SMED30024529

Overview
NameSMED30024529
Smed IDSMED30024529
Length (bp)601
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30024529 (SMED30024529) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30024529 (SMED30024529) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30024529 (SMED30024529) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30024529 (SMED30024529) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024529

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30024529SMESG000070890.1 Contig1671GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30024529SMESG000004003.1 Contig1671GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30024529SMESG000004003.1 dd_Smed_v4_2482_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30024529 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.003193:33621..34332 -2817
Homology
BLAST of SMED30024529 vs. Ensembl Human
Match: TXNDC17 (thioredoxin domain containing 17 [Source:HGNC Symbol;Acc:HGNC:28218])

HSP 1 Score: 73.559 bits (179), Expect = 1.760e-16
Identity = 37/121 (30.58%), Postives = 68/121 (56.20%), Query Frame = -1
Query:  179 EQLYIGNYDKYIGKIDELKSLQNSVILFFCGSTEESTGDSWCPDCRDAEPFIEKGMELCS-NLVFALVEVGYKDEWKSTENKFRCDSDLKLTEIPTLINLKKKNRLIGNQCTDSNLINEFF 538
            E++ +  ++++   +++      ++  +F GS +++ G SWCPDC  AEP + +G++  S   VF   +VG K  WK   N FR   +LK+T +PTL+      +L+ ++C  +NL+   F
Sbjct:    5 EEVSVSGFEEFHRAVEQHNG--KTIFAYFTGS-KDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFR--KNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLF 120          
BLAST of SMED30024529 vs. Ensembl Human
Match: TXNDC17 (thioredoxin domain containing 17 [Source:HGNC Symbol;Acc:HGNC:28218])

HSP 1 Score: 50.447 bits (119), Expect = 5.491e-8
Identity = 26/76 (34.21%), Postives = 42/76 (55.26%), Query Frame = -1
Query:  179 RDAEPFIEKGMELCS-NLVFALVEVGYKDEWKSTENKFRCDSDLKLTEIPTLINLKKKNRLIGNQCTDSNLINEFF 403
             +AEP + +G++  S   VF   +VG K  WK   N FR   +LK+T +PTL+      +L+ ++C  +NL+   F
Sbjct:   22 HNAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFR--KNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLF 95          
BLAST of SMED30024529 vs. Ensembl Celegans
Match: Y71H2AR.1 (pep chromosome:WBcel235:III:2834663:2836261:1 gene:WBGene00022188.1 transcript:Y71H2AR.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y71H2AR.1)

HSP 1 Score: 63.5438 bits (153), Expect = 4.801e-13
Identity = 40/112 (35.71%), Postives = 58/112 (51.79%), Query Frame = -1
Query:  179 DELKSLQNS--VILFFCGSTEESTGDSWCPDC----RDAEPFIEKGMELCSNLVFALVEVGYKDEWKSTENKFRCDSDLKLTEIPTLINL-KKKNRLIGNQCTDSNLINEFF 493
            + LKS+     V+  F GS   +TG+SWCPDC       E  I+       ++ F  V VG ++ W+     FR D  LKLT IPTL+ +  K  RL+  Q  + +L+ +FF
Sbjct:   17 ETLKSIGKGKRVVALFTGSKILTTGESWCPDCVVAEPVVEEVIKDAAVAGLDVHFVTVFVGNREVWRDPAVGFRTDPTLKLTCIPTLLEVGNKAKRLLERQIANKHLVKDFF 128          
BLAST of SMED30024529 vs. Ensembl Fly
Match: cl (gene:FBgn0000318 transcript:FBtr0329967)

HSP 1 Score: 76.6406 bits (187), Expect = 6.912e-18
Identity = 40/117 (34.19%), Postives = 63/117 (53.85%), Query Frame = -1
Query:  179 IGNYDKYIGKIDELKSLQNSVILFFCGSTEESTGDSWCPDCRDAEPFIEKGMELCS-NLVFALVEVGYKDEWKSTENKFRCDSDLKLTEIPTLINLKKKNRLIGNQCTDSNLINEFF 526
            +  YD++  K++EL++    V + F G  +E  G+SWCP C  AEP I   ++    N  F  V+VG +  WK     FR D +  L  +PTL+  K+  RL G +C++ +L+   F
Sbjct:    7 VKGYDEFTKKMEELENGDEPVHVLFSGGKDEK-GESWCPYCVKAEPVIHDALKKAPGNSHFVHVDVGERAYWKDLNCPFRKDPNTHLIFLPTLLRWKRPQRLDGERCSNQDLVEMMF 122          
BLAST of SMED30024529 vs. Ensembl Fly
Match: cl (gene:FBgn0000318 transcript:FBtr0079095)

HSP 1 Score: 76.6406 bits (187), Expect = 6.912e-18
Identity = 40/117 (34.19%), Postives = 63/117 (53.85%), Query Frame = -1
Query:  179 IGNYDKYIGKIDELKSLQNSVILFFCGSTEESTGDSWCPDCRDAEPFIEKGMELCS-NLVFALVEVGYKDEWKSTENKFRCDSDLKLTEIPTLINLKKKNRLIGNQCTDSNLINEFF 526
            +  YD++  K++EL++    V + F G  +E  G+SWCP C  AEP I   ++    N  F  V+VG +  WK     FR D +  L  +PTL+  K+  RL G +C++ +L+   F
Sbjct:    7 VKGYDEFTKKMEELENGDEPVHVLFSGGKDEK-GESWCPYCVKAEPVIHDALKKAPGNSHFVHVDVGERAYWKDLNCPFRKDPNTHLIFLPTLLRWKRPQRLDGERCSNQDLVEMMF 122          
BLAST of SMED30024529 vs. Ensembl Fly
Match: cl (gene:FBgn0000318 transcript:FBtr0329968)

HSP 1 Score: 76.6406 bits (187), Expect = 6.912e-18
Identity = 40/117 (34.19%), Postives = 63/117 (53.85%), Query Frame = -1
Query:  179 IGNYDKYIGKIDELKSLQNSVILFFCGSTEESTGDSWCPDCRDAEPFIEKGMELCS-NLVFALVEVGYKDEWKSTENKFRCDSDLKLTEIPTLINLKKKNRLIGNQCTDSNLINEFF 526
            +  YD++  K++EL++    V + F G  +E  G+SWCP C  AEP I   ++    N  F  V+VG +  WK     FR D +  L  +PTL+  K+  RL G +C++ +L+   F
Sbjct:    7 VKGYDEFTKKMEELENGDEPVHVLFSGGKDEK-GESWCPYCVKAEPVIHDALKKAPGNSHFVHVDVGERAYWKDLNCPFRKDPNTHLIFLPTLLRWKRPQRLDGERCSNQDLVEMMF 122          
BLAST of SMED30024529 vs. Ensembl Fly
Match: CG3939 (gene:FBgn0040396 transcript:FBtr0343600)

HSP 1 Score: 55.8398 bits (133), Expect = 5.090e-10
Identity = 34/101 (33.66%), Postives = 49/101 (48.51%), Query Frame = -1
Query:  179 QNSVILFFCGSTEESTGDSWCPDCRDAEPFIEKGM--ELCSNLVFALVEVGYKDEWKSTENKFRCDSDLKLTEIPTLINLKKKNRLIGNQCTDSNLINEFF 475
            Q S I  +    ++  G SWCPDC  AE  I         ++ +  +V+VG ++ W   +N FR      +  IPTLI  K   RL G+Q   S+L+  FF
Sbjct:   23 QRSPIYIYFYGEKDKDGRSWCPDCVAAEETIMSAFRNHAPADCMILVVDVGSRESWIGKDNMFR-KPPYSVEGIPTLIRWKGVERLDGDQLLKSSLLELFF 122          
BLAST of SMED30024529 vs. Ensembl Fly
Match: CG3939 (gene:FBgn0040396 transcript:FBtr0070508)

HSP 1 Score: 55.8398 bits (133), Expect = 5.090e-10
Identity = 34/101 (33.66%), Postives = 49/101 (48.51%), Query Frame = -1
Query:  179 QNSVILFFCGSTEESTGDSWCPDCRDAEPFIEKGM--ELCSNLVFALVEVGYKDEWKSTENKFRCDSDLKLTEIPTLINLKKKNRLIGNQCTDSNLINEFF 475
            Q S I  +    ++  G SWCPDC  AE  I         ++ +  +V+VG ++ W   +N FR      +  IPTLI  K   RL G+Q   S+L+  FF
Sbjct:   23 QRSPIYIYFYGEKDKDGRSWCPDCVAAEETIMSAFRNHAPADCMILVVDVGSRESWIGKDNMFR-KPPYSVEGIPTLIRWKGVERLDGDQLLKSSLLELFF 122          
BLAST of SMED30024529 vs. Ensembl Zebrafish
Match: txndc17 (thioredoxin domain containing 17 [Source:NCBI gene;Acc:445062])

HSP 1 Score: 67.0106 bits (162), Expect = 4.112e-14
Identity = 36/121 (29.75%), Postives = 61/121 (50.41%), Query Frame = -1
Query:  179 EQLYIGNYDKYIGKIDELKSLQNSVILFFCGSTEESTGDSWCPDCRDAEPFIEKGM-ELCSNLVFALVEVGYKDEWKSTENKFRCDSDLKLTEIPTLINLKKKNRLIGNQCTDSNLINEFF 538
            E++ +  Y+++   + + K     +  +F G  +E  G SWCPDC  AEP +   +  L    VF   +VG +  WK + N F+    LKLT +PTL+      +L+  +C  ++L+   F
Sbjct:    5 EEVAVHGYEEFCKAVSDRKG--KEIFAYFSGDKDEH-GKSWCPDCVKAEPVVRAELPHLPEGTVFIYCQVGDRPYWKDSNNDFK--KTLKLTGVPTLLRYGTPQKLVEEECFKADLVRMMF 120          
BLAST of SMED30024529 vs. Ensembl Mouse
Match: Txndc17 (thioredoxin domain containing 17 [Source:MGI Symbol;Acc:MGI:1289248])

HSP 1 Score: 71.633 bits (174), Expect = 6.357e-16
Identity = 35/104 (33.65%), Postives = 57/104 (54.81%), Query Frame = -1
Query:  179 LKSLQNSVILFFCGSTEESTGDSWCPDCRDAEPFIEKGM-ELCSNLVFALVEVGYKDEWKSTENKFRCDSDLKLTEIPTLINLKKKNRLIGNQCTDSNLINEFF 487
            +K  +   I  +   ++++ G SWCPDC +AEP I +G+  +  + VF   +VG K  WK   N FR    LK+T +PTL+      +L+ ++C  S+L+   F
Sbjct:   19 VKEHEGKTIFAYFSGSKDTEGKSWCPDCVEAEPVIREGLKHVTEDCVFIYCQVGDKPYWKDPNNDFR--QKLKITAVPTLLKYGTPQKLVESECCQSSLVEMIF 120          
BLAST of SMED30024529 vs. UniProt/SwissProt
Match: sp|Q5REA8|TXD17_PONAB (Thioredoxin domain-containing protein 17 OS=Pongo abelii OX=9601 GN=TXNDC17 PE=2 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 3.434e-16
Identity = 38/121 (31.40%), Postives = 68/121 (56.20%), Query Frame = -1
Query:  179 EQLYIGNYDKYIGKIDELKSLQNSVILFFCGSTEESTGDSWCPDCRDAEPFIEKGMELCS-NLVFALVEVGYKDEWKSTENKFRCDSDLKLTEIPTLINLKKKNRLIGNQCTDSNLINEFF 538
            E++ +  ++++   +++      ++  +F GS +++ G SWCPDC  AEP + +G++  S   VF   +VG K  WK   N FR   +LK+T +PTLI      +L+ ++C  +NL+   F
Sbjct:    5 EEVSVSGFEEFHRAVEQHNG--KTIFAYFTGS-KDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFR--KNLKVTAVPTLIKYGTPQKLVESECLQANLVEMLF 120          
BLAST of SMED30024529 vs. UniProt/SwissProt
Match: sp|Q9BRA2|TXD17_HUMAN (Thioredoxin domain-containing protein 17 OS=Homo sapiens OX=9606 GN=TXNDC17 PE=1 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 8.450e-16
Identity = 37/121 (30.58%), Postives = 68/121 (56.20%), Query Frame = -1
Query:  179 EQLYIGNYDKYIGKIDELKSLQNSVILFFCGSTEESTGDSWCPDCRDAEPFIEKGMELCS-NLVFALVEVGYKDEWKSTENKFRCDSDLKLTEIPTLINLKKKNRLIGNQCTDSNLINEFF 538
            E++ +  ++++   +++      ++  +F GS +++ G SWCPDC  AEP + +G++  S   VF   +VG K  WK   N FR   +LK+T +PTL+      +L+ ++C  +NL+   F
Sbjct:    5 EEVSVSGFEEFHRAVEQHNG--KTIFAYFTGS-KDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFR--KNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLF 120          
BLAST of SMED30024529 vs. UniProt/SwissProt
Match: sp|Q9CQM5|TXD17_MOUSE (Thioredoxin domain-containing protein 17 OS=Mus musculus OX=10090 GN=Txndc17 PE=1 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 4.447e-15
Identity = 35/104 (33.65%), Postives = 57/104 (54.81%), Query Frame = -1
Query:  179 LKSLQNSVILFFCGSTEESTGDSWCPDCRDAEPFIEKGM-ELCSNLVFALVEVGYKDEWKSTENKFRCDSDLKLTEIPTLINLKKKNRLIGNQCTDSNLINEFF 487
            +K  +   I  +   ++++ G SWCPDC +AEP I +G+  +  + VF   +VG K  WK   N FR    LK+T +PTL+      +L+ ++C  S+L+   F
Sbjct:   19 VKEHEGKTIFAYFSGSKDTEGKSWCPDCVEAEPVIREGLKHVTEDCVFIYCQVGDKPYWKDPNNDFR--QKLKITAVPTLLKYGTPQKLVESECCQSSLVEMIF 120          
BLAST of SMED30024529 vs. UniProt/SwissProt
Match: sp|T1SH39|TXD17_EPICO (Thioredoxin domain-containing protein 17 OS=Epinephelus coioides OX=94232 PE=2 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 3.786e-14
Identity = 37/121 (30.58%), Postives = 63/121 (52.07%), Query Frame = -1
Query:  179 EQLYIGNYDKYIGKIDELKSLQNSVILFFCGSTEESTGDSWCPDCRDAEPFIEKGM-ELCSNLVFALVEVGYKDEWKSTENKFRCDSDLKLTEIPTLINLKKKNRLIGNQCTDSNLINEFF 538
            E++ +  YD++   + E K     +  +F G  ++++G SWCPDC  AEP +   M  L    VF   +VG +  WK + N F+    LKL+ +PTL+      +L+  +C  ++L+   F
Sbjct:    5 EEVNVRGYDEFCQAVSERKG--KDIFAYFSGD-KDASGKSWCPDCVTAEPIVRGQMSHLPEGSVFIYCQVGERAYWKDSTNAFK--KTLKLSGVPTLLRYGTPQKLVEEECFKADLVRMMF 120          
BLAST of SMED30024529 vs. UniProt/SwissProt
Match: sp|Q6DBT3|TXD17_DANRE (Thioredoxin domain-containing protein 17 OS=Danio rerio OX=7955 GN=txndc17 PE=2 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 3.104e-13
Identity = 36/121 (29.75%), Postives = 61/121 (50.41%), Query Frame = -1
Query:  179 EQLYIGNYDKYIGKIDELKSLQNSVILFFCGSTEESTGDSWCPDCRDAEPFIEKGM-ELCSNLVFALVEVGYKDEWKSTENKFRCDSDLKLTEIPTLINLKKKNRLIGNQCTDSNLINEFF 538
            E++ +  Y+++   + + K     +  +F G  +E  G SWCPDC  AEP +   +  L    VF   +VG +  WK + N F+    LKLT +PTL+      +L+  +C  ++L+   F
Sbjct:    5 EEVAVHGYEEFCKAVSDRKG--KEIFAYFSGDKDEH-GKSWCPDCVKAEPVVRAELPHLPEGTVFIYCQVGDRPYWKDSNNDFK--KTLKLTGVPTLLRYGTPQKLVEEECFKADLVRMMF 120          
BLAST of SMED30024529 vs. TrEMBL
Match: A0A0K2T6Y6 (Thioredoxin domaincontaining protein 17like [Musca domestica] (Fragment) OS=Lepeophtheirus salmonis OX=72036 PE=4 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 1.461e-21
Identity = 45/116 (38.79%), Postives = 70/116 (60.34%), Query Frame = -1
Query:  179 IGNYDKYIGKIDELKSLQNSVILFFCGSTEESTGDSWCPDCRDAEPFIEKGMELCSNLVFALVEVGYKDEWKSTENKFRCDSDLKLTEIPTLINLKKKNRLIGNQCTDSNLINEFF 526
            +  Y+ ++ K+ E+++L  ++ + F GS + S+G SWCPDC  AEP ++  M+  + + F  V VG +D WK  +  FR + D +L  IPTLI  K +++L G   TDSNLI   F
Sbjct:    5 VHGYEGFLSKVKEMEALGGTLAVLFTGSIDPSSGKSWCPDCVVAEPIVDSVMKDKTEVHFLRVFVGPRDFWKDPQCPFRTNPDTRLKSIPTLIIWKSQSKLDGYDITDSNLIAMLF 120          
BLAST of SMED30024529 vs. TrEMBL
Match: A0A3M6V4T7 (DUF953 domain-containing protein OS=Pocillopora damicornis OX=46731 GN=pdam_00014191 PE=4 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 1.555e-21
Identity = 49/120 (40.83%), Postives = 75/120 (62.50%), Query Frame = -1
Query:  179 QLYIGNYDKYIGKIDELKSLQNSVILFFCGSTEESTGDSWCPDCRDAEPFIEKGMELC-SNLVFALVEVGYKDEWKSTENKFRCDSDLKLTEIPTLINLKKKNRLIGNQCTDSNLINEFF 535
            QL +      +  ++E K  + +V+  F G+  E+ G+SWCPDCRDAEP +E  ++   S++VF LV VG K EWKS +N+FR + D KL EIPT+++     RL    C +S ++++FF
Sbjct:    8 QLQVEGLSNLMQTLEEHKGKRRTVM--FIGAMNEN-GESWCPDCRDAEPIVEAALKKAPSDMVFILVIVGDKPEWKSPDNEFRTNPDFKLKEIPTIVDYGTDKRLGCEDCKNSEIVDKFF 124          
BLAST of SMED30024529 vs. TrEMBL
Match: A0A4S2L3I7 (DUF953 domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_009946 PE=4 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 4.494e-21
Identity = 46/107 (42.99%), Postives = 66/107 (61.68%), Query Frame = -1
Query:  179 QNSVILFFCGSTEESTGDSWCPDCRDAEPFIEKGMELCSNL-VFALVEVGYKDEWKSTENKFRCDSDLKLTEIPTLIN-------LKKKNRLIGNQCTDSNLINEFF 475
            Q  V  FF G+T+  TGDSWCPDCR AEP +E+  +  S   +F + EVG +D WK+  N FR     KLTEIPTL++       +  ++RL+ + C D +L+++FF
Sbjct:   26 QLRVYAFFIGTTDPITGDSWCPDCRTAEPIVEEATKKMSEKDLFIMCEVGDRDHWKTATNPFRTHPVFKLTEIPTLLSFYLDVGEIAVRSRLVNDGCKDPDLVDKFF 132          
BLAST of SMED30024529 vs. TrEMBL
Match: D3PHN2 (Thioredoxin domain-containing protein 17 OS=Lepeophtheirus salmonis OX=72036 GN=TXD17 PE=2 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 6.011e-21
Identity = 44/116 (37.93%), Postives = 69/116 (59.48%), Query Frame = -1
Query:  179 IGNYDKYIGKIDELKSLQNSVILFFCGSTEESTGDSWCPDCRDAEPFIEKGMELCSNLVFALVEVGYKDEWKSTENKFRCDSDLKLTEIPTLINLKKKNRLIGNQCTDSNLINEFF 526
            +  Y+ ++ K+ E+++L  ++ + F GS + S+G SWCPDC  AEP ++  M+  + + F  V VG +D WK  +  FR + D +L  IPTLI  K +++L G   TD NLI   F
Sbjct:    5 VHGYEGFLSKVKEMEALGGTLAVLFTGSIDPSSGKSWCPDCVVAEPIVDSVMKDKTEVHFLRVFVGPRDFWKDPQCPFRTNPDTRLKSIPTLIIWKSQSKLDGYDITDPNLIAMLF 120          
BLAST of SMED30024529 vs. TrEMBL
Match: A0A4S2L317 (DUF953 domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_009946 PE=4 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 9.323e-21
Identity = 48/107 (44.86%), Postives = 64/107 (59.81%), Query Frame = -1
Query:  179 QNSVILFFCGSTEESTGDSWCPDCRDAEPFIEKGMELCSNL-VFALVEVGYKDEWKSTENKFRCDSDLKLTEIPTLIN-------LKKKNRLIGNQCTDSNLINEFF 475
            Q  V  FF G+T+  TGDSWCPDCR AEP +E+  +  S   +F + EVG +D WK+  N FR     KLTEIPTL++       +  K+RL+G+ C DS  +  FF
Sbjct:   26 QLRVYAFFIGTTDPITGDSWCPDCRTAEPIVEEATKKMSEKDLFIMCEVGDRDHWKTPTNPFRTHPVFKLTEIPTLLSFCLNSGEIGVKSRLLGDGCKDSAQVGTFF 132          
BLAST of SMED30024529 vs. Ensembl Cavefish
Match: txndc17 (thioredoxin domain containing 17 [Source:NCBI gene;Acc:103032862])

HSP 1 Score: 65.4698 bits (158), Expect = 1.060e-13
Identity = 36/121 (29.75%), Postives = 60/121 (49.59%), Query Frame = -1
Query:  179 EQLYIGNYDKYIGKIDELKSLQNSVILFFCGSTEESTGDSWCPDCRDAEPFIEKGM-ELCSNLVFALVEVGYKDEWKSTENKFRCDSDLKLTEIPTLINLKKKNRLIGNQCTDSNLINEFF 538
            E++ +  Y+++   + +       +  +F G  ++  G SWCPDC  AEP +   M  L    VF   +VG +  WK   N+F+    LKLT +PTL+      +L+  QC  ++L+   F
Sbjct:    5 EEVKVRGYEEFCKTVSDRAG--KDIFAYFSGDKDQQ-GQSWCPDCVKAEPVVRGEMNHLPEGSVFIYCQVGDRPYWKDPNNEFK--KTLKLTGVPTLLRYGTPQKLVEEQCFKADLVRMMF 120          
BLAST of SMED30024529 vs. Ensembl Cavefish
Match: txndc17 (thioredoxin domain containing 17 [Source:NCBI gene;Acc:103032862])

HSP 1 Score: 65.4698 bits (158), Expect = 1.060e-13
Identity = 36/121 (29.75%), Postives = 60/121 (49.59%), Query Frame = -1
Query:  179 EQLYIGNYDKYIGKIDELKSLQNSVILFFCGSTEESTGDSWCPDCRDAEPFIEKGM-ELCSNLVFALVEVGYKDEWKSTENKFRCDSDLKLTEIPTLINLKKKNRLIGNQCTDSNLINEFF 538
            E++ +  Y+++   + +       +  +F G  ++  G SWCPDC  AEP +   M  L    VF   +VG +  WK   N+F+    LKLT +PTL+      +L+  QC  ++L+   F
Sbjct:    5 EEVKVRGYEEFCKTVSDRAG--KDIFAYFSGDKDQQ-GQSWCPDCVKAEPVVRGEMNHLPEGSVFIYCQVGDRPYWKDPNNEFK--KTLKLTGVPTLLRYGTPQKLVEEQCFKADLVRMMF 120          
BLAST of SMED30024529 vs. Ensembl Sea Lamprey
Match: txndc17 (thioredoxin domain containing 17 [Source:NCBI gene;Acc:445062])

HSP 1 Score: 74.7146 bits (182), Expect = 6.193e-18
Identity = 38/123 (30.89%), Postives = 66/123 (53.66%), Query Frame = -1
Query:  179 SCEQLYIGNYDKYIGKIDELKSLQNSVILFFCGSTEESTGDSWCPDCRDAEPFIEKGM-ELCSNLVFALVEVGYKDEWKSTENKFRCDSDLKLTEIPTLINLKKKNRLIGNQCTDSNLINEFF 544
            SCE++ +  Y ++   +  L+  +  +   F GS +++ G+SWCPDC  AEP +   +  L    VF   +VG +  WK+ +N+FR    L+LT +PTL+      +L+  +C    L++  F
Sbjct:    3 SCEEVSVSGYAEFTSAVRRLQGRE--IFALFSGS-KDAGGESWCPDCVAAEPVVRSALNTLPEGAVFIYCQVGDRAYWKNKDNEFR--KQLQLTAVPTLLKYGSPQKLVEEECLKPELVSMLF 120          
BLAST of SMED30024529 vs. Ensembl Nematostella
Match: EDO42121 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2D0])

HSP 1 Score: 78.1814 bits (191), Expect = 6.971e-19
Identity = 48/130 (36.92%), Postives = 65/130 (50.00%), Query Frame = -1
Query:  179 FAMSCEQLYIGNYDKYIGKIDELKSLQNSVILFFCGSTEESTGDSWCPDCRDAEPFIEKGMELCSN----LVFALVEVGYKDEWKSTENKFRCDSDLKLTEIPTLINLKKKNRLIGN-QCTDSNLINEFF 553
             A    QL + N  +   KI+E K     + + F G+ +E TGDSWCPDC  AEP +EK +E         VF L  VG +  WK   N+FR    L+L  IPTL+        +G+ QC  + L+  FF
Sbjct:    1 MAGRIPQLQVENCAELFEKIEEQKG--KRIFVMFIGAIDE-TGDSWCPDCVRAEPNVEKAVENFQGDKNAAVFILAIVGDRPTWKDPNNEFRVHEKLRLKSIPTLMEWNTTKEPLGDEQCQKAELVESFF 127          
BLAST of SMED30024529 vs. Ensembl Medaka
Match: txndc17 (thioredoxin domain containing 17 [Source:NCBI gene;Acc:101163188])

HSP 1 Score: 65.0846 bits (157), Expect = 1.536e-13
Identity = 36/121 (29.75%), Postives = 61/121 (50.41%), Query Frame = -1
Query:  179 EQLYIGNYDKYIGKIDELKSLQNSVILFFCGSTEESTGDSWCPDCRDAEPFIEKGM-ELCSNLVFALVEVGYKDEWKSTENKFRCDSDLKLTEIPTLINLKKKNRLIGNQCTDSNLINEFF 538
            E++ +  Y+++   + + K     +  +F G T++  G SWCPDC  AEP +   M  L    VF   +VG +  WK   N+F+    LKL+ +PTL+      +L+  +C  + L+   F
Sbjct:    5 EEVNVHGYEEFCKAVSDRKG--KEIFAYFSG-TKDDKGTSWCPDCVTAEPIVRGEMSHLPDGSVFIYCQVGERAYWKDPNNEFK--KTLKLSGVPTLLRYGTPQKLVEEECFKAELVKMLF 120          
BLAST of SMED30024529 vs. Planmine SMEST
Match: SMESG000004003.1 (SMESG000004003.1)

HSP 1 Score: 214.157 bits (544), Expect = 3.459e-72
Identity = 104/104 (100.00%), Postives = 104/104 (100.00%), Query Frame = -1
Query:  236 MSCEQLYIGNYDKYIGKIDELKSLQNSVILFFCGSTEESTGDSWCPDCRDAEPFIEKGMELCSNLVFALVEVGYKDEWKSTENKFRCDSDLKLTEIPTLINLKK 547
            MSCEQLYIGNYDKYIGKIDELKSLQNSVILFFCGSTEESTGDSWCPDCRDAEPFIEKGMELCSNLVFALVEVGYKDEWKSTENKFRCDSDLKLTEIPTLINLKK
Sbjct:    1 MSCEQLYIGNYDKYIGKIDELKSLQNSVILFFCGSTEESTGDSWCPDCRDAEPFIEKGMELCSNLVFALVEVGYKDEWKSTENKFRCDSDLKLTEIPTLINLKK 104          
BLAST of SMED30024529 vs. Planmine SMEST
Match: SMESG000074476.1 (SMESG000074476.1)

HSP 1 Score: 67.781 bits (164), Expect = 1.148e-14
Identity = 38/99 (38.38%), Postives = 52/99 (52.53%), Query Frame = -1
Query:  173 VILFFCGSTEESTGDSWCPDCRDAEPFIEKGME-LCSNLVFALVEVGYKDEWKSTENKFRCDSDLKLTEIPTLINLKKKNRLIGNQCTDSNLINEFFLN 466
            + + F G T   TG SWCPDC  A P IEK +E    N +F  V VG ++++K  +  FR    + LT IPTL+      RL   +C   +LI E  +N
Sbjct:   24 IFVLFTGDTNSETGHSWCPDCVLANPVIEKMIEKFPKNAIFITVFVGNREQYKDLDCVFRKHPQITLTGIPTLMEFGTMKRLGPIECLSEDLI-ELLIN 121          
BLAST of SMED30024529 vs. Planmine SMEST
Match: SMESG000074476.1 (SMESG000074476.1)

HSP 1 Score: 61.6178 bits (148), Expect = 2.469e-12
Identity = 38/102 (37.25%), Postives = 51/102 (50.00%), Query Frame = -1
Query:  173 VILFFCGSTEESTGDSWCPDCRDAEPFIEKGME-LCSNLVFALVEVGYKDE---WKSTENKFRCDSDLKLTEIPTLINLKKKNRLIGNQCTDSNLINEFFLN 466
            + + F G T   TG SWCPDC  A P IEK +E    N +F  V VG ++    +K  +  FR    + LT IPTL+      RL   +C   +LI E  +N
Sbjct:   24 IFVLFTGDTNSETGHSWCPDCVLANPVIEKMIEKFPKNAIFITVFVGNREHDCRYKDLDCVFRKHPQITLTGIPTLMEFGTMKRLGPIECLSEDLI-ELLIN 124          
The following BLAST results are available for this feature:
BLAST of SMED30024529 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
TXNDC171.760e-1630.58thioredoxin domain containing 17 [Source:HGNC Symb... [more]
TXNDC175.491e-834.21thioredoxin domain containing 17 [Source:HGNC Symb... [more]
back to top
BLAST of SMED30024529 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Y71H2AR.14.801e-1335.71pep chromosome:WBcel235:III:2834663:2836261:1 gene... [more]
back to top
BLAST of SMED30024529 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cl6.912e-1834.19gene:FBgn0000318 transcript:FBtr0329967[more]
cl6.912e-1834.19gene:FBgn0000318 transcript:FBtr0079095[more]
cl6.912e-1834.19gene:FBgn0000318 transcript:FBtr0329968[more]
CG39395.090e-1033.66gene:FBgn0040396 transcript:FBtr0343600[more]
CG39395.090e-1033.66gene:FBgn0040396 transcript:FBtr0070508[more]
back to top
BLAST of SMED30024529 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
txndc174.112e-1429.75thioredoxin domain containing 17 [Source:NCBI gene... [more]
back to top
BLAST of SMED30024529 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30024529 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Txndc176.357e-1633.65thioredoxin domain containing 17 [Source:MGI Symbo... [more]
back to top
BLAST of SMED30024529 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5REA8|TXD17_PONAB3.434e-1631.40Thioredoxin domain-containing protein 17 OS=Pongo ... [more]
sp|Q9BRA2|TXD17_HUMAN8.450e-1630.58Thioredoxin domain-containing protein 17 OS=Homo s... [more]
sp|Q9CQM5|TXD17_MOUSE4.447e-1533.65Thioredoxin domain-containing protein 17 OS=Mus mu... [more]
sp|T1SH39|TXD17_EPICO3.786e-1430.58Thioredoxin domain-containing protein 17 OS=Epinep... [more]
sp|Q6DBT3|TXD17_DANRE3.104e-1329.75Thioredoxin domain-containing protein 17 OS=Danio ... [more]
back to top
BLAST of SMED30024529 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0K2T6Y61.461e-2138.79Thioredoxin domaincontaining protein 17like [Musca... [more]
A0A3M6V4T71.555e-2140.83DUF953 domain-containing protein OS=Pocillopora da... [more]
A0A4S2L3I74.494e-2142.99DUF953 domain-containing protein OS=Opisthorchis f... [more]
D3PHN26.011e-2137.93Thioredoxin domain-containing protein 17 OS=Lepeop... [more]
A0A4S2L3179.323e-2144.86DUF953 domain-containing protein OS=Opisthorchis f... [more]
back to top
BLAST of SMED30024529 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
txndc171.060e-1329.75thioredoxin domain containing 17 [Source:NCBI gene... [more]
txndc171.060e-1329.75thioredoxin domain containing 17 [Source:NCBI gene... [more]
back to top
BLAST of SMED30024529 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
txndc176.193e-1830.89thioredoxin domain containing 17 [Source:NCBI gene... [more]
back to top
BLAST of SMED30024529 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30024529 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO421216.971e-1936.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30024529 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
txndc171.536e-1329.75thioredoxin domain containing 17 [Source:NCBI gene... [more]
back to top
BLAST of SMED30024529 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000004003.13.459e-72100.00SMESG000004003.1[more]
SMESG000074476.11.148e-1438.38SMESG000074476.1[more]
SMESG000074476.12.469e-1237.25SMESG000074476.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024529 ID=SMED30024529|Name=SMED30024529|organism=Schmidtea mediterranea sexual|type=transcript|length=601bp
AAATAATGCAAATACAATATAAGTTCAACACAATTTCAATTAAACAGCCT
TTACATAAATAACTCAAAATAAATTTGATCCTAATTATGAAATTTGAAAA
ACAATATCACATAATTAGTAATAGTAATAAACAAATCACCAATTTTATTG
CGTGTCAAAAATCAAATCAAATATTTAGAAAAAACTCATTAATTAAATTT
GAATCCGTGCATTGATTGCCGATTAATCGATTTTTCTTTTTTAAATTTAT
GAGAGTTGGAATTTCAGTTAATTTCAAATCAGAATCGCATCTAAATTTAT
TTTCAGTTGATTTCCATTCGTCTTTATAGCCAACTTCCACCAAAGCAAAT
ACCAAGTTACTACACAATTCCATTCCTTTTTCAATAAAAGGCTCAGCATC
ACGACAATCAGGGCACCAACTATCACCAGTTGATTCTTCAGTAGACCCGC
AGAAAAATAAAATCACCGAATTTTGTAAAGATTTAAGCTCATCAATTTTT
CCTATATATTTGTCATAATTTCCAATATATAATTGTTCACATGACATCGC
AAAAACTTTATTGAGTTTACTCTTAATAAAATTCGGTGATTTTATTTTTC
A
back to top

protein sequence of SMED30024529-orf-1

>SMED30024529-orf-1 ID=SMED30024529-orf-1|Name=SMED30024529-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=127bp
MSCEQLYIGNYDKYIGKIDELKSLQNSVILFFCGSTEESTGDSWCPDCRD
AEPFIEKGMELCSNLVFALVEVGYKDEWKSTENKFRCDSDLKLTEIPTLI
NLKKKNRLIGNQCTDSNLINEFFLNI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
Vocabulary: INTERPRO
TermDefinition
IPR036249Thioredoxin-like_sf
IPR010357DUF953_thioredox
IPR012336Thioredoxin-like_fold
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR010357Domain of unknown function DUF953, thioredoxin-likePFAMPF06110DUF953coord: 26..135
e-value: 1.2E-28
score: 99.1
IPR036249Thioredoxin-like superfamilyGENE3DG3DSA:3.40.30.10coord: 8..137
e-value: 4.2E-33
score: 115.9
IPR036249Thioredoxin-like superfamilySUPERFAMILYSSF52833Thioredoxin-likecoord: 30..132
NoneNo IPR availablePANTHERPTHR1245242-9-9 PROTEIN-RELATEDcoord: 21..136