbjct:   44 VAFKCG-----YRNKYLNESGEWQSDPSSVATCLQGKLDILKYCKRVYPDKKITNIVEYGHISQIPRWCDEDTGRHCQKSFYIRPYRCLEGEFTADSLQVPSRCKFGHVSGRETCEDFRQWRQKGEKQCETSVDEKTDKPMKLHSFGLLEPCGLS-------LFRGVEYVCCPKDVEDKYVESHIEEDIQSYNLDDDEEDEDDDDDDDEDDEETSNSETKDVDGQD-----PYYNE---DPEADEHERYKDAQERLEKKHRGKVTKVINEWSQLFERYNTMKEKDPNQAEKFKDEMTNKFRKTVAALENENKDQRRQLEQVHDERVQNTLNERKRKATHDYRMALALQVGHKNKKQVLKTLKDYIRAEEKDRAYMLHRYRHLLRSNSESAQAYEPMLLHRLRYIDLRINGTLAMLRDFPDLERQLRP-IAEEFWREYRKENTPDAEEHKIVDSPAADANEKLIKFYK 489          
BLAST of Beta-amyloid-like protein vs. Ensembl Cavefish
Match: ENSAMXT00000015571.2 (pep primary_assembly:Astyanax_mexicanus-2.0:12:31369849:31402293:1 gene:ENSAMXG00000015133.2 transcript:ENSAMXT00000015571.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 108.997 bits (271), Expect = 1.656e-24
Identity = 59/177 (33.33%), Postives = 94/177 (53.11%), Query Frame = 3
Query:  141 QVAFYCGRPANV---FRNKVWTLD--FQQDCLTNETKIVEFCQKSFPQWKILTSEPAVEKSKFKSWCDFKNQSCEVNVEIR-PFKCLDKNFQSDALILPRNCQFGHLFNETGCLLYKHWVKNAKEECIRKNNWHIKSYGMLFPCSINDNKIKPMFFKGVEFVCCPNQEFKSVDNSDL 653
            QVA +CG+  N+    +N  W LD    + C+  +  I+++CQ+ +P+ +I     A +    ++WC    + C  +V I  P++CL   F SDAL++P  C+F H      C  + HW   AKE C   +  ++  YGML PC I+        F+GVEFVCCP +  +  D++D+
Sbjct:   27 QVAMFCGK-LNMHINVQNGKWELDPSGTKGCIGTKEGILQYCQEVYPELQITNVVEANQPVSIQNWCKKGRKQCRSHVHIVVPYRCLVGEFVSDALLVPDKCKFLHQERMDICESHLHWHTVAKESC-GDHTMNLHDYGMLLPCGID-------RFRGVEFVCCPAETERETDSADM 194          
BLAST of Beta-amyloid-like protein vs. Ensembl Cavefish
Match: appb (amyloid beta A4 protein-like [Source:NCBI gene;Acc:103046668])

HSP 1 Score: 101.679 bits (252), Expect = 4.647e-22
Identity = 62/200 (31.00%), Postives = 98/200 (49.00%), Query Frame = 3
Query:   78 LYLVLVKFSISLIVASSNDDL------QVAFYCGRPANV---FRNKVWTLD--FQQDCLTNETKIVEFCQKSFPQWKILTSEPAVEKSKFKSWCDFKNQSCEVNVEIR-PFKCLDKNFQSDALILPRNCQFGHLFNETGCLLYKHWVKNAKEECIRKNNWHIKSYGMLFPCSINDNKIKPMFFKGVEFVCCPNQEFKSVD 641
            + L LV  S   +   S+D +      QVA +CG+  N+    ++  W  D    + C+  +  I+++CQ+ +P  +I     A +    ++WC    + C  +V I  P++CL   F SDAL++P  C+F H      C  + HW   AKE C      ++  +GML PC I+        F+GVEFVCCP +E +  D
Sbjct:    7 ILLFLVATSALAVEVPSDDSVGLLAEPQVAMFCGK-LNMHISVQSGKWESDPSGTKSCIGTKEGILQYCQEVYPDLQITNVVEANQPVSIQNWCKKGRRQCRSHVHIVVPYRCLVGEFVSDALLVPDKCKFLHQERMDMCESHLHWHTVAKESC-GDQTMNLHDFGMLLPCGID-------RFRGVEFVCCPVEEQRDSD 197          
BLAST of Beta-amyloid-like protein vs. Ensembl Cavefish
Match: appb (amyloid beta A4 protein-like [Source:NCBI gene;Acc:103046668])

HSP 1 Score: 100.908 bits (250), Expect = 1.028e-21
Identity = 62/200 (31.00%), Postives = 98/200 (49.00%), Query Frame = 3
Query:   78 LYLVLVKFSISLIVASSNDDL------QVAFYCGRPANV---FRNKVWTLD--FQQDCLTNETKIVEFCQKSFPQWKILTSEPAVEKSKFKSWCDFKNQSCEVNVEIR-PFKCLDKNFQSDALILPRNCQFGHLFNETGCLLYKHWVKNAKEECIRKNNWHIKSYGMLFPCSINDNKIKPMFFKGVEFVCCPNQEFKSVD 641
            + L LV  S   +   S+D +      QVA +CG+  N+    ++  W  D    + C+  +  I+++CQ+ +P  +I     A +    ++WC    + C  +V I  P++CL   F SDAL++P  C+F H      C  + HW   AKE C      ++  +GML PC I+        F+GVEFVCCP +E +  D
Sbjct:    7 ILLFLVATSALAVEVPSDDSVGLLAEPQVAMFCGK-LNMHISVQSGKWESDPSGTKSCIGTKEGILQYCQEVYPDLQITNVVEANQPVSIQNWCKKGRRQCRSHVHIVVPYRCLVGEFVSDALLVPDKCKFLHQERMDMCESHLHWHTVAKESC-GDQTMNLHDFGMLLPCGIDR-------FRGVEFVCCPVEEQRDSD 197          
BLAST of Beta-amyloid-like protein vs. Ensembl Cavefish
Match: appb (amyloid beta A4 protein-like [Source:NCBI gene;Acc:103046668])

HSP 1 Score: 100.523 bits (249), Expect = 1.072e-21
Identity = 62/200 (31.00%), Postives = 98/200 (49.00%), Query Frame = 3
Query:   78 LYLVLVKFSISLIVASSNDDL------QVAFYCGRPANV---FRNKVWTLD--FQQDCLTNETKIVEFCQKSFPQWKILTSEPAVEKSKFKSWCDFKNQSCEVNVEIR-PFKCLDKNFQSDALILPRNCQFGHLFNETGCLLYKHWVKNAKEECIRKNNWHIKSYGMLFPCSINDNKIKPMFFKGVEFVCCPNQEFKSVD 641
            + L LV  S   +   S+D +      QVA +CG+  N+    ++  W  D    + C+  +  I+++CQ+ +P  +I     A +    ++WC    + C  +V I  P++CL   F SDAL++P  C+F H      C  + HW   AKE C      ++  +GML PC I+        F+GVEFVCCP +E +  D
Sbjct:    7 ILLFLVATSALAVEVPSDDSVGLLAEPQVAMFCGK-LNMHISVQSGKWESDPSGTKSCIGTKEGILQYCQEVYPDLQITNVVEANQPVSIQNWCKKGRRQCRSHVHIVVPYRCLVGEFVSDALLVPDKCKFLHQERMDMCESHLHWHTVAKESC-GDQTMNLHDFGMLLPCGIDR-------FRGVEFVCCPVEEQRDSD 197          
BLAST of Beta-amyloid-like protein vs. Ensembl Cavefish
Match: appb (amyloid beta A4 protein-like [Source:NCBI gene;Acc:103046668])

HSP 1 Score: 99.3673 bits (246), Expect = 2.568e-21
Identity = 56/173 (32.37%), Postives = 88/173 (50.87%), Query Frame = 3
Query:  141 QVAFYCGRPANV---FRNKVWTLD--FQQDCLTNETKIVEFCQKSFPQWKILTSEPAVEKSKFKSWCDFKNQSCEVNVEIR-PFKCLDKNFQSDALILPRNCQFGHLFNETGCLLYKHWVKNAKEECIRKNNWHIKSYGMLFPCSINDNKIKPMFFKGVEFVCCPNQEFKSVD 641
            QVA +CG+  N+    ++  W  D    + C+  +  I+++CQ+ +P  +I     A +    ++WC    + C  +V I  P++CL   F SDAL++P  C+F H      C  + HW   AKE C      ++  +GML PC I+        F+GVEFVCCP +E +  D
Sbjct:   33 QVAMFCGK-LNMHISVQSGKWESDPSGTKSCIGTKEGILQYCQEVYPDLQITNVVEANQPVSIQNWCKKGRRQCRSHVHIVVPYRCLVGEFVSDALLVPDKCKFLHQERMDMCESHLHWHTVAKESC-GDQTMNLHDFGMLLPCGIDR-------FRGVEFVCCPVEEQRDSD 196          
BLAST of Beta-amyloid-like protein vs. Ensembl Nematostella
Match: EDO45291 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTM2])

HSP 1 Score: 101.293 bits (251), Expect = 1.831e-22
Identity = 91/390 (23.33%), Postives = 170/390 (43.59%), Query Frame = 3
Query:  144 VAFYCGRPANVF--RNKVWTLD--FQQDCLTNETKIVEFCQKSFPQWKILTSEPAVEKSKFKSWCDFKNQSCEVNVEIRPFKCLDKNFQSDALILPRNCQFGHLFNETGCLLYKHWVKNAKEECIRKNNWHIKSYGMLFPCSINDNKIKPMFFKGVEFVCCPNQEFKSVDNS--------------DLSMYKTYLNNAVLDTEQGEQKFYEDAEKNLIK-------SEYEKEAEIINXXXXXXXXXXXXXXXDPEF--------AKKKEEDFLKG----FKTQMNSIQTQFQENKEQLLNFHDNRLEFIFNTKFESAKRNLXXXXXXXXXXXXEIFEAMKIILKALMDRKKYLMAEFEEAKRFNSKTADAMYIRM-ELVDKLISDLFDTL 1199
            VA +CG+           W  D      C T+  +++++CQ  +P+  +     A      K+WCD KN +C     + P++CL   F++DAL++P  C+F HL   + C  +  W   A+E+C +  + +++ YG+L PC+          F GVEFVCCP    K  DN                  +  T    +++D  + E K Y   +K +I        ++Y +E + +NE  +   +       D E           K+ E  + G    FK  +++++ Q +  +++L   H   L+   N K     +   + +++  K  D+I  AM++      + + + +  F+ A + N +  + M   + E +DK+   + DT+
Sbjct:   34 VAMWCGKVNQHMDINTGEWATDENGHSMCSTSTKQVLKYCQHVYPKLNVSNVVEANMNVTIKTWCDPKNVNCNATKTVLPYRCLVGKFEADALLVPPGCRFQHLHPGSECKSHDFWKIKAEEKC-KDQDANLRYYGVLLPCNTG-------LFTGVEFVCCP---VKKPDNKLPFEKVVPAIEVEVATPIPTTAPPASIIDKLEAEVKEY---DKKIIPALFGCNLTKYREERKKLNEQHRVNMKQVIKQWEDAEKRYNILHKDEPKQAEQMMAGVMARFKETISTLEQQAKLERQRLHEEHHQCLQIHINEKRHKTIKTFLRELRREIKNPDKILAAMRMFTNICNEDRVHNLRYFKIASKHNPEMTEEMRANLKEHLDKINQRMNDTM 409          
BLAST of Beta-amyloid-like protein vs. Ensembl Nematostella
Match: EDO27219 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T9V3])

HSP 1 Score: 57.3806 bits (137), Expect = 8.522e-11
Identity = 27/73 (36.99%), Postives = 42/73 (57.53%), Query Frame = 3
Query:  399 SDALILPRNCQFGHLFNETGCLLYKHWVKNAKEECIRKNNWHIKSYGMLFPCSINDNKIKPMFFKGVEFVCCP 617
            +DAL++P  C+F HL   + C  +  W   A+E+C +  + +++ YG+L PC+          F GVEFVCCP
Sbjct:    1 ADALLVPPGCRFQHLHPGSECKSHDFWKIKAEEKC-KDQDANLRYYGVLLPCNTG-------LFTGVEFVCCP 65          
BLAST of Beta-amyloid-like protein vs. Ensembl Medaka
Match: APP (amyloid-beta A4 protein [Source:NCBI gene;Acc:101162104])

HSP 1 Score: 105.531 bits (262), Expect = 2.621e-23
Identity = 59/176 (33.52%), Postives = 91/176 (51.70%), Query Frame = 3
Query:  141 QVAFYCGR---PANVFRNKVWTLD--FQQDCLTNETKIVEFCQKSFPQWKILTSEPAVEKSKFKSWCDFKNQSCEVNVEIR-PFKCLDKNFQSDALILPRNCQFGHLFNETGCLLYKHWVKNAKEECIRKNNWHIKSYGMLFPCSINDNKIKPMFFKGVEFVCCPNQEFKSVDNSD 650
            QVA +CG+     NV   K W  D    + C+  +  I+++CQ+ +P+ +I     A +    +SWC    + C  ++ I  P++CL   F SDAL++P  C+F H      C  + HW   AKE C  +    +  YGML PC I+        FKGVEFVCCP +  ++ D+++
Sbjct:    8 QVAMFCGKLNMHINVQTGK-WESDPSGTKSCIGTKEGILQYCQEVYPELQITNVVEANQPVSIQSWCKKGRKQCRGHMHIVVPYRCLVGEFVSDALLVPDKCKFLHQERMDQCESHLHWHTVAKESCGDR-TMTLHDYGMLLPCGIDR-------FKGVEFVCCPTEVERNADSAE 174          
BLAST of Beta-amyloid-like protein vs. Ensembl Medaka
Match: APP (amyloid-beta A4 protein [Source:NCBI gene;Acc:101162104])

HSP 1 Score: 104.76 bits (260), Expect = 5.838e-23
Identity = 59/176 (33.52%), Postives = 91/176 (51.70%), Query Frame = 3
Query:  141 QVAFYCGR---PANVFRNKVWTLD--FQQDCLTNETKIVEFCQKSFPQWKILTSEPAVEKSKFKSWCDFKNQSCEVNVEIR-PFKCLDKNFQSDALILPRNCQFGHLFNETGCLLYKHWVKNAKEECIRKNNWHIKSYGMLFPCSINDNKIKPMFFKGVEFVCCPNQEFKSVDNSD 650
            QVA +CG+     NV   K W  D    + C+  +  I+++CQ+ +P+ +I     A +    +SWC    + C  ++ I  P++CL   F SDAL++P  C+F H      C  + HW   AKE C  +    +  YGML PC I+        FKGVEFVCCP +  ++ D+++
Sbjct:   34 QVAMFCGKLNMHINVQTGK-WESDPSGTKSCIGTKEGILQYCQEVYPELQITNVVEANQPVSIQSWCKKGRKQCRGHMHIVVPYRCLVGEFVSDALLVPDKCKFLHQERMDQCESHLHWHTVAKESCGDR-TMTLHDYGMLLPCGID-------RFKGVEFVCCPTEVERNADSAE 200          
BLAST of Beta-amyloid-like protein vs. Ensembl Medaka
Match: APP (amyloid-beta A4 protein [Source:NCBI gene;Acc:101162104])

HSP 1 Score: 103.605 bits (257), Expect = 1.266e-22
Identity = 59/176 (33.52%), Postives = 91/176 (51.70%), Query Frame = 3
Query:  141 QVAFYCGR---PANVFRNKVWTLD--FQQDCLTNETKIVEFCQKSFPQWKILTSEPAVEKSKFKSWCDFKNQSCEVNVEIR-PFKCLDKNFQSDALILPRNCQFGHLFNETGCLLYKHWVKNAKEECIRKNNWHIKSYGMLFPCSINDNKIKPMFFKGVEFVCCPNQEFKSVDNSD 650
            QVA +CG+     NV   K W  D    + C+  +  I+++CQ+ +P+ +I     A +    +SWC    + C  ++ I  P++CL   F SDAL++P  C+F H      C  + HW   AKE C  +    +  YGML PC I+        FKGVEFVCCP +  ++ D+++
Sbjct:   34 QVAMFCGKLNMHINVQTGK-WESDPSGTKSCIGTKEGILQYCQEVYPELQITNVVEANQPVSIQSWCKKGRKQCRGHMHIVVPYRCLVGEFVSDALLVPDKCKFLHQERMDQCESHLHWHTVAKESCGDR-TMTLHDYGMLLPCGID-------RFKGVEFVCCPTEVERNADSAE 200          
BLAST of Beta-amyloid-like protein vs. Ensembl Medaka
Match: aplp2 (amyloid beta precursor like protein 2 [Source:NCBI gene;Acc:101168561])

HSP 1 Score: 100.138 bits (248), Expect = 1.589e-21
Identity = 54/166 (32.53%), Postives = 89/166 (53.61%), Query Frame = 3
Query:  141 QVAFYCGRPANVFRN---KVWTLD--FQQDCLTNETKIVEFCQKSFPQWKILTSEPAVEKSKFKSWCDFKNQSCEVNVEIR-PFKCLDKNFQSDALILPRNCQFGHLFNETGCLLYKHWVKNAKEECIRKNNWHIKSYGMLFPCSINDNKIKPMFFKGVEFVCCPN 620
            QVA +CG+  N+  N     W  D    + C+  +  ++++CQ+ +P+ +I     A +  + K+WC  + + C+ +  I  PFKCL   F SD L++P  C+F H      C+ ++ W   AKE C  K++  + SYGML PC ++        F+G E+VCCP+
Sbjct:   51 QVAMFCGK-LNMHVNIQTGRWEPDPSGTKSCIRTKEGVLQYCQEVYPELQITNVVEANQPIQIKNWCRREKKVCKGHDHIVVPFKCLVGEFVSDVLLVPEKCKFFHKERMDICVSHQQWHGVAKEACT-KSSMVLHSYGMLVPCGVD-------MFRGTEYVCCPS 207          
BLAST of Beta-amyloid-like protein vs. Ensembl Medaka
Match: appb (amyloid-beta A4 protein [Source:NCBI gene;Acc:101172288])

HSP 1 Score: 99.3673 bits (246), Expect = 2.535e-21
Identity = 62/195 (31.79%), Postives = 97/195 (49.74%), Query Frame = 3
Query:   87 VLVKFSISLIVASSNDDLQVAFYCGR---PANVFRNKVWTLD--FQQDCLTNETKIVEFCQKSFPQWKILTSEPAVEKSKFKSWCDFKNQSCEVNVEIR-PFKCLDKNFQSDALILPRNCQFGHLFNETGCLLYKHWVKNAKEECI-RKNNWHIKSYGMLFPCSINDNKIKPMFFKGVEFVCCPNQEFKSVDNSD 650
            V V  S+ L+      + QVA +CG+     NV   K W  D    + C+  +  ++ +CQ+ +P+ +I     A +     +WC    + C  +  I  P++CL   F SDAL++P  C+F H      C  + HW   AKE C  R  N H   YGML PC+++        F+GVEFVCCP +  + +D+++
Sbjct:   21 VPVDDSVGLLT-----EPQVAMFCGKLNMHINVQSGK-WEADPSGTKSCIDTKEGLLRYCQEVYPELQITNVVEANQPVSITNWCKKGRKQCRSHPHIVVPYRCLVGEFVSDALLVPDKCKFLHQERMDQCESHLHWHTVAKESCGDRSMNLH--DYGMLLPCNVD-------RFRGVEFVCCPVEGEREMDSAE 200          
BLAST of Beta-amyloid-like protein vs. Planmine SMEST
Match: SMESG000025214.1 (SMESG000025214.1)

HSP 1 Score: 582.408 bits (1500), Expect = 0.000e+0
Identity = 297/301 (98.67%), Postives = 299/301 (99.34%), Query Frame = 3
Query:  882 MNSIQTQFQENKEQLLNFHDNRLEFIFNTKFESAKRNLXXXXXXXXXXXXEIFEAMKIILKALMDRKKYLMAEFEEAKRFNSKTADAMYIRMELVDKLISDLFDTLKQVPNYEFILKERLMNYFTTVYPRDGVPVNTKQSLYDKTERINIEDIIAKYKHHTKNINTDDSEFAVHYDLGLNDPDQIHADFGKLEKIARHDDQNSKKNSGAKPIFIIVFGLLAIVLMSLVGIVFYKRRLVKKGYSTPIFQNERSTKNFPGFGVNSQLAFSKEFKPHFYENMNYVNVHENPLIQTKIEVEEKSK 1784
            MNSIQTQFQENKEQLLNFHDNRLEFIFNTKFESAKRNLDKVMKKTDKT+DEIFEAMKIILKALMDRKKYLMAEFEEAKRFNSKTADAMYIRMELVDKLISDLFDTLKQV NYEFILKERLMNYFTTVYPRDGVPVNTKQSLYDKT RINIEDIIAKYKHHTKNINTDDSEFAVHYDLGLNDPDQIHADFGKLEK+ARHDDQNSKKNSGAKPIFIIVFGLLAIVLMSLVGIVFYKRRLVKKGYSTPIFQNERSTKNFPGFGVNSQLAFSKEFKPHFYENMNYVNVHENPLIQTKIEVEEKSK
Sbjct:    1 MNSIQTQFQENKEQLLNFHDNRLEFIFNTKFESAKRNLDKVMKKTDKTLDEIFEAMKIILKALMDRKKYLMAEFEEAKRFNSKTADAMYIRMELVDKLISDLFDTLKQVSNYEFILKERLMNYFTTVYPRDGVPVNTKQSLYDKTGRINIEDIIAKYKHHTKNINTDDSEFAVHYDLGLNDPDQIHADFGKLEKLARHDDQNSKKNSGAKPIFIIVFGLLAIVLMSLVGIVFYKRRLVKKGYSTPIFQNERSTKNFPGFGVNSQLAFSKEFKPHFYENMNYVNVHENPLIQTKIEVEEKSK 301          
BLAST of Beta-amyloid-like protein vs. Planmine SMEST
Match: SMESG000025213.1 (SMESG000025213.1)

HSP 1 Score: 438.343 bits (1126), Expect = 6.128e-151
Identity = 233/266 (87.59%), Postives = 237/266 (89.10%), Query Frame = 3
Query:   69 CLILYLVLVKFSISLIVASSNDDLQVAFYCGRPANVFRNKVWTLDFQQDCLTNETKIVEFCQKSFPQWKILTSEPAVEKSKFKSWCDFKNQSCEVNVEIRPFKCLDKNFQSDALILPRNCQFGHLFNETGCLLYKHWVKNAKEECIRKNNWHIKSYGMLFPCSINDNKIKPMFFKGVEFVCCPNQEFKSVDNSDLSMYKTYLNNAVLDTEQGEQKFYEDAEKNLIKSEYEKEAEIINXXXXXXXXXXXXXXXDPEFAKKKEEDFLK 866
            CL   L   +FSISLIVASSNDDLQVAFYCGRPANVFRNKVWTLDFQQDCLTNETKIVEFCQKSFPQWKILTSEPAVEKSKFK                      +KNFQSDALILPRNCQFGHLFNETGCLLYKHWVKNAKEECIRKNNWHIKSYGMLFPCSINDNKIKPMFFKGVEFVCCPNQEFKSVDNSDLSMYKTYLNNAVLDTEQGEQKFYEDAEKNLIKSEYEKE EIINELKKSEKELESLWKSDPEFAKK+EE+FLK
Sbjct:   50 CLTSQLNANQFSISLIVASSNDDLQVAFYCGRPANVFRNKVWTLDFQQDCLTNETKIVEFCQKSFPQWKILTSEPAVEKSKFK----------------------NKNFQSDALILPRNCQFGHLFNETGCLLYKHWVKNAKEECIRKNNWHIKSYGMLFPCSINDNKIKPMFFKGVEFVCCPNQEFKSVDNSDLSMYKTYLNNAVLDTEQGEQKFYEDAEKNLIKSEYEKETEIINELKKSEKELESLWKSDPEFAKKEEENFLK 293          
BLAST of Beta-amyloid-like protein vs. Planmine SMEST
Match: SMESG000025213.1 (SMESG000025213.1)

HSP 1 Score: 437.958 bits (1125), Expect = 6.311e-151
Identity = 233/266 (87.59%), Postives = 237/266 (89.10%), Query Frame = 3
Query:   69 CLILYLVLVKFSISLIVASSNDDLQVAFYCGRPANVFRNKVWTLDFQQDCLTNETKIVEFCQKSFPQWKILTSEPAVEKSKFKSWCDFKNQSCEVNVEIRPFKCLDKNFQSDALILPRNCQFGHLFNETGCLLYKHWVKNAKEECIRKNNWHIKSYGMLFPCSINDNKIKPMFFKGVEFVCCPNQEFKSVDNSDLSMYKTYLNNAVLDTEQGEQKFYEDAEKNLIKSEYEKEAEIINXXXXXXXXXXXXXXXDPEFAKKKEEDFLK 866
            CL   L   +FSISLIVASSNDDLQVAFYCGRPANVFRNKVWTLDFQQDCLTNETKIVEFCQKSFPQWKILTSEPAVEKSKFK                      +KNFQSDALILPRNCQFGHLFNETGCLLYKHWVKNAKEECIRKNNWHIKSYGMLFPCSINDNKIKPMFFKGVEFVCCPNQEFKSVDNSDLSMYKTYLNNAVLDTEQGEQKFYEDAEKNLIKSEYEKE EIINELKKSEKELESLWKSDPEFAKK+EE+FLK
Sbjct:   49 CLTSQLNANQFSISLIVASSNDDLQVAFYCGRPANVFRNKVWTLDFQQDCLTNETKIVEFCQKSFPQWKILTSEPAVEKSKFK----------------------NKNFQSDALILPRNCQFGHLFNETGCLLYKHWVKNAKEECIRKNNWHIKSYGMLFPCSINDNKIKPMFFKGVEFVCCPNQEFKSVDNSDLSMYKTYLNNAVLDTEQGEQKFYEDAEKNLIKSEYEKETEIINELKKSEKELESLWKSDPEFAKKEEENFLK 292          
BLAST of Beta-amyloid-like protein vs. Planmine SMEST
Match: SMESG000025222.1 (SMESG000025222.1)

HSP 1 Score: 399.823 bits (1026), Expect = 1.636e-137
Identity = 192/194 (98.97%), Postives = 193/194 (99.48%), Query Frame = 3
Query: 1203 QVPNYEFILKERLMNYFTTVYPRDGVPVNTKQSLYDKTERINIEDIIAKYKHHTKNINTDDSEFAVHYDLGLNDPDQIHADFGKLEKIARHDDQNSKKNSGAKPIFIIVFGLLAIVLMSLVGIVFYKRRLVKKGYSTPIFQNERSTKNFPGFGVNSQLAFSKEFKPHFYENMNYVNVHENPLIQTKIEVEEKSK 1784
            QVPNYEFILKERLMNYFTTVYPRDGVPVNTKQSLYDKT RINIEDIIAKYKHHTKNINTDDSEFAVHYDLGLNDPDQIHADFGKLEK+ARHDDQNSKKNSGAKPIFIIVFGLLAIVLMSLVGIVFYKRRLVKKGYSTPIFQNERSTKNFPGFGVNSQLAFSKEFKPHFYENMNYVNVHENPLIQTKIEVEEKSK
Sbjct:    5 QVPNYEFILKERLMNYFTTVYPRDGVPVNTKQSLYDKTGRINIEDIIAKYKHHTKNINTDDSEFAVHYDLGLNDPDQIHADFGKLEKLARHDDQNSKKNSGAKPIFIIVFGLLAIVLMSLVGIVFYKRRLVKKGYSTPIFQNERSTKNFPGFGVNSQLAFSKEFKPHFYENMNYVNVHENPLIQTKIEVEEKSK 198          
BLAST of Beta-amyloid-like protein vs. Planmine SMEST
Match: SMESG000041669.1 (SMESG000041669.1)

HSP 1 Score: 58.9214 bits (141), Expect = 7.640e-9
Identity = 86/360 (23.89%), Postives = 170/360 (47.22%), Query Frame = 3
Query:  372 FKCLDKNFQSDALILPRNCQFGHLFNETG-CLLYKHWVKNAKEECIRKN---NWHIKSYGMLFPCSINDNKIKPMFFKGVEFVCCPNQEFKSVDNSDLSMYKTYLNNAVLDTEQGEQKFYEDAEKNLIKSEYEKEAEIINXXXXXXXXXXXXXXXDPEFAK----KKEEDFLKGFKTQMNSIQTQFQENKEQLLNFHDNRLEFIFNTKFESAKRNLXXXXXXXXXXXXEIFEAMKIILKALMDRKK--------YLMAEFEEAKR--------FNSKTADAMYIRMELVDKLISDLFD-TLKQVPNYEFILKERLMNYFTTVYPRDGVPVNTKQSLYDKTERINIEDIIAKYKHHTKNIN 1376
            ++C   + +S+AL +P  C+F H   E   CL  + W   A   CI      +  +  +  +F C I+D   + + FK +++VCCP  +  + D      YK ++ N      + E + +  A+K L +  ++   + I +    E+      + +P+ A     K +++F K F  +M+      +E    L   H+NR++ +F    +SAK  L+  +++T+   + I +A+K+ L +++   K         L   F +++R        FNS    +      L+D+ +S+L D  +KQ+ ++E + K+ L+  FT++   D V    K S+  + E  +++++I+ Y H + N N
Sbjct:   10 YQCSINDKKSEALSVPGGCRFDHSLKEANVCLTEEEWKAKAGSFCINYGTEVDLELAHFSGIFNCKISDTNPR-ITFKSIQYVCCP--KLNAYD-----FYKIHIKNQ--SKVKSENQAFLLAKKAL-RKRFDLRQKQIQDRFILEENSIDFSQKNPKIANFLENKIQDNFRKRFTLEMSKEVDLMKE----LEIIHENRMQKLFEKNRKSAKARLEYTLQETNPRANRIAKALKLELISILSEAKDVTEFYETLLTEGFTDSERSKILIRETFNSLVGRSWNEVFGLLDR-VSELKDEIMKQITDFE-LQKQNLIKRFTSL-DNDKV---LKDSVKHQVEN-HVKNMISLYGHGSANKN 347          
The following BLAST results are available for this feature:
BLAST of Beta-amyloid-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
APP3.039e-2333.90amyloid beta precursor protein [Source:HGNC Symbol... [more]
APP5.430e-2333.90amyloid beta precursor protein [Source:HGNC Symbol... [more]
APP5.780e-2333.90amyloid beta precursor protein [Source:HGNC Symbol... [more]
APP6.433e-2333.90amyloid beta precursor protein [Source:HGNC Symbol... [more]
APP6.584e-2333.90amyloid beta precursor protein [Source:HGNC Symbol... [more]
back to top
BLAST of Beta-amyloid-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
apl-12.610e-2320.53Amyloid-beta-like protein [Source:UniProtKB/Swiss... [more]
apl-12.621e-2320.53Amyloid-beta-like protein [Source:UniProtKB/Swiss... [more]
back to top
BLAST of Beta-amyloid-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Appl1.977e-2128.18gene:FBgn0000108 transcript:FBtr0307293[more]
Appl2.029e-2128.18gene:FBgn0000108 transcript:FBtr0307295[more]
Appl5.161e-2028.18gene:FBgn0000108 transcript:FBtr0307294[more]
Appl5.315e-2028.18gene:FBgn0000108 transcript:FBtr0070109[more]
Appl5.328e-2028.18gene:FBgn0000108 transcript:FBtr0307291[more]
back to top
BLAST of Beta-amyloid-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
appb2.948e-2433.66amyloid beta (A4) precursor protein b [Source:ZFIN... [more]
appb8.748e-2433.66amyloid beta (A4) precursor protein b [Source:ZFIN... [more]
appb1.220e-2335.03amyloid beta (A4) precursor protein b [Source:ZFIN... [more]
appb2.572e-2335.03amyloid beta (A4) precursor protein b [Source:ZFIN... [more]
appb2.992e-2335.03amyloid beta (A4) precursor protein b [Source:ZFIN... [more]
back to top
BLAST of Beta-amyloid-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gtf2e22.376e-2232.79general transcription factor IIE subunit 2 [Source... [more]
gtf2e22.429e-2232.79general transcription factor IIE subunit 2 [Source... [more]
gtf2e22.544e-2232.79general transcription factor IIE subunit 2 [Source... [more]
gtf2e22.925e-2232.79general transcription factor IIE subunit 2 [Source... [more]
gtf2e23.663e-2230.26general transcription factor IIE subunit 2 [Source... [more]
back to top
BLAST of Beta-amyloid-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
App5.607e-2434.46amyloid beta (A4) precursor protein [Source:MGI Sy... [more]
App1.127e-2334.46amyloid beta (A4) precursor protein [Source:MGI Sy... [more]
App1.142e-2334.46amyloid beta (A4) precursor protein [Source:MGI Sy... [more]
App1.190e-2334.46amyloid beta (A4) precursor protein [Source:MGI Sy... [more]
App1.236e-2334.46amyloid beta (A4) precursor protein [Source:MGI Sy... [more]
back to top
BLAST of Beta-amyloid-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q06BR2|A4_DORPE7.381e-2423.34Amyloid-beta precursor-like protein OS=Doryteuthis... [more]
sp|P12023|A4_MOUSE8.644e-2334.46Amyloid-beta A4 protein OS=Mus musculus OX=10090 G... [more]
sp|P08592|A4_RAT1.261e-2233.90Amyloid-beta A4 protein OS=Rattus norvegicus OX=10... [more]
sp|O73683|A4_TETFL1.362e-2231.55Amyloid-beta A4 protein OS=Tetraodon fluviatilis O... [more]
sp|P79307|A4_PIG2.194e-2233.90Amyloid-beta A4 protein OS=Sus scrofa OX=9823 GN=A... [more]
back to top
BLAST of Beta-amyloid-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
R7TD289.988e-3123.00A4_EXTRA domain-containing protein OS=Capitella te... [more]
T2MFP91.937e-2925.26Amyloid-like protein 1 OS=Hydra vulgaris OX=6087 G... [more]
A0A1I7ZKG77.397e-2823.88A4_EXTRA domain-containing protein OS=Steinernema ... [more]
A0A0B2UNW53.673e-2723.13Beta-amyloid-like protein OS=Toxocara canis OX=626... [more]
A0A1I7SQ532.507e-2623.34A4_EXTRA domain-containing protein OS=Bursaphelenc... [more]
back to top
BLAST of Beta-amyloid-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000015571.21.656e-2433.33pep primary_assembly:Astyanax_mexicanus-2.0:12:313... [more]
appb4.647e-2231.00amyloid beta A4 protein-like [Source:NCBI gene;Acc... [more]
appb1.028e-2131.00amyloid beta A4 protein-like [Source:NCBI gene;Acc... [more]
appb1.072e-2131.00amyloid beta A4 protein-like [Source:NCBI gene;Acc... [more]
appb2.568e-2132.37amyloid beta A4 protein-like [Source:NCBI gene;Acc... [more]
back to top
BLAST of Beta-amyloid-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Beta-amyloid-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Beta-amyloid-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO452911.831e-2223.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO272198.522e-1136.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Beta-amyloid-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
APP2.621e-2333.52amyloid-beta A4 protein [Source:NCBI gene;Acc:1011... [more]
APP5.838e-2333.52amyloid-beta A4 protein [Source:NCBI gene;Acc:1011... [more]
APP1.266e-2233.52amyloid-beta A4 protein [Source:NCBI gene;Acc:1011... [more]
aplp21.589e-2132.53amyloid beta precursor like protein 2 [Source:NCBI... [more]
appb2.535e-2131.79amyloid-beta A4 protein [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of Beta-amyloid-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000025214.10.000e+098.67SMESG000025214.1[more]
SMESG000025213.16.128e-15187.59SMESG000025213.1[more]
SMESG000025213.16.311e-15187.59SMESG000025213.1[more]
SMESG000025222.11.636e-13798.97SMESG000025222.1[more]
SMESG000041669.17.640e-923.89SMESG000041669.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024538 ID=SMED30024538|Name=Beta-amyloid-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1910bp
GTGTTCATAATAGTTATTTGAAGCAACTCATAATTCAAATTATTTAAATT
ATGAAAATACAACATAATTGTTTAATATTGTATCTTGTGCTTGTCAAATT
TTCTATCAGTTTAATCGTAGCGTCTAGCAATGATGATTTACAAGTTGCTT
TCTATTGTGGAAGGCCTGCAAATGTCTTCCGAAATAAGGTATGGACTTTA
GATTTTCAACAAGACTGCCTAACAAATGAAACGAAAATAGTCGAATTTTG
TCAAAAATCGTTTCCACAATGGAAAATTCTAACTTCTGAACCGGCAGTTG
AGAAATCAAAATTTAAAAGTTGGTGCGACTTCAAGAATCAAAGTTGTGAA
GTAAATGTGGAAATTCGCCCTTTTAAATGTTTAGATAAAAACTTCCAATC
AGATGCTCTAATTTTACCCCGTAATTGTCAATTTGGTCATTTATTCAATG
AAACTGGGTGTTTACTTTATAAACATTGGGTTAAAAATGCCAAAGAAGAA
TGCATTCGAAAAAACAATTGGCATATTAAATCATATGGTATGCTATTTCC
ATGCAGCATTAATGACAACAAAATAAAGCCAATGTTTTTCAAAGGAGTGG
AATTCGTTTGTTGTCCTAATCAAGAGTTCAAAAGTGTTGATAATAGCGAT
TTAAGCATGTATAAAACTTATCTGAATAATGCAGTTCTTGATACTGAACA
GGGTGAACAGAAGTTTTATGAAGATGCTGAAAAAAATCTAATAAAATCTG
AATATGAAAAGGAAGCTGAAATAATCAATGAACTTAAAAAATCTGAAAAA
GAACTTGAAAGTCTCTGGAAATCCGATCCAGAATTTGCAAAAAAGAAAGA
AGAGGATTTTCTTAAAGGTTTTAAAACTCAAATGAATTCTATCCAGACTC
AATTCCAAGAAAATAAAGAGCAACTTCTTAATTTCCACGACAATAGGCTT
GAATTTATCTTTAATACAAAATTTGAAAGCGCAAAAAGAAATTTGGATAA
AGTTATGAAAAAAACAGATAAAACAGTTGATGAGATATTTGAAGCCATGA
AGATCATTTTAAAGGCGCTGATGGATCGCAAAAAATATCTCATGGCTGAA
TTTGAAGAGGCCAAAAGGTTTAATTCAAAGACAGCAGATGCTATGTACAT
TCGTATGGAGTTGGTTGATAAGTTAATCTCTGATTTATTTGACACTTTGA
AACAGGTTCCGAACTATGAATTCATCTTGAAGGAGAGATTGATGAATTAT
TTTACGACGGTCTATCCTCGGGATGGTGTACCAGTTAACACAAAACAATC
TCTATACGATAAAACTGAAAGAATCAACATTGAGGATATTATTGCCAAAT
ATAAACATCATACAAAAAATATAAATACTGATGACTCTGAATTCGCTGTT
CACTATGATCTCGGTTTAAATGATCCAGATCAGATTCATGCAGATTTTGG
AAAATTGGAGAAAATAGCACGACATGATGATCAAAATTCAAAAAAAAATT
CGGGTGCAAAGCCAATTTTCATTATCGTGTTTGGATTGTTGGCAATTGTT
TTAATGAGTTTAGTTGGAATCGTTTTCTACAAAAGAAGATTGGTAAAGAA
AGGTTATTCTACTCCAATATTTCAAAATGAAAGGAGCACGAAAAATTTTC
CTGGGTTCGGAGTCAATTCTCAATTGGCGTTTTCTAAAGAATTTAAACCC
CATTTCTATGAAAATATGAATTACGTCAATGTGCACGAAAATCCACTTAT
ACAGACAAAAATAGAAGTTGAAGAAAAATCTAAATAATTTTATTTCATGA
ATTCGCTTTGCTTCATTCATTTATATGATTTTTCACTTAAAATAATGAAT
TGTATTTAACTTTTGTTTTAATCTACCTATTATATATTTTTATAAATAAA
TAAATGCAAG
back to top

protein sequence of SMED30024538-orf-1

>SMED30024538-orf-1 ID=SMED30024538-orf-1|Name=SMED30024538-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=579bp
MKIQHNCLILYLVLVKFSISLIVASSNDDLQVAFYCGRPANVFRNKVWTL
DFQQDCLTNETKIVEFCQKSFPQWKILTSEPAVEKSKFKSWCDFKNQSCE
VNVEIRPFKCLDKNFQSDALILPRNCQFGHLFNETGCLLYKHWVKNAKEE
CIRKNNWHIKSYGMLFPCSINDNKIKPMFFKGVEFVCCPNQEFKSVDNSD
LSMYKTYLNNAVLDTEQGEQKFYEDAEKNLIKSEYEKEAEIINELKKSEK
ELESLWKSDPEFAKKKEEDFLKGFKTQMNSIQTQFQENKEQLLNFHDNRL
EFIFNTKFESAKRNLDKVMKKTDKTVDEIFEAMKIILKALMDRKKYLMAE
FEEAKRFNSKTADAMYIRMELVDKLISDLFDTLKQVPNYEFILKERLMNY
FTTVYPRDGVPVNTKQSLYDKTERINIEDIIAKYKHHTKNINTDDSEFAV
HYDLGLNDPDQIHADFGKLEKIARHDDQNSKKNSGAKPIFIIVFGLLAIV
LMSLVGIVFYKRRLVKKGYSTPIFQNERSTKNFPGFGVNSQLAFSKEFKP
HFYENMNYVNVHENPLIQTKIEVEEKSK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036669Amyloid_Cu-bd_sf
IPR036176E2_sf
IPR036454Amyloid_glyco_heparin-bd_sf
IPR008155Amyloid_glyco
IPR008154Amyloid_glyco_extra
IPR011178Amyloid_glyco_Cu-bd
IPR015849Amyloid_glyco_heparin-bd
IPR024329Amyloid_glyco_E2_domain
IPR019744APP_CUBD_CS
Vocabulary: molecular function
TermDefinition
GO:0046914transition metal ion binding
GO:0008201heparin binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 235..255
NoneNo IPR availablePANTHERPTHR23103:SF15AMYLOID-BETA-LIKE PROTEINcoord: 11..482
NoneNo IPR availablePROSITEPS51869APP_E1coord: 26..190
score: 20.953
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..24
score: 0.761
NoneNo IPR availableTMHMMTMhelixcoord: 488..510
NoneNo IPR availableTMHMMTMhelixcoord: 7..24
IPR008154Amyloidogenic glycoprotein, extracellularSMARTSM00006A4_EXTRA_3coord: 24..189
e-value: 3.1E-22
score: 89.8
IPR011178Amyloidogenic glycoprotein, copper-bindingPFAMPF12924APP_Cu_bdcoord: 125..189
e-value: 6.9E-13
score: 49.1
IPR036669Amyloidogenic glycoprotein, copper-binding domain superfamilyGENE3DG3DSA:3.30.1490.140coord: 124..190
e-value: 1.4E-14
score: 56.2
IPR036669Amyloidogenic glycoprotein, copper-binding domain superfamilySUPERFAMILYSSF89811Amyloid beta a4 protein copper binding domain (domain 2)coord: 117..190
IPR015849Amyloidogenic glycoprotein, heparin-bindingPFAMPF02177APP_Ncoord: 31..123
e-value: 1.9E-16
score: 60.3
IPR024329Amyloidogenic glycoprotein, E2 domainPFAMPF12925APP_E2coord: 216..375
e-value: 1.3E-13
score: 51.1
IPR036176E2 domain superfamilyGENE3DG3DSA:1.20.120.770coord: 207..411
e-value: 1.7E-15
score: 59.1
IPR036176E2 domain superfamilySUPERFAMILYSSF109843CAPPD, an extracellular domain of amyloid beta A4 proteincoord: 216..394
IPR036454Amyloidogenic glycoprotein, heparin-binding domain superfamilyGENE3DG3DSA:3.90.570.10coord: 21..116
e-value: 3.5E-13
score: 51.5
IPR036454Amyloidogenic glycoprotein, heparin-binding domain superfamilySUPERFAMILYSSF56491A heparin-binding domaincoord: 30..115
IPR008155Amyloidogenic glycoproteinPANTHERPTHR23103ALZHEIMER'S DISEASE BETA-AMYLOID RELATEDcoord: 11..482
IPR019744Amyloidogenic glycoprotein, copper-binding domain conserved sitePROSITEPS00319APP_CUBDcoord: 182..189