Potassium channel subfamily K member 18

Overview
NamePotassium channel subfamily K member 18
Smed IDSMED30024528
Length (bp)2093
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Potassium channel subfamily K member 18 (SMED30024528) t-SNE clustered cells

Violin plots show distribution of expression levels for Potassium channel subfamily K member 18 (SMED30024528) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Potassium channel subfamily K member 18 (SMED30024528) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Potassium channel subfamily K member 18 (SMED30024528) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024528

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30024528h1SMcG0013184 dd_Smed_v4_23109_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30024528h1SMcG0013184 dd_Smed_v4_23109_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30024528h1SMcG0013184 dd_Smed_v4_23109_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30024528h1SMcG0013184 dd_Smed_v4_23109_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
anterior sideSMED30024528h1SMcG0013184 dd_Smed_v4_23109_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Human
Match: KCNK18 (potassium two pore domain channel subfamily K member 18 [Source:HGNC Symbol;Acc:HGNC:19439])

HSP 1 Score: 65.855 bits (159), Expect = 9.160e-11
Identity = 37/107 (34.58%), Postives = 58/107 (54.21%), Query Frame = 2
Query: 1157 FIESLTKNFENLTETVFDVTKDGWIHENGHIGTEKGSG---KTLWTFGGSILYCITVITTIGYGHITPKTIPGRFGTIIYAIFGIPIMLICLAHIGSLMANMFRLIY 1468
            F+E L +   N +ETV +  K       GH+   K       T W+F  S+ +C TV +T+GYG+I P T  G++  ++YA+FGIP+M + L   G ++A +    Y
Sbjct:   61 FLEELCRIL-NCSETVVEDRKQDL---QGHLQKVKPQWFNRTTHWSFLSSLFFCCTVFSTVGYGYIYPVTRLGKYLCMLYALFGIPLMFLVLTDTGDILATILSTSY 163          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Human
Match: KCNK9 (potassium two pore domain channel subfamily K member 9 [Source:HGNC Symbol;Acc:HGNC:6283])

HSP 1 Score: 62.3882 bits (150), Expect = 1.127e-9
Identity = 28/73 (38.36%), Postives = 38/73 (52.05%), Query Frame = 2
Query: 1253 TEKGSGKTLWTFGGSILYCITVITTIGYGHITPKTIPGRFGTIIYAIFGIPIMLICLAHIGSLMANMFRLIYR 1471
            +E       W F GS  + ITVITTIGYGH  P T  G+   + YA+ GIP+ L+    +G  M    R + +
Sbjct:   69 SEPHRAGVQWKFAGSFYFAITVITTIGYGHAAPGTDAGKAFCMFYAVLGIPLTLVMFQSLGERMNTFVRYLLK 141          

HSP 2 Score: 51.2174 bits (121), Expect = 4.835e-6
Identity = 25/63 (39.68%), Postives = 39/63 (61.90%), Query Frame = 2
Query: 1781 VGSVFFTICEGWKITDSFYFSFITLSTIGFGDFVPVAIGNEAEQYKSIMCSF---YVLFGLSL 1960
            +G+  F+ CE W    ++Y+ FITL+TIGFGD+V +     A Q K +  +F   Y+L GL++
Sbjct:  173 IGAAAFSQCEEWSFFHAYYYCFITLTTIGFGDYVALQTKG-ALQKKPLYVAFSFMYILVGLTV 234          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Human
Match: KCNK9 (potassium two pore domain channel subfamily K member 9 [Source:HGNC Symbol;Acc:HGNC:6283])

HSP 1 Score: 62.3882 bits (150), Expect = 1.127e-9
Identity = 28/73 (38.36%), Postives = 38/73 (52.05%), Query Frame = 2
Query: 1253 TEKGSGKTLWTFGGSILYCITVITTIGYGHITPKTIPGRFGTIIYAIFGIPIMLICLAHIGSLMANMFRLIYR 1471
            +E       W F GS  + ITVITTIGYGH  P T  G+   + YA+ GIP+ L+    +G  M    R + +
Sbjct:   69 SEPHRAGVQWKFAGSFYFAITVITTIGYGHAAPGTDAGKAFCMFYAVLGIPLTLVMFQSLGERMNTFVRYLLK 141          

HSP 2 Score: 51.2174 bits (121), Expect = 4.835e-6
Identity = 25/63 (39.68%), Postives = 39/63 (61.90%), Query Frame = 2
Query: 1781 VGSVFFTICEGWKITDSFYFSFITLSTIGFGDFVPVAIGNEAEQYKSIMCSF---YVLFGLSL 1960
            +G+  F+ CE W    ++Y+ FITL+TIGFGD+V +     A Q K +  +F   Y+L GL++
Sbjct:  173 IGAAAFSQCEEWSFFHAYYYCFITLTTIGFGDYVALQTKG-ALQKKPLYVAFSFMYILVGLTV 234          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Human
Match: KCNK9 (potassium two pore domain channel subfamily K member 9 [Source:HGNC Symbol;Acc:HGNC:6283])

HSP 1 Score: 62.3882 bits (150), Expect = 1.127e-9
Identity = 28/73 (38.36%), Postives = 38/73 (52.05%), Query Frame = 2
Query: 1253 TEKGSGKTLWTFGGSILYCITVITTIGYGHITPKTIPGRFGTIIYAIFGIPIMLICLAHIGSLMANMFRLIYR 1471
            +E       W F GS  + ITVITTIGYGH  P T  G+   + YA+ GIP+ L+    +G  M    R + +
Sbjct:   69 SEPHRAGVQWKFAGSFYFAITVITTIGYGHAAPGTDAGKAFCMFYAVLGIPLTLVMFQSLGERMNTFVRYLLK 141          

HSP 2 Score: 51.2174 bits (121), Expect = 4.835e-6
Identity = 25/63 (39.68%), Postives = 39/63 (61.90%), Query Frame = 2
Query: 1781 VGSVFFTICEGWKITDSFYFSFITLSTIGFGDFVPVAIGNEAEQYKSIMCSF---YVLFGLSL 1960
            +G+  F+ CE W    ++Y+ FITL+TIGFGD+V +     A Q K +  +F   Y+L GL++
Sbjct:  173 IGAAAFSQCEEWSFFHAYYYCFITLTTIGFGDYVALQTKG-ALQKKPLYVAFSFMYILVGLTV 234          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Human
Match: KCNK9 (potassium two pore domain channel subfamily K member 9 [Source:HGNC Symbol;Acc:HGNC:6283])

HSP 1 Score: 62.3882 bits (150), Expect = 1.127e-9
Identity = 28/73 (38.36%), Postives = 38/73 (52.05%), Query Frame = 2
Query: 1253 TEKGSGKTLWTFGGSILYCITVITTIGYGHITPKTIPGRFGTIIYAIFGIPIMLICLAHIGSLMANMFRLIYR 1471
            +E       W F GS  + ITVITTIGYGH  P T  G+   + YA+ GIP+ L+    +G  M    R + +
Sbjct:   69 SEPHRAGVQWKFAGSFYFAITVITTIGYGHAAPGTDAGKAFCMFYAVLGIPLTLVMFQSLGERMNTFVRYLLK 141          

HSP 2 Score: 51.2174 bits (121), Expect = 4.835e-6
Identity = 25/63 (39.68%), Postives = 39/63 (61.90%), Query Frame = 2
Query: 1781 VGSVFFTICEGWKITDSFYFSFITLSTIGFGDFVPVAIGNEAEQYKSIMCSF---YVLFGLSL 1960
            +G+  F+ CE W    ++Y+ FITL+TIGFGD+V +     A Q K +  +F   Y+L GL++
Sbjct:  173 IGAAAFSQCEEWSFFHAYYYCFITLTTIGFGDYVALQTKG-ALQKKPLYVAFSFMYILVGLTV 234          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Celegans
Match: twk-48 (TWiK family of potassium channels [Source:UniProtKB/TrEMBL;Acc:Q7YWY7])

HSP 1 Score: 135.191 bits (339), Expect = 2.347e-34
Identity = 89/256 (34.77%), Postives = 134/256 (52.34%), Query Frame = 2
Query: 1235 ENGHIGTEKGSGKTLWTFGGSILYCITVITTIGYGHITPKTIPGRFGTIIYAIFGIPIMLICLAHIGSLMANMFRLIYRVSCLXXXXXXXXXXXXXXXXXXXXXXTSNELLDKSDDEDNQISLTVVKNPHNPTGNYFGSTVQFRKILFHIPNPNRLL---EAAKKSKSVEVPVSLVITVFIIYNLVGSVFFTICEGWKITDSFYFSFITLSTIGFGDFVP-VAIGNEAE-QYKSIMCSFYVLFGLSLCVMSFDLME 1987
              G+ G E G  +  WTF G+ LY +TVITTIGYG+   KT  G+  T++YAI GIP+ML+ L +IG +MA +FR +Y  S     +   +      +    +   +N L+ +            VK   +      G+      +L       +L     AA + +S+ VP+SLV+   + Y  VG+  F + EGW   +SFYF FI+L+TIGFGD  P  ++ N  E Q K ++ S Y+LFG++L  M F+L +
Sbjct:  106 RKGYDGKEYGK-QAQWTFTGAFLYSLTVITTIGYGNTAAKTYIGKTLTMLYAIIGIPLMLLFLTNIGDVMAKIFRFLYAQSI----RLKFRLILWHKKRKAAKIRRANSLVSRLTRGHR------VKADSSVDSFGLGAGADVEDLLTARVEMEQLEVRETAAAQLESMTVPISLVVFTMLGYLGVGTTIFKVWEGWTFLESFYFCFISLTTIGFGDKFPSTSVSNTDEAQEKLVITSIYLLFGMALLAMCFNLAQ 350          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Celegans
Match: twk-18 (TWiK family of potassium channels protein 18 [Source:UniProtKB/Swiss-Prot;Acc:Q18120])

HSP 1 Score: 94.3597 bits (233), Expect = 3.336e-20
Identity = 66/202 (32.67%), Postives = 94/202 (46.53%), Query Frame = 2
Query: 1280 WTFGGSILYCITVITTIGYGHITPKTIPGRFGTIIYAIFGIPIMLICLAHIGSLMANMFRLIYRVSCLXXXXXXXXXXXXXXXXXXXXXXTSNELLDKSDDEDNQISLTVVKNPHNPTGNYFGSTVQFRKILFHIPNPNRLLEAAKKSKSVEVPVSLVITVFIIYNLVGSVFFTICEGWKITDSFYFSFITLSTIGFGDFVP 1885
            WTF GSI YC+TV TTIGYG+I P T  GRF TI+YA  GIP+ ++ L  +GSL A   ++++R                           SN++ + +D+ +     T +      T N                N + LL       S  +   L+ITV  I+ +  +V FT  E W    S YF+ I+ +TIGFGD +P
Sbjct:  114 WTFLGSIFYCMTVYTTIGYGNIVPGTGWGRFATILYAFIGIPLTVLSLYCLGSLFAKGCKMLWRF--------------FLKSTRVVSKDLSNKISEAADNIEE--GTTAITPSAEKTEN----------------NDDDLL-------SFPISGLLLITV--IWVIFCAVLFTFLEEWDFGTSLYFTLISFTTIGFGDILP 274          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Celegans
Match: twk-18 (TWiK family of potassium channels protein 18 [Source:UniProtKB/Swiss-Prot;Acc:Q18120])

HSP 1 Score: 94.3597 bits (233), Expect = 3.336e-20
Identity = 66/202 (32.67%), Postives = 94/202 (46.53%), Query Frame = 2
Query: 1280 WTFGGSILYCITVITTIGYGHITPKTIPGRFGTIIYAIFGIPIMLICLAHIGSLMANMFRLIYRVSCLXXXXXXXXXXXXXXXXXXXXXXTSNELLDKSDDEDNQISLTVVKNPHNPTGNYFGSTVQFRKILFHIPNPNRLLEAAKKSKSVEVPVSLVITVFIIYNLVGSVFFTICEGWKITDSFYFSFITLSTIGFGDFVP 1885
            WTF GSI YC+TV TTIGYG+I P T  GRF TI+YA  GIP+ ++ L  +GSL A   ++++R                           SN++ + +D+ +     T +      T N                N + LL       S  +   L+ITV  I+ +  +V FT  E W    S YF+ I+ +TIGFGD +P
Sbjct:  114 WTFLGSIFYCMTVYTTIGYGNIVPGTGWGRFATILYAFIGIPLTVLSLYCLGSLFAKGCKMLWRF--------------FLKSTRVVSKDLSNKISEAADNIEE--GTTAITPSAEKTEN----------------NDDDLL-------SFPISGLLLITV--IWVIFCAVLFTFLEEWDFGTSLYFTLISFTTIGFGDILP 274          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Celegans
Match: twk-2 (TWiK family of potassium channels [Source:UniProtKB/TrEMBL;Acc:A0A2X0SX30])

HSP 1 Score: 94.3597 bits (233), Expect = 1.606e-19
Identity = 66/250 (26.40%), Postives = 113/250 (45.20%), Query Frame = 2
Query: 1232 HENGHIGTEKGSGKTLWTFGGSILYCITVITTIGYGHITPKTIPGRFGTIIYAIFGIPIMLICLAHIGSLMANMFRLIYRVSCLXXXXXXXXXXXXXXXXXXXXXXTSNELLDKSDDEDNQISLTVVKNPHNPTGNYFGSTVQFRKILFHIPNPNRLLEAAKKSKSVEVPVSLVITVFIIYNLVGSVFFTICEGWKITDSFYFSFITLSTIGFGDFVPVAIGNEAEQYKSIMCSFYVLFGLSLCVMSFDL 1981
            H +G+   ++GS K +WT   ++ +  T + TIGYG+I P T  GR   +++A+FG PI +I +  +G  ++     +Y+                            +  LD +      +  ++  +  + + N   S +               ++   KS+   + V  +I ++I +   G + F+I E W   D+FY+SFI+L+TIGFGD VP     E   Y +IM   Y+  GLS+  M  DL
Sbjct:  149 HRHGNKRGDRGSEK-MWTTSSALFFAATTMATIGYGNIVPVTPLGRLACVLFALFGAPIAIITIGDLGKFLSECTIWLYK-----------------------HMRKGSARLDSAWKRFRGLEDSISDDLESASKNQDSSILDMD------------MDEIDKSEVPVLMVFTIILLYIAF---GGILFSILEDWSYMDAFYYSFISLTTIGFGDIVP-----ENHDYIAIML-IYLGVGLSVTTMCIDL 353          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Celegans
Match: twk-39 (TWiK family of potassium channels [Source:UniProtKB/TrEMBL;Acc:A1EHR5])

HSP 1 Score: 91.2781 bits (225), Expect = 8.508e-19
Identity = 39/63 (61.90%), Postives = 48/63 (76.19%), Query Frame = 2
Query: 1280 WTFGGSILYCITVITTIGYGHITPKTIPGRFGTIIYAIFGIPIMLICLAHIGSLMANMFRLIY 1468
            WTF G++LY ITV TTIGYGHI PKT  GR  TI+Y+I GIP+ML+CLA+I   +A +F  IY
Sbjct:  121 WTFSGALLYSITVFTTIGYGHICPKTDTGRLLTILYSILGIPLMLLCLANIAETLAQVFTYIY 183          

HSP 2 Score: 77.7962 bits (190), Expect = 1.173e-14
Identity = 36/85 (42.35%), Postives = 52/85 (61.18%), Query Frame = 2
Query: 1733 EVPVSLVITVFIIYNLVGSVFFTICEGWKITDSFYFSFITLSTIGFGDFVPVAIGNEAEQYKSIMCSFYVLFGLSLCVMSFDLME 1987
            ++PVS+ I +   +   G+  F+  E W   D  Y+ FITLSTIGFGD VP    +E  Q K ++C+ Y+LFG++L  M F LM+
Sbjct:  491 KMPVSVGICIVFAFISGGAWLFSWWENWNGFDGAYYCFITLSTIGFGDIVPGQALDEGSQEKLVVCALYLLFGMALIAMCFKLMQ 575          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Fly
Match: CG34396 (gene:FBgn0085425 transcript:FBtr0112645)

HSP 1 Score: 116.701 bits (291), Expect = 1.553e-26
Identity = 81/262 (30.92%), Postives = 119/262 (45.42%), Query Frame = 2
Query: 1241 GHIGTEKGSGKTLWTFGGSILYCITVITTIGYGHITPKTIPGRFGTIIYAIFGIPIMLICLAHIGSLMAN--------MFRLIYRVSCLXXXXXXXXXXXXXXXXXXXXXXTSNELL-----DKSDDEDNQISLTVVK-----NPHNPTGNYFGSTVQFRKILFHIPNPNRLLEAAKKSKSVEVPVSLVITVFIIYNLVGSVFFTICE-GWKITDSFYFSFITLSTIGFGDFVPVAIGNEAEQYKSIMCSFYVLFGLSLCVM 1969
              +G  +  G+  W F    ++C TVITTIGYGHITPKT  GR  TI+YAI GIP+ LI LA +G L           + R+ Y  SC +  K+ +        N+    +     +        +DE++Q      +     +P  PT  Y                     E  +      +PVS+   + I Y L+GS  F + E  W   D+FY+ FI++STIGFGD VP      +  +  ++   Y++FGL+L  M
Sbjct:  601 AELGLRRYPGQKSWNFVNCFIFCWTVITTIGYGHITPKTGMGRSLTIVYAIIGIPMFLIVLADLGKLFTRCVKFLWVYVRRMYYTRSCRRIRKQQQIRSAMTGFNTMYDMAIRRPSMFFSNSAPENDEESQADAEAARSVGTSHPETPTSPY--------------------PETFEVDDEFNLPVSVASLLLITYILLGSFGFLMMEPSWTPLDAFYYVFISMSTIGFGDLVP------SNPFYVMVSMIYLMFGLALTSM 836          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Fly
Match: CG34396 (gene:FBgn0085425 transcript:FBtr0112644)

HSP 1 Score: 107.071 bits (266), Expect = 6.419e-24
Identity = 77/255 (30.20%), Postives = 119/255 (46.67%), Query Frame = 2
Query: 1280 WTFGGSILYCITVITTIGYGHITPKTIPGRFGTIIYAIFGIPIMLICLAHIGSLMAN--------MFRLIYRVSCLXXXXXXXXXXXXXXXXXXXXXXTSNELL-----DKSDDEDNQISLTVVK-----NPHNPTGNYFGSTVQFRKILFHIPNPNRLLEAAKKSKSVEVPVSLVITVFIIYNLVGSVFFTICE-GWKITDSFYFSFITLSTIGFGDFVPVAIGNEAEQYKSIMCSFYVLFGLSLCVMSFDLME 1987
            W+F  +++Y  T+ TTIGYGHITPKT  GR  TI+YAI GIP+ LI LA +G L           + R+ Y  SC +  K+ +        N+    +     +        +DE++Q      +     +P  PT  Y                     E  +      +PVS+   + I Y L+GS  F + E  W   D+FY+ FI++STIGFGD VP      +  +  ++   Y++FGL+L  M  ++++
Sbjct:  203 WSFWDAMVYSATIYTTIGYGHITPKTGMGRSLTIVYAIIGIPMFLIVLADLGKLFTRCVKFLWVYVRRMYYTRSCRRIRKQQQIRSAMTGFNTMYDMAIRRPSMFFSNSAPENDEESQADAEAARSVGTSHPETPTSPY--------------------PETFEVDDEFNLPVSVASLLLITYILLGSFGFLMMEPSWTPLDAFYYVFISMSTIGFGDLVP------SNPFYVMVSMIYLMFGLALTSMFINVVQ 431          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Fly
Match: CG9194 (gene:FBgn0035192 transcript:FBtr0072651)

HSP 1 Score: 102.449 bits (254), Expect = 3.066e-22
Identity = 51/123 (41.46%), Postives = 78/123 (63.41%), Query Frame = 2
Query: 1118 LIGNNLSLRQKSSFIESLTKNFENLTETVFDVTK-DGWIHENGHIGTEKGSGKTLWTFGGSILYCITVITTIGYGHITPKTIPGRFGTIIYAIFGIPIMLICLAHIGSLMANMFRLIY-RVSC 1480
            L+ ++  + ++S ++ +++K+  N  + +    K DGW         ++   K+ WTF GS+ Y I VITTIGYGHI+P+T  G+  TI YAI GIP+MLICL++IG +MA  FR +Y R+ C
Sbjct:   87 LLSDDAVVLRESDWMANVSKHLANFEKQILTAIKADGW-------DGDEDLRKSQWTFAGSLFYSIIVITTIGYGHISPRTDWGKVTTIFYAIVGIPLMLICLSNIGDVMATSFRFLYWRICC 202          

HSP 2 Score: 85.8853 bits (211), Expect = 6.070e-17
Identity = 44/90 (48.89%), Postives = 59/90 (65.56%), Query Frame = 2
Query: 1724 KSVEVPVSLVITVFIIYNLVGSVFFTICEGWKITDSFYFSFITLSTIGFGDFVPV-AIGNEAEQYKSIM-CSFYVLFGLSLCVMSFDLME 1987
            K   VP+ L + + + Y L G+V F   E W   DS YF FITL+TIGFGDFVP   + +E+EQ  SI  CS Y+LFG++L  MSF+L++
Sbjct:  615 KDRPVPIWLCVFLVVSYILGGAVLFAYWENWSFLDSAYFCFITLTTIGFGDFVPAKGVKDESEQ--SIAYCSLYLLFGIALLAMSFNLVQ 702          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Fly
Match: CG10864 (gene:FBgn0038621 transcript:FBtr0083654)

HSP 1 Score: 99.3673 bits (246), Expect = 4.876e-22
Identity = 73/282 (25.89%), Postives = 124/282 (43.97%), Query Frame = 2
Query: 1079 FINMKYNGKDINSLIGNNLSLRQK-SSFIESLTK-----NFENLTETVFDVTKD-----GWIHENGHIGTEKGSGKTLWTFGGSILYCITVITTIGYGHITPKTIPGRFGTIIYAIFGIPIMLICLAHIGSLMANMFRLIYRVSCLXXXXXXXXXXXXXXXXXXXXXXTSNELLDKSDDEDNQISLTVVKNPHNPTGNYFGSTVQFRKILFHIPNPNRLLEAAKKSKSVEVPVSLVITVFIIYNLVGSVFFTICEGWKITDSFYFSFITLSTIGFGDFVPVA 1891
            F  M    + ++   G+ + LRQ  S  + S+T+     +    TE   DV ++       + ++G++G    S + +W+F  ++++C++VIT IGYG++ P+T  G+  T+IYA FGIP+ ++   ++G ++A  F+ +YR                    S    +  +  LD+ D  +  + +T                                       K V VP +  + V   Y L G+V F   E W + +SFYF   +L  IGFGDFVP A
Sbjct:   66 FAFMHIERQFVDETAGHVMELRQNCSQQLWSITEQHNIIDRRRWTEATNDVLREYQSQIAGVVKHGYVGR---SPEQIWSFPAALMFCLSVITMIGYGNMVPRTPWGKGFTVIYATFGIPLYILYFLNMGRVLARSFKFLYR--------------------SLHDCTQEHPRLDRMDALEGGVGMT--------------------------------------RKKVIVPSTACLWVIFFYVLTGTVMFANWEKWSLLNSFYFCMTSLCKIGFGDFVPGA 286          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Fly
Match: CG1688 (gene:FBgn0027589 transcript:FBtr0088495)

HSP 1 Score: 85.8853 bits (211), Expect = 5.568e-17
Identity = 36/81 (44.44%), Postives = 58/81 (71.60%), Query Frame = 2
Query: 1241 GHIGTEKGSGKTLWTFGGSILYCITVITTIGYGHITPKTIPGRFGTIIYAIFGIPIMLICLAHIGSLMANMFRLIY-RVSC 1480
            GH G + G  ++ W+F  ++LY +TVITTIG+G +TP+T  G+  TI YA+ G+P+ML+CL+ +G+L+A+  +  Y R+ C
Sbjct:  179 GHFGYDAGDSQS-WSFSEALLYSVTVITTIGHGSLTPRTAAGKLATIFYALVGVPLMLMCLSSLGALLADGLQCTYVRLCC 258          

HSP 2 Score: 82.4185 bits (202), Expect = 7.003e-16
Identity = 40/87 (45.98%), Postives = 53/87 (60.92%), Query Frame = 2
Query: 1733 EVPVSLVITVFIIYNLVGSVFFTICEGWKITDSFYFSFITLSTIGFGDFVPVAI--GNEAEQYKSIMCSFYVLFGLSLCVMSFDLME 1987
            +VP+SLV+ +   Y  VG+V F + E W + D  YF F+TLSTIG+GDFVP     G E + Y    C  Y+L GL L  MSF ++E
Sbjct:  814 QVPISLVLLILASYICVGTVIFALWENWSLVDGAYFCFVTLSTIGYGDFVPARSFNGPELQLYA---CCAYLLLGLVLVAMSFSILE 897          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Zebrafish
Match: kcnk18 (potassium channel, subfamily K, member 18 [Source:ZFIN;Acc:ZDB-GENE-100405-2])

HSP 1 Score: 70.8626 bits (172), Expect = 1.409e-12
Identity = 37/112 (33.04%), Postives = 62/112 (55.36%), Query Frame = 2
Query: 1133 LSLRQKSSFIESLTKNFENLTETVFDVTKDGWIHENGHIGTEKGSGKTLWTFGGSILYCITVITTIGYGHITPKTIPGRFGTIIYAIFGIPIMLICLAHIGSLMANMFRLIY 1468
            LS+ QK   +  + +N  + +E    + K  +I ++     E+  G   WTF  S+ +C TV TT+GYG I P T  G+   ++YA+ GIP+ML+ ++ +G L+A +    Y
Sbjct:   57 LSIVQK---VMEIVQNHTDASEQKHLINKAKYILDDYCYEKERDHG---WTFFASLFFCCTVFTTVGYGRIYPLTSKGKVACVLYAMVGIPLMLLVISDVGDLLAVLLSKAY 162          

HSP 2 Score: 52.373 bits (124), Expect = 1.126e-6
Identity = 33/108 (30.56%), Postives = 61/108 (56.48%), Query Frame = 2
Query: 1679 HIPNPNRLL--EAAKKSKSVEVPVSLVITVFIIYNLVGSVFFTICEGWKI----TDSFYFSFITLSTIGFGDFVPVAIGNEAEQYKSIMCSF-YVLFGLSLCVMSFDL 1981
             +P P   L  +  ++ + ++VP+ +++ +   Y ++ S    I + W+     +D+FYF+FITL+TIGFGD VP       E  K  M +F +++ G+++  M+F L
Sbjct:  264 RVPTPKDELFNDIGQEMEQLDVPLLVILLMVFAYMVICS---QILKCWEKQMDHSDAFYFTFITLTTIGFGDIVP-------EHPKFFMVTFLFIITGMAIMSMAFKL 361          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Zebrafish
Match: kcnk18 (potassium channel, subfamily K, member 18 [Source:ZFIN;Acc:ZDB-GENE-100405-2])

HSP 1 Score: 70.8626 bits (172), Expect = 1.483e-12
Identity = 37/112 (33.04%), Postives = 62/112 (55.36%), Query Frame = 2
Query: 1133 LSLRQKSSFIESLTKNFENLTETVFDVTKDGWIHENGHIGTEKGSGKTLWTFGGSILYCITVITTIGYGHITPKTIPGRFGTIIYAIFGIPIMLICLAHIGSLMANMFRLIY 1468
            LS+ QK   +  + +N  + +E    + K  +I ++     E+  G   WTF  S+ +C TV TT+GYG I P T  G+   ++YA+ GIP+ML+ ++ +G L+A +    Y
Sbjct:   57 LSIVQK---VMEIVQNHTDASEQKHLINKAKYILDDYCYEKERDHG---WTFFASLFFCCTVFTTVGYGRIYPLTSKGKVACVLYAMVGIPLMLLVISDVGDLLAVLLSKAY 162          

HSP 2 Score: 52.373 bits (124), Expect = 1.101e-6
Identity = 33/108 (30.56%), Postives = 61/108 (56.48%), Query Frame = 2
Query: 1679 HIPNPNRLL--EAAKKSKSVEVPVSLVITVFIIYNLVGSVFFTICEGWKI----TDSFYFSFITLSTIGFGDFVPVAIGNEAEQYKSIMCSF-YVLFGLSLCVMSFDL 1981
             +P P   L  +  ++ + ++VP+ +++ +   Y ++ S    I + W+     +D+FYF+FITL+TIGFGD VP       E  K  M +F +++ G+++  M+F L
Sbjct:  264 RVPTPKDELFNDIGQEMEQLDVPLLVILLMVFAYMVICS---QILKCWEKQMDHSDAFYFTFITLTTIGFGDIVP-------EHPKFFMVTFLFIITGMAIMSMAFKL 361          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Zebrafish
Match: kcnk18 (potassium channel, subfamily K, member 18 [Source:ZFIN;Acc:ZDB-GENE-100405-2])

HSP 1 Score: 68.5514 bits (166), Expect = 9.579e-12
Identity = 37/112 (33.04%), Postives = 61/112 (54.46%), Query Frame = 2
Query: 1133 LSLRQKSSFIESLTKNFENLTETVFDVTKDGWIHENGHIGTEKGSGKTLWTFGGSILYCITVITTIGYGHITPKTIPGRFGTIIYAIFGIPIMLICLAHIGSLMANMFRLIY 1468
            LS+ QK   +  + +N  + +E    + K   I ++     E+  G   WTF  S+ +C TV TT+GYG I P T  G+   ++YA+ GIP+ML+ ++ +G L+A +    Y
Sbjct:   57 LSIVQK---VMEIVQNHTDTSEQKHLINKAKDILDDYCYEKERDHG---WTFFASLFFCCTVFTTVGYGRIYPLTSKGKVACVLYAMVGIPLMLLVISDVGDLLAVLLSKAY 162          

HSP 2 Score: 52.7582 bits (125), Expect = 9.621e-7
Identity = 33/108 (30.56%), Postives = 61/108 (56.48%), Query Frame = 2
Query: 1679 HIPNPNRLL--EAAKKSKSVEVPVSLVITVFIIYNLVGSVFFTICEGWKI----TDSFYFSFITLSTIGFGDFVPVAIGNEAEQYKSIMCSF-YVLFGLSLCVMSFDL 1981
             +P P   L  +  ++ + ++VP+ +++ +   Y ++ S    I + W+     +D+FYF+FITL+TIGFGD VP       E  K  M +F +++ G+++  M+F L
Sbjct:  264 RVPTPKDELFNDIGQEMEQLDVPLLVILLMVFAYMVICS---QILKCWEKQMDHSDAFYFTFITLTTIGFGDIVP-------EHPKFFMVTFLFIITGMAIMSMAFKL 361          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Zebrafish
Match: kcnk15 (potassium channel, subfamily K, member 15 [Source:ZFIN;Acc:ZDB-GENE-080220-30])

HSP 1 Score: 62.3882 bits (150), Expect = 6.458e-10
Identity = 29/71 (40.85%), Postives = 37/71 (52.11%), Query Frame = 2
Query: 1253 TEKGSGKTLWTFGGSILYCITVITTIGYGHITPKTIPGRFGTIIYAIFGIPIMLICLAHIGSLMANMFRLI 1465
             E     T W F GS  + ITVITTIGYGH  P T  G+   ++YA  GIP+ L+    +G  M    R +
Sbjct:   69 AEPHRAGTQWRFAGSFYFAITVITTIGYGHAAPGTDAGKLFCMLYAGLGIPLTLVMFQSLGERMNTGVRFL 139          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Zebrafish
Match: kcnk10b (potassium channel, subfamily K, member 10b [Source:ZFIN;Acc:ZDB-GENE-050420-31])

HSP 1 Score: 63.1586 bits (152), Expect = 6.600e-10
Identity = 31/66 (46.97%), Postives = 40/66 (60.61%), Query Frame = 2
Query: 1280 WTFGGSILYCITVITTIGYGHITPKTIPGRFGTIIYAIFGIPIMLICLAHIGSLMANMF-RLIYRV 1474
            W  G +  +  TVITTIGYG+I P T  G+   I+YAIFGIP+    LA +G  +  MF + I RV
Sbjct:  153 WDLGSAFFFAGTVITTIGYGNIAPSTEGGKIFCILYAIFGIPLFGFLLAGVGDQLGTMFMKSILRV 218          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Xenopus
Match: pole4 (polymerase (DNA-directed), epsilon 4, accessory subunit [Source:Xenbase;Acc:XB-GENE-5722002])

HSP 1 Score: 63.929 bits (154), Expect = 3.991e-10
Identity = 27/64 (42.19%), Postives = 36/64 (56.25%), Query Frame = 2
Query: 1280 WTFGGSILYCITVITTIGYGHITPKTIPGRFGTIIYAIFGIPIMLICLAHIGSLMANMFRLIYR 1471
            W F GS  + ITVITTIGYGH  P T  G+   + YA+ GIP+ L+    +G  M    R + +
Sbjct:   90 WKFAGSFYFAITVITTIGYGHAAPGTDAGKVFCMFYAVLGIPLTLVMFQSLGERMNTFVRFLLK 153          

HSP 2 Score: 55.4546 bits (132), Expect = 2.054e-7
Identity = 29/63 (46.03%), Postives = 40/63 (63.49%), Query Frame = 2
Query: 1781 VGSVFFTICEGWKITDSFYFSFITLSTIGFGDFVPVAIGNEAEQYKSIMCSF---YVLFGLSL 1960
            +G+  F+  EGW    S+Y+ FITL+TIGFGDFV +   NEA Q K    +F   Y+L GL++
Sbjct:  185 IGAAAFSYFEGWTFFHSYYYCFITLTTIGFGDFVALQ-KNEALQKKPPYVAFSFMYILVGLTV 246          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Xenopus
Match: pole4 (polymerase (DNA-directed), epsilon 4, accessory subunit [Source:Xenbase;Acc:XB-GENE-5722002])

HSP 1 Score: 62.7734 bits (151), Expect = 8.169e-10
Identity = 34/113 (30.09%), Postives = 48/113 (42.48%), Query Frame = 2
Query: 1127 NNLSLRQKSSFIESLTKNFENLTETVFDVTKDGWIHENGHIGTEKGSGKTLWTFGGSILYCITVITTIGYGHITPKTIPGRFGTIIYAIFGIPIMLICLAHIGSLMANMFRLI 1465
            N + LR K  F +   +  E + +                  +E       W F GS  + ITVITTIGYGH  P T  G+   + YA+ GIP+ L+    +G  M    R +
Sbjct:   45 NRMDLRHKHGFSDEDYREIERVVQQ-----------------SEPHRAGKQWKFTGSFYFAITVITTIGYGHAAPGTDAGKVFCMFYAVLGIPLTLVMFQSLGERMNTFVRFL 140          

HSP 2 Score: 54.6842 bits (130), Expect = 3.811e-7
Identity = 29/63 (46.03%), Postives = 40/63 (63.49%), Query Frame = 2
Query: 1781 VGSVFFTICEGWKITDSFYFSFITLSTIGFGDFVPVAIGNEAEQYKSIMCSF---YVLFGLSL 1960
            +G+  F+  EGW    S+Y+ FITL+TIGFGDFV +   NEA Q K    +F   Y+L GL++
Sbjct:  174 IGAAAFSYFEGWTFFHSYYYCFITLTTIGFGDFVALQ-KNEALQKKPPYVAFSFMYILVGLTV 235          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Xenopus
Match: pole4 (polymerase (DNA-directed), epsilon 4, accessory subunit [Source:Xenbase;Acc:XB-GENE-5722002])

HSP 1 Score: 62.7734 bits (151), Expect = 9.593e-10
Identity = 27/62 (43.55%), Postives = 35/62 (56.45%), Query Frame = 2
Query: 1280 WTFGGSILYCITVITTIGYGHITPKTIPGRFGTIIYAIFGIPIMLICLAHIGSLMANMFRLI 1465
            W F GS  + ITVITTIGYGH  P T  G+   + YA+ GIP+ L+    +G  M    R +
Sbjct:   99 WKFAGSFYFAITVITTIGYGHAAPGTDAGKVFCMFYAVLGIPLTLVMFQSLGERMNTFVRFL 160          

HSP 2 Score: 54.299 bits (129), Expect = 5.031e-7
Identity = 29/63 (46.03%), Postives = 40/63 (63.49%), Query Frame = 2
Query: 1781 VGSVFFTICEGWKITDSFYFSFITLSTIGFGDFVPVAIGNEAEQYKSIMCSF---YVLFGLSL 1960
            +G+  F+  EGW    S+Y+ FITL+TIGFGDFV +   NEA Q K    +F   Y+L GL++
Sbjct:  194 IGAAAFSYFEGWTFFHSYYYCFITLTTIGFGDFVALQ-KNEALQKKPPYVAFSFMYILVGLTV 255          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Xenopus
Match: ENSXETT00000028438.1 (potassium channel subfamily K member 17 [Source:NCBI gene;Acc:101731658])

HSP 1 Score: 59.6918 bits (143), Expect = 1.950e-9
Identity = 34/81 (41.98%), Postives = 49/81 (60.49%), Query Frame = 2
Query: 1190 LTETVFDVTKDGWIHENGHIGTEKGSGKTLWTFGGSILYCITVITTIGYGHITPKTIPGRFGTIIYAIFGIPIMLICLAHI 1432
            L++TV    K G I   G+  +  GS    W+FGGS  + +TV+TTIGYG++ P T   R   ++YA+FGIP+ LI L  +
Sbjct:    6 LSQTVIGAYKSG-ISPEGN-SSNLGS----WSFGGSFFFSVTVVTTIGYGNLCPSTAGARAFCVVYALFGIPLNLILLTKL 80          

HSP 2 Score: 49.6766 bits (117), Expect = 4.210e-6
Identity = 27/67 (40.30%), Postives = 40/67 (59.70%), Query Frame = 2
Query: 1790 VFFTICEGWKITDSFYFSFITLSTIGFGDFVPVAIG-NEAEQYKSI---MCSFYVLFGLSLCVMSFD 1978
            V F   EGW   +  Y+SFITL+TIGFGD+V   +G N  +QY +    + S ++LFGL+   +  +
Sbjct:  100 VLFRAVEGWTYGEGLYYSFITLATIGFGDYV---VGRNPDKQYPNWYRNLLSVWILFGLAWLALGIN 163          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Xenopus
Match: tbc1d1 (TBC1 domain family member 1 [Source:Xenbase;Acc:XB-GENE-5959648])

HSP 1 Score: 61.6178 bits (148), Expect = 2.293e-9
Identity = 27/64 (42.19%), Postives = 35/64 (54.69%), Query Frame = 2
Query: 1253 TEKGSGKTLWTFGGSILYCITVITTIGYGHITPKTIPGRFGTIIYAIFGIPIMLICLAHIGSLM 1444
            +E       W F GS  + ITVITTIGYGH  P T  G+   + YA+ GIP+ L+    +G  M
Sbjct:  168 SEPHRAGVQWKFAGSFYFAITVITTIGYGHAAPGTDAGKAFCMFYAVLGIPLTLVMFQSLGERM 231          

HSP 2 Score: 50.8322 bits (120), Expect = 5.653e-6
Identity = 34/97 (35.05%), Postives = 54/97 (55.67%), Query Frame = 2
Query: 1700 LLEAAKKS---KSVEVPVSLVITVFIIYNL----VGSVFFTICEGWKITDSFYFSFITLSTIGFGDFVPVAIGNEAEQYKSIMCSF---YVLFGLSL 1960
            LL+  KK    +S +V +  ++TV     +    +G+  F+  E W    S+Y+ FITL+TIGFGD+V +   N A Q K +  +F   Y+L GL++
Sbjct:  238 LLKRIKKCCGMRSTDVSMENMVTVGFFSCMGTLCIGAAAFSHYEDWSFFQSYYYCFITLTTIGFGDYVALQ-KNRALQKKPLYVAFSFMYILVGLTV 333          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Mouse
Match: Kcnk18 (potassium channel, subfamily K, member 18 [Source:MGI Symbol;Acc:MGI:2685627])

HSP 1 Score: 81.6481 bits (200), Expect = 4.928e-16
Identity = 74/298 (24.83%), Postives = 129/298 (43.29%), Query Frame = 2
Query: 1199 TVFDVTKDGWIHENGHIGTEKGSGKTLWTFGGSILYCITVITTIGYGHITPKTIPGRFGTIIYAIFGIPIMLICLAHIGSLMANMFRLIY-RVSCLXXXXXXXXXXXXXXXXXXXXXXTSNE------LLDKSDDE--DNQISLTVVKNPHNPTGN--YFGSTVQFRKILFHIPNPNRLLE-----------------------AAKKSKSVEVPVSLVITVFIIYNLVGSVFFTICEG-WKITDSFYFSFITLSTIGFGDFVPVAIGNEAEQYKSIMCSFYVLFGLSLCVMSFDLME 1987
            TV + ++        H+  +       W+F  ++ +C TV +T+GYGH+ P T  G+F  ++YA+FGIP+M + L  IG ++A +    Y R   L          +S     ++  S   E      ++D   DE  + Q S    K+P +P+ N   F   V  R+    +  P R +E                         ++ + +++P+ ++  V   Y    +      E      D+FYF F+TL+TIGFGD V V        +  +  S Y++ G+ +  ++F LM+
Sbjct:   85 TVVEGSRKNLCEHLQHLKPQWLKAPQDWSFLSALFFCCTVFSTVGYGHMYPVTRLGKFLCMLYALFGIPLMFLVLTDIGDILATILSRAYSRFQALLCLPHDIFKWRSLPLCRKQPDSKPVEEAIPQIVIDAGVDELLNPQPS----KDPPSPSCNVELFERLVA-REKKNKLQPPTRPVERSNSCPELVLGRLSCSILSNLDEVGQQVERLDIPLPVIALVVFAYISCAAAILPFWETELGFEDAFYFCFVTLTTIGFGDIVLV------HPHFFLFFSIYIIVGMEILFIAFKLMQ 371          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Mouse
Match: Kcnk15 (potassium channel, subfamily K, member 15 [Source:MGI Symbol;Acc:MGI:2675209])

HSP 1 Score: 60.8474 bits (146), Expect = 2.270e-9
Identity = 26/62 (41.94%), Postives = 36/62 (58.06%), Query Frame = 2
Query: 1280 WTFGGSILYCITVITTIGYGHITPKTIPGRFGTIIYAIFGIPIMLICLAHIGSLMANMFRLI 1465
            W F GS  + ITVITTIGYGH  P T  G+   + YA+ GIP+ L+    +G  +  + R +
Sbjct:   97 WRFAGSFYFAITVITTIGYGHAAPGTDSGKVFCMFYALLGIPLTLVTFQSLGERLNTLVRCL 158          

HSP 2 Score: 49.6766 bits (117), Expect = 8.061e-6
Identity = 26/60 (43.33%), Postives = 37/60 (61.67%), Query Frame = 2
Query: 1790 VFFTICEGWKITDSFYFSFITLSTIGFGDFVPVAIGNEAEQYKSIMCSF---YVLFGLSL 1960
            + F   EGW    ++Y+ FITL+TIGFGDFV +   +EA Q K    +F   Y+L GL++
Sbjct:  195 IAFAHFEGWTFFHAYYYCFITLTTIGFGDFVALQ-RDEALQRKPPYVAFSFLYILLGLTV 253          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Mouse
Match: Kcnk15 (potassium channel, subfamily K, member 15 [Source:MGI Symbol;Acc:MGI:2675209])

HSP 1 Score: 60.4622 bits (145), Expect = 2.640e-9
Identity = 26/62 (41.94%), Postives = 36/62 (58.06%), Query Frame = 2
Query: 1280 WTFGGSILYCITVITTIGYGHITPKTIPGRFGTIIYAIFGIPIMLICLAHIGSLMANMFRLI 1465
            W F GS  + ITVITTIGYGH  P T  G+   + YA+ GIP+ L+    +G  +  + R +
Sbjct:   78 WRFAGSFYFAITVITTIGYGHAAPGTDSGKVFCMFYALLGIPLTLVTFQSLGERLNTLVRCL 139          

HSP 2 Score: 49.6766 bits (117), Expect = 8.346e-6
Identity = 26/58 (44.83%), Postives = 36/58 (62.07%), Query Frame = 2
Query: 1796 FTICEGWKITDSFYFSFITLSTIGFGDFVPVAIGNEAEQYKSIMCSF---YVLFGLSL 1960
            F   EGW    ++Y+ FITL+TIGFGDFV +   +EA Q K    +F   Y+L GL++
Sbjct:  178 FAHFEGWTFFHAYYYCFITLTTIGFGDFVALQ-RDEALQRKPPYVAFSFLYILLGLTV 234          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Mouse
Match: Kcnk9 (potassium channel, subfamily K, member 9 [Source:MGI Symbol;Acc:MGI:3521816])

HSP 1 Score: 60.8474 bits (146), Expect = 2.840e-9
Identity = 28/71 (39.44%), Postives = 37/71 (52.11%), Query Frame = 2
Query: 1253 TEKGSGKTLWTFGGSILYCITVITTIGYGHITPKTIPGRFGTIIYAIFGIPIMLICLAHIGSLMANMFRLI 1465
            +E       W F GS  + ITVITTIGYGH  P T  G+   + YA+ GIP+ L+    +G  M    R +
Sbjct:   69 SEPHRAGVQWKFAGSFYFAITVITTIGYGHAAPGTDAGKAFCMFYAVLGIPLTLVMFQSLGERMNTFVRYL 139          

HSP 2 Score: 51.6026 bits (122), Expect = 2.226e-6
Identity = 26/63 (41.27%), Postives = 38/63 (60.32%), Query Frame = 2
Query: 1781 VGSVFFTICEGWKITDSFYFSFITLSTIGFGDFVPVAIGNEAEQYKSIMCSF---YVLFGLSL 1960
            +G+  F+ CE W    ++Y+ FITL+TIGFGDFV +     A Q K    +F   Y+L GL++
Sbjct:  173 LGAAAFSQCEDWSFFHAYYYCFITLTTIGFGDFVALQ-AKGALQRKPFYVAFSFMYILVGLTV 234          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Mouse
Match: Kcnk10 (potassium channel, subfamily K, member 10 [Source:MGI Symbol;Acc:MGI:1919508])

HSP 1 Score: 61.2326 bits (147), Expect = 2.853e-9
Identity = 31/66 (46.97%), Postives = 40/66 (60.61%), Query Frame = 2
Query: 1280 WTFGGSILYCITVITTIGYGHITPKTIPGRFGTIIYAIFGIPIMLICLAHIGSLMANMF-RLIYRV 1474
            W  G +  +  TVITTIGYG+I P T  G+   I+YAIFGIP+    LA IG  +  +F + I RV
Sbjct:  149 WDLGSAFFFAGTVITTIGYGNIAPSTEGGKIFCILYAIFGIPLFGFLLAGIGDQLGTIFGKSIARV 214          

HSP 2 Score: 50.8322 bits (120), Expect = 4.545e-6
Identity = 28/68 (41.18%), Postives = 41/68 (60.29%), Query Frame = 2
Query: 1766 IIYNLVGSVFFTICEGWKITDSFYFSFITLSTIGFGDFVPVAIGNEA----EQYKSIMCSFYVLFGLS 1957
            I++  + +V F   EGW   +S YF  +TL+T+GFGDF  VA GN      E YK ++  F++L GL+
Sbjct:  242 IVFVTIPAVIFKYIEGWTALESIYFVVVTLTTVGFGDF--VAGGNAGINYREWYKPLVW-FWILVGLA 306          
BLAST of Potassium channel subfamily K member 18 vs. UniProt/SwissProt
Match: sp|Q18120|TWK18_CAEEL (TWiK family of potassium channels protein 18 OS=Caenorhabditis elegans OX=6239 GN=twk-18 PE=1 SV=2)

HSP 1 Score: 94.3597 bits (233), Expect = 4.243e-19
Identity = 66/202 (32.67%), Postives = 94/202 (46.53%), Query Frame = 2
Query: 1280 WTFGGSILYCITVITTIGYGHITPKTIPGRFGTIIYAIFGIPIMLICLAHIGSLMANMFRLIYRVSCLXXXXXXXXXXXXXXXXXXXXXXTSNELLDKSDDEDNQISLTVVKNPHNPTGNYFGSTVQFRKILFHIPNPNRLLEAAKKSKSVEVPVSLVITVFIIYNLVGSVFFTICEGWKITDSFYFSFITLSTIGFGDFVP 1885
            WTF GSI YC+TV TTIGYG+I P T  GRF TI+YA  GIP+ ++ L  +GSL A   ++++R                           SN++ + +D+ +     T +      T N                N + LL       S  +   L+ITV  I+ +  +V FT  E W    S YF+ I+ +TIGFGD +P
Sbjct:  114 WTFLGSIFYCMTVYTTIGYGNIVPGTGWGRFATILYAFIGIPLTVLSLYCLGSLFAKGCKMLWRF--------------FLKSTRVVSKDLSNKISEAADNIEE--GTTAITPSAEKTEN----------------NDDDLL-------SFPISGLLLITV--IWVIFCAVLFTFLEEWDFGTSLYFTLISFTTIGFGDILP 274          
BLAST of Potassium channel subfamily K member 18 vs. UniProt/SwissProt
Match: sp|Q6Q1P3|KCNKI_RAT (Potassium channel subfamily K member 18 OS=Rattus norvegicus OX=10116 GN=Kcnk18 PE=2 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 1.924e-15
Identity = 69/271 (25.46%), Postives = 119/271 (43.91%), Query Frame = 2
Query: 1280 WTFGGSILYCITVITTIGYGHITPKTIPGRFGTIIYAIFGIPIMLICLAHIGSLMANMFRLIY----RVSCLXXXXX---XXXXXXXXXXXXXXXXXTSNELLDKSDDE--DNQISLTVVKNPHNPTGN--YFGSTVQFRKILFHIPNPNR-----------------------LLEAAKKSKSVEVPVSLVITVFIIYNLVGSVFFTICE-GWKITDSFYFSFITLSTIGFGDFVPVAIGNEAEQYKSIMCSFYVLFGLSLCVMSFDLME 1987
            W+F  ++ +C TV +T+GYGH+ P T  G+F  ++YA+FGIP+M + L  IG ++A +    Y     + CL             + +  +     +    ++D   DE  D Q S    + P +P+ N   F   V  R+    +  P R                       L E  ++ + +++P+ ++  V   Y    +      E      D+FYF F+TL+TIGFGD V V        +  +  S Y++ G+ +  ++F LM+
Sbjct:  123 WSFLSALFFCCTVFSTVGYGHMYPVTRLGKFLCMLYALFGIPLMFLVLTDIGDILAAILSRAYSRFQALLCLPRDISKWRPLLLCRKQTDSKPADEAIPQIVIDAGADELLDPQPS----REPASPSCNVELFERLVA-REKQNELQPPMRPVERSNSCPELVLGRLSCSILSNLDEVGQQVERLDIPLPVIALVIFAYISCAAAILPFWETDLGFEDAFYFCFVTLTTIGFGDIVLV------HPHFFLFFSIYIIVGMEILFIAFKLMQ 382          
BLAST of Potassium channel subfamily K member 18 vs. UniProt/SwissProt
Match: sp|Q6VV64|KCNKI_MOUSE (Potassium channel subfamily K member 18 OS=Mus musculus OX=10090 GN=Kcnk18 PE=1 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 3.447e-15
Identity = 74/298 (24.83%), Postives = 129/298 (43.29%), Query Frame = 2
Query: 1199 TVFDVTKDGWIHENGHIGTEKGSGKTLWTFGGSILYCITVITTIGYGHITPKTIPGRFGTIIYAIFGIPIMLICLAHIGSLMANMFRLIY-RVSCLXXXXXXXXXXXXXXXXXXXXXXTSNE------LLDKSDDE--DNQISLTVVKNPHNPTGN--YFGSTVQFRKILFHIPNPNRLLE-----------------------AAKKSKSVEVPVSLVITVFIIYNLVGSVFFTICEG-WKITDSFYFSFITLSTIGFGDFVPVAIGNEAEQYKSIMCSFYVLFGLSLCVMSFDLME 1987
            TV + ++        H+  +       W+F  ++ +C TV +T+GYGH+ P T  G+F  ++YA+FGIP+M + L  IG ++A +    Y R   L          +S     ++  S   E      ++D   DE  + Q S    K+P +P+ N   F   V  R+    +  P R +E                         ++ + +++P+ ++  V   Y    +      E      D+FYF F+TL+TIGFGD V V        +  +  S Y++ G+ +  ++F LM+
Sbjct:   85 TVVEGSRKNLCEHLQHLKPQWLKAPQDWSFLSALFFCCTVFSTVGYGHMYPVTRLGKFLCMLYALFGIPLMFLVLTDIGDILATILSRAYSRFQALLCLPHDIFKWRSLPLCRKQPDSKPVEEAIPQIVIDAGVDELLNPQPS----KDPPSPSCNVELFERLVA-REKKNKLQPPTRPVERSNSCPELVLGRLSCSILSNLDEVGQQVERLDIPLPVIALVVFAYISCAAAILPFWETELGFEDAFYFCFVTLTTIGFGDIVLV------HPHFFLFFSIYIIVGMEILFIAFKLMQ 371          
BLAST of Potassium channel subfamily K member 18 vs. UniProt/SwissProt
Match: sp|A8X8I4|TWK12_CAEBR (TWiK family of potassium channels protein 12 OS=Caenorhabditis briggsae OX=6238 GN=twk-12 PE=3 SV=2)

HSP 1 Score: 67.3958 bits (163), Expect = 2.681e-10
Identity = 30/69 (43.48%), Postives = 43/69 (62.32%), Query Frame = 2
Query: 1265 SGKTLWTFGGSILYCITVITTIGYGHITPKTIPGRFGTIIYAIFGIPIMLICLAHIGSLMANMFRLIYR 1471
            S  T WT+ G++ Y   + TTIGYG+ T KT  GR  T++YA+FGIP  L+ L  IG  ++   + IY+
Sbjct:  107 SEDTPWTWTGAMFYAGQLYTTIGYGYPTAKTDEGRICTVLYALFGIPCFLMYLKAIGKTLSKRLKKIYK 175          
BLAST of Potassium channel subfamily K member 18 vs. UniProt/SwissProt
Match: sp|Q7Z418|KCNKI_HUMAN (Potassium channel subfamily K member 18 OS=Homo sapiens OX=9606 GN=KCNK18 PE=1 SV=1)

HSP 1 Score: 65.855 bits (159), Expect = 4.399e-10
Identity = 37/107 (34.58%), Postives = 58/107 (54.21%), Query Frame = 2
Query: 1157 FIESLTKNFENLTETVFDVTKDGWIHENGHIGTEKGSG---KTLWTFGGSILYCITVITTIGYGHITPKTIPGRFGTIIYAIFGIPIMLICLAHIGSLMANMFRLIY 1468
            F+E L +   N +ETV +  K       GH+   K       T W+F  S+ +C TV +T+GYG+I P T  G++  ++YA+FGIP+M + L   G ++A +    Y
Sbjct:   61 FLEELCRIL-NCSETVVEDRKQDL---QGHLQKVKPQWFNRTTHWSFLSSLFFCCTVFSTVGYGYIYPVTRLGKYLCMLYALFGIPLMFLVLTDTGDILATILSTSY 163          
BLAST of Potassium channel subfamily K member 18 vs. TrEMBL
Match: A0A210QTX8 (TWiK family of potassium channels protein 18 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT15723 PE=3 SV=1)

HSP 1 Score: 164.851 bits (416), Expect = 2.719e-40
Identity = 101/280 (36.07%), Postives = 151/280 (53.93%), Query Frame = 2
Query: 1163 ESLTKNFENLTETVFDVTKDGWIHENGHIGTEKGSGKTLWTFGGSILYCITVITTIGYGHITPKTIPGRFGTIIYAIFGIPIMLICLAHIGSLMANMFRLIYRVSCLXXXXXXXXXXXXXXXXXXXXXXTSNELLDKSDDEDNQISLTVVKNPHNPTGNYFGSTVQFRKILFH----IPNPNRLLEAAKKSKSVEVPVSLVITVFIIYNLVGSVFFTICEGWKITDSFYFSFITLSTIGFGDFVPVA-IGNEAEQYKSIMCSFYVLFGLSLCVMSFDLME 1987
            + + ++F+ L   ++  TK     ENG  G + G G+  W+F G++LY ITVITTIGYGHI PKT  GR  T++YA+FGIP+ L+CLA++GS +AN FR +Y+  CL                          L   S  + ++ S + +K P     +   S+   +K   H    I   ++      K++ V VP+ + + +   Y   G+  F + EGW      YF FITLST+GFGDFVP A + + +   K I+C+FY++FGLSL  M F+LM+
Sbjct:  214 DDILRDFQTL---IYKATK-----ENGWDGKD-GEGEVQWSFAGALLYSITVITTIGYGHIAPKTANGRMVTVVYALFGIPLTLLCLANMGSFLANCFRFLYKNVCLAVIW----------------------LCCPSQAKWHRQSDSRIKTPTKEEADLIRSS---KKGELHDEVTIVIGDKTSNTNNKNEKVRVPILVSLMLIAAYIFGGATLFAMWEGWDYLVGSYFCFITLSTVGFGDFVPGAGVYSFSNNQKLIICAFYLIFGLSLIAMCFELMQ 459          
BLAST of Potassium channel subfamily K member 18 vs. TrEMBL
Match: V3ZUS1 (Uncharacterized protein (Fragment) OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_94184 PE=3 SV=1)

HSP 1 Score: 156.762 bits (395), Expect = 5.388e-39
Identity = 99/314 (31.53%), Postives = 161/314 (51.27%), Query Frame = 2
Query: 1097 NGKDINSLIGNN--------------LSLRQKSSFIESLTKNFENLTETVFDVTKDGWIHENGHIGTEKGSGKTLWTFGGSILYCITVITTIGYGHITPKTIPGRFGTIIYAIFGIPIMLICLAHIGSLMANMFRLIYRVSCLXXXXXXXXXXXXXXXXXXXXXXTSNELLDKSDDEDNQISLTVVKNPHN-PTGNYFGSTVQFRKILFHIPNPNRLLEAAKKSKSVEVPVSLVITVFIIYNLVGSVFFTICE-GWKITDSFYFSFITLSTIGFGDFVPVAIGNE-AEQYKSIMCSFYVLFGLSLCVMSFDLME 1987
            + K+I S +G N              L++  ++++     + FE   ++V+   ++GW  ++     E    +  W+F GS+LY +TVITTIGYGH+TP+T  GR  TI YAI GIP+ L+CL++IG L+A +FR++++                         +       K ++E      +V++NP N P     GS    R ++    + N +LE  + S  + VP+ + + +  +Y  +G++ F + E  W   D+ YF F+TLSTIGFGD VP         QYK + C+ Y+LFGL +  M FDL++
Sbjct:   32 HAKEIRSFVGFNRLAHVKKVWDITSKLNILHEANWTRLADEIFEEFQQSVYVAVQNGWDGQDIFATKEI---EEEWSFAGSLLYSVTVITTIGYGHLTPRTNWGRIVTIFYAIIGIPLTLLCLSNIGCLLAKLFRILWK------------------------HTQCKRCCKKENNEPG----SVIENPINKPLVRGQGS----RDVISDSAHYNNILENRRHSDIIRVPIPICLCLLALYIGLGALLFRLWERSWSYMDASYFCFVTLSTIGFGDLVPGYTHESWGNQYKRVACTLYLLFGLVVVAMCFDLIQ 310          
BLAST of Potassium channel subfamily K member 18 vs. TrEMBL
Match: A0A3R7JRV1 (TWiK family of potassium channels protein 18 OS=Clonorchis sinensis OX=79923 GN=twk-18 PE=3 SV=1)

HSP 1 Score: 159.844 bits (403), Expect = 8.876e-38
Identity = 97/272 (35.66%), Postives = 153/272 (56.25%), Query Frame = 2
Query: 1253 TEKGSGKTLWTFGGSILYCITVITTIGYGHITPKTIPGRFGTIIYAIFGIPIMLICLAHIGSLMANMFRLIYRVSCLXXXXXXXXXXXXXXXXXXXXXXTSNEL----------------------LDKSDDEDNQISLTVVKNPHNPTGNYFGSTVQFRKILFHIPNPNRLLEAAKKSKSVEVPVSLVITVFIIYNLVGSVFFTICEGWKITDSFYFSFITLSTIGFGDFVPVAIGNEAEQY-----KSIMCSFYVLFGLSLCVMSFDLME 1987
            +E    + +WT  G++LY  TVITTIGYGHI P+T  GRF T++YA+FGIP++L+ +A++G  +A+  RL+Y++ CL++ +K +  QK+       + +   EL                      + + D ++ Q+S+ +   P   +  +F  T+   + L       R  +   KS+ + VP+ L + + +IY +VG++ F+I EGW +  S YF FITLSTIGFGDFVP   G + +Q+     K I C FY+L GLS+  M F LM+
Sbjct:  323 SESEKHQVMWTLTGALLYATTVITTIGYGHIVPRTELGRFVTVLYAMFGIPLVLLFMANLGGFLASCVRLLYKL-CLRSRQKRQPEQKANASREMFKKTPPKELQMKIITITENDTDRQTATTEGSMKEGDKKNGQLSIPIAAYPRRSSVQHFIHTLATSQSLIS----KRANKPNNKSQEIRVPIWLTLLIILIYLIVGAIIFSIWEGWSVLQSAYFVFITLSTIGFGDFVP---GIQKDQWYKDSRKPIFCCFYLLIGLSMIAMCFSLMQ 586          
BLAST of Potassium channel subfamily K member 18 vs. TrEMBL
Match: G7Y5R6 (Potassium channel subfamily K member 18 OS=Clonorchis sinensis OX=79923 GN=CLF_101438 PE=3 SV=1)

HSP 1 Score: 159.844 bits (403), Expect = 1.159e-37
Identity = 97/272 (35.66%), Postives = 153/272 (56.25%), Query Frame = 2
Query: 1253 TEKGSGKTLWTFGGSILYCITVITTIGYGHITPKTIPGRFGTIIYAIFGIPIMLICLAHIGSLMANMFRLIYRVSCLXXXXXXXXXXXXXXXXXXXXXXTSNEL----------------------LDKSDDEDNQISLTVVKNPHNPTGNYFGSTVQFRKILFHIPNPNRLLEAAKKSKSVEVPVSLVITVFIIYNLVGSVFFTICEGWKITDSFYFSFITLSTIGFGDFVPVAIGNEAEQY-----KSIMCSFYVLFGLSLCVMSFDLME 1987
            +E    + +WT  G++LY  TVITTIGYGHI P+T  GRF T++YA+FGIP++L+ +A++G  +A+  RL+Y++ CL++ +K +  QK+       + +   EL                      + + D ++ Q+S+ +   P   +  +F  T+   + L       R  +   KS+ + VP+ L + + +IY +VG++ F+I EGW +  S YF FITLSTIGFGDFVP   G + +Q+     K I C FY+L GLS+  M F LM+
Sbjct:  323 SESEKHQVMWTLTGALLYATTVITTIGYGHIVPRTELGRFVTVLYAMFGIPLVLLFMANLGGFLASCVRLLYKL-CLRSRQKRQPEQKANASREMFKKTPPKELQMKIITITENDTDRQTATTEGSMKEGDKKNGQLSIPIAAYPRRSSVQHFIHTLATSQSLIS----KRANKPNNKSQEIRVPIWLTLLIILIYLIVGAIIFSIWEGWSVLQSAYFVFITLSTIGFGDFVP---GIQKDQWYKDSRKPIFCCFYLLIGLSMIAMCFSLMQ 586          
BLAST of Potassium channel subfamily K member 18 vs. TrEMBL
Match: A0A077ZBB5 (TWiK family of potassium channels protein 7 OS=Trichuris trichiura OX=36087 GN=TTRE_0000592401 PE=3 SV=1)

HSP 1 Score: 154.066 bits (388), Expect = 4.818e-37
Identity = 100/286 (34.97%), Postives = 155/286 (54.20%), Query Frame = 2
Query: 1133 LSLRQKSSFIESLTKNFENLTETVFDVTKDGWIHENGHIGTEKGSGKTLWTFGGSILYCITVITTIGYGHITPKTIPGRFGTIIYAIFGIPIMLICLAHIGSLMANMFRLIY-RVSCLXXXXXXXXXXXXXXXXXXXXXXTSNELLDKSDDEDNQISLTVVKNPHNPTGNYFGSTVQFRKILFHIPNPNRLLEAAKKSKSVEVPVSLVITVFIIYNLVGSVFFTICEGWKITDSFYFSFITLSTIGFGDFVPVAIGNEAEQYKSIMCSFYVLFGLSLCVMSFDLME 1987
            L+ R+     + L K++E  T+ V  V  +G+  E+  I       K  WTF G++LY IT+ TTIGYGHI PKT  GR  TI+YA+ GIP+ML+CLA+I   +  +F  +Y R+ C     K ++    +   S + ++T    + + +DE+      V  +  +   +      ++ +    +  P RL+   +  K   VPVS+ I   +++ L G+V F + E W + D  YFSF+TL+TIGFGD VP    +   Q K I+CS Y+LFG++L  M F LM+
Sbjct:   58 LNPREWMELADGLLKDYE--TKLVHAVNFEGYDGEDEQI-------KYQWTFFGALLYSITIFTTIGYGHICPKTKLGRAITILYAMIGIPLMLLCLANIADSLVRLFTFVYSRICCFYCRMKKQERWMKRANISVRYTNT----VPRFNDEE-----VVGTSERSHEADIRSDFRRYEESALKV--PKRLVNQYRYEK---VPVSVGILTVVLFILGGAVLFAVWENWNVFDGAYFSFVTLTTIGFGDMVPGKSLDSGSQEKLIICSLYLLFGMALIAMCFKLMQ 320          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Cavefish
Match: ENSAMXT00000047723.1 (pep primary_assembly:Astyanax_mexicanus-2.0:9:15897283:15919205:1 gene:ENSAMXG00000033807.1 transcript:ENSAMXT00000047723.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 69.3218 bits (168), Expect = 5.902e-12
Identity = 33/77 (42.86%), Postives = 45/77 (58.44%), Query Frame = 2
Query: 1280 WTFGGSILYCITVITTIGYGHITPKTIPGRFGTIIYAIFGIPIMLICLAHIGSLMANMF------------RLIYRV 1474
            W F GS+ +C TV TT+GYG I P T  GR   I+YA  GIP+ML+ +  +G ++A +F            RL+YRV
Sbjct:  223 WHFYGSLFFCCTVFTTVGYGEIYPVTKAGRVACILYATVGIPLMLLVITDVGDILAVLFSNSYRRLHSSCRRLLYRV 299          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Cavefish
Match: KCNK16 (potassium channel subfamily K member 16 [Source:NCBI gene;Acc:103040539])

HSP 1 Score: 63.1586 bits (152), Expect = 2.331e-10
Identity = 38/102 (37.25%), Postives = 53/102 (51.96%), Query Frame = 2
Query: 1196 ETVFDVTKDGWIHENGHIGTEKGSGKTLWTFGGSILYCITVITTIGYGHITPKTIPGRFGTIIYAIFGIPIMLI-------CLA-HIGSLMANMFRLIYRVS 1477
            E    V  D W  ENG   +   +  + W FG S  +  TV+TTIGYG+++P T  G+   + YA+ GIP+ L        CLA H+G L  NM  ++ R S
Sbjct:   67 EKFVKVILDAW--ENGVNPSGNSTNPSNWDFGSSFFFAGTVVTTIGYGNLSPATFQGQVFCVFYALCGIPLNLAFLNQLSKCLAFHLGRLEHNMVSMVPRKS 166          

HSP 2 Score: 50.0618 bits (118), Expect = 3.813e-6
Identity = 26/57 (45.61%), Postives = 36/57 (63.16%), Query Frame = 2
Query: 1766 IIYNLVGSVFFTI--------CEGWKITDSFYFSFITLSTIGFGDFVPVAIGNEAEQ 1912
            +++ L+GSV F I         EGW   + FY++FITLSTIGFGDFV   +GN  ++
Sbjct:  177 VVFLLMGSVLFLIFPPIIFSYVEGWSYGEGFYYAFITLSTIGFGDFV---VGNGQDR 230          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Cavefish
Match: ENSAMXT00000032793.1 (pep primary_assembly:Astyanax_mexicanus-2.0:22:28595722:28598505:1 gene:ENSAMXG00000030049.1 transcript:ENSAMXT00000032793.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.3882 bits (150), Expect = 3.415e-10
Identity = 27/60 (45.00%), Postives = 38/60 (63.33%), Query Frame = 2
Query: 1280 WTFGGSILYCITVITTIGYGHITPKTIPGRFGTIIYAIFGIPIMLICLAHIGSLMANMFR 1459
            W+F GS  + +TVITTIGYGH  P+T  G+   ++YA+ GIP+ L+     G  M  +FR
Sbjct:   68 WSFPGSFYFSLTVITTIGYGHSYPRTEAGKVFCMLYALLGIPLTLVMFQSTGERMNMLFR 127          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Cavefish
Match: kcnk15 (potassium channel subfamily K member 15-like [Source:NCBI gene;Acc:103042097])

HSP 1 Score: 63.1586 bits (152), Expect = 4.421e-10
Identity = 31/70 (44.29%), Postives = 40/70 (57.14%), Query Frame = 2
Query: 1280 WTFGGSILYCITVITTIGYGHITPKTIPGRFGTIIYAIFGIPIMLICLAHIGSLMANMFR-LIYRV-SCL 1483
            W F GS  + ITVITTIGYGH  P T  G+   + YA+ GIP+ L+    +G  M    R L++R   CL
Sbjct:   78 WKFAGSFYFAITVITTIGYGHAAPGTDAGKVFCMFYAVLGIPLTLVMFQSLGERMNTFVRFLLHRTKQCL 147          

HSP 2 Score: 50.447 bits (119), Expect = 4.420e-6
Identity = 28/63 (44.44%), Postives = 39/63 (61.90%), Query Frame = 2
Query: 1781 VGSVFFTICEGWKITDSFYFSFITLSTIGFGDFVPVAIGNEAEQYKSIMCSF---YVLFGLSL 1960
            VG+  F+  EGW    ++Y+ FITL+TIGFGDFV +   NE  Q K+    F   Y+L GL++
Sbjct:  173 VGAAAFSHFEGWTFFHAYYYCFITLTTIGFGDFVALQ-KNEDLQEKTPYVVFSFMYILVGLTV 234          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Cavefish
Match: kcnk10b (potassium two pore domain channel subfamily K member 10 [Source:NCBI gene;Acc:103030192])

HSP 1 Score: 61.6178 bits (148), Expect = 1.725e-9
Identity = 28/59 (47.46%), Postives = 36/59 (61.02%), Query Frame = 2
Query: 1280 WTFGGSILYCITVITTIGYGHITPKTIPGRFGTIIYAIFGIPIMLICLAHIGSLMANMF 1456
            W  G +  +  TVITTIGYG+I P T  G+   I+YAIFGIP+    LA IG  +  +F
Sbjct:  160 WDLGSAFFFAGTVITTIGYGNIAPSTEGGKIFCILYAIFGIPLFGFLLAGIGDQLGTIF 218          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003416.1 (pep scaffold:Pmarinus_7.0:GL476517:78247:80718:1 gene:ENSPMAG00000003129.1 transcript:ENSPMAT00000003416.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 110.153 bits (274), Expect = 1.685e-27
Identity = 67/209 (32.06%), Postives = 106/209 (50.72%), Query Frame = 2
Query: 1280 WTFGGSILYCITVITTIGYGHITPKTIPGRFGTIIYAIFGIPIMLICLAHIGSLMANMFRLIY---RVSCLXXXXXXXXXXXXXXXXXXXXXXTSNELLD--KSDDEDNQISLTVVKNPHNPT--GNYFGSTVQFRKILFHIPNPNRLLEAAKKSKSVEVPVSLVITVFIIYNLVGSVFFTICEGWKITDSFYFSFITLSTIGFGDFVP 1885
            W F GS+ +C T+ TTIGYGHI P T  G+   ++YA FGIPIML+ LA +G L+A     IY   R   L   +  ++              +  ++ D  + + ED+ + +  +K+P +    G    +TV        I     + EA ++ K ++VP +L+  +  +Y + G+      E W   D+FYF F+T++TIG GD VP
Sbjct:    2 WNFLGSLFFCCTIFTTIGYGHIAPSTDGGKIMCMVYATFGIPIMLLVLADVGDLLARTLTTIYTSFRHRLLPGARCGRQHPPGDGPEGNDLQRSRTKIDDSHRHEGEDDAVDVP-LKSPGSDVEGGRELPATVS-------IAEGADVPEADREVKELDVPFTLIFLIVFVYLMFGTFLLPCWEEWSYLDAFYFVFVTMTTIGLGDIVP 202          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Sea Lamprey
Match: kcnk13a (potassium channel, subfamily K, member 13a [Source:ZFIN;Acc:ZDB-GENE-080219-46])

HSP 1 Score: 65.4698 bits (158), Expect = 1.944e-11
Identity = 57/223 (25.56%), Postives = 86/223 (38.57%), Query Frame = 2
Query: 1250 GTEKGSGKTLWTFGGSILYCITVITTIGYGHITPKTIPGRFGTIIYAIFGIPIMLICLAHIGSLMANMF--RLIYRVSCLXXXXXXXXXXXXXXXXXXXXXXTSNELLDKSDDEDNQISLTVVKNPHNPTGNYFGSTVQFRKILFHIPNPNRLLEAAKKSKSVEVPVSLVITVFIIYNLVG----------SVFFTICEGWKITDSFYFSFITLSTIGFGDFV 1882
            G      +  W F G+  +  TV++TIG+G  TP T+ G+   I Y +FG      C A  G L  N+F  RLI  ++C                                          V+++ H             R+I   +  P R  +A+ +S ++E       +V+ +  ++G          S  F+  EGW   DS YF F+  STIGFGD V
Sbjct:  105 GVRAAPLRPRWDFTGAFYFVGTVVSTIGFGMTTPTTVSGKIFLIFYGLFG------CAA--GILFFNLFLERLITLLAC------------------------------------------VMRSCHR------------RQINRLVIQPGR--KASDQSDAIECLAGWKPSVYHVMMILGIAAVAIACSASAMFSAVEGWSYVDSLYFCFVAFSTIGFGDLV 263          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Sea Lamprey
Match: KCNK10 (potassium two pore domain channel subfamily K member 10 [Source:HGNC Symbol;Acc:HGNC:6273])

HSP 1 Score: 54.6842 bits (130), Expect = 3.319e-8
Identity = 28/68 (41.18%), Postives = 40/68 (58.82%), Query Frame = 2
Query: 1274 TLWTFGGSILYCITVITTIGYGHITPKTIPGRFGTIIYAIFGIPIMLICLAHIGSLMANMF-RLIYRV 1474
            +LW  G +  +  TV+TTIGYG+++P T  GR     YA+ GIPI    LA +G  +  +F + I RV
Sbjct:  100 SLWDLGSAFFFAGTVLTTIGYGNVSPSTDWGRIFCTAYALVGIPIFGFLLAGVGDQLGTIFGKAIGRV 167          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Sea Lamprey
Match: KCNK16 (potassium two pore domain channel subfamily K member 16 [Source:HGNC Symbol;Acc:HGNC:14464])

HSP 1 Score: 50.447 bits (119), Expect = 6.196e-7
Identity = 21/56 (37.50%), Postives = 32/56 (57.14%), Query Frame = 2
Query: 1247 IGTEKGSGKTLWTFGGSILYCITVITTIGYGHITPKTIPGRFGTIIYAIFGIPIML 1414
            +   + S  + W F  ++L+ +TV+TTIGYG   P +  GR     YA+ GIP+ L
Sbjct:   74 VAAGQASSPSNWDFSSALLFTVTVVTTIGYGSTAPGSTWGRASCAFYALLGIPLNL 129          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Sea Lamprey
Match: kcnk7 (potassium channel, subfamily K, member 7 [Source:ZFIN;Acc:ZDB-GENE-110304-2])

HSP 1 Score: 49.2914 bits (116), Expect = 1.349e-6
Identity = 24/61 (39.34%), Postives = 36/61 (59.02%), Query Frame = 2
Query: 1280 WTFGGSILYCITVITTIGYGHITPKTIPGRFGTIIYAIFGIPIMLICLAHI-GSLMANMFR 1459
            W F  ++ +  TV+TT+GYGH  P +  G+   I+YA+ GIP  L+ L  I   LM ++ R
Sbjct:   88 WDFVSALFFASTVLTTVGYGHTVPLSDAGKALCILYAVLGIPFTLLLLTSIVQRLMEHLTR 148          

HSP 2 Score: 47.3654 bits (111), Expect = 6.493e-6
Identity = 21/46 (45.65%), Postives = 30/46 (65.22%), Query Frame = 2
Query: 1784 GSVFFTICEGWKITDSFYFSFITLSTIGFGDFVPVAIGNEAEQYKS 1921
             +VF ++ EGW    +FYF FI+LST+G GD+VP     EA++  S
Sbjct:  193 AAVFASLEEGWGFLGAFYFCFISLSTVGLGDYVP----GEADRQPS 234          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Yeast
Match: TOK1 (Outward-rectifier potassium channel of the plasma membrane; has two pore domains in tandem, each of which forms a functional channel permeable to potassium; carboxy tail functions to prevent inner gate closures; target of K1 toxin [Source:SGD;Acc:S000003629])

HSP 1 Score: 46.9802 bits (110), Expect = 8.589e-6
Identity = 19/55 (34.55%), Postives = 32/55 (58.18%), Query Frame = 2
Query: 1280 WTFGGSILYCITVITTIGYGHITPKTIPGRFGTIIYAIFGIPIMLICLAHIGSLM 1444
            W++   I +C   + TIGYG   P+T  GR   +I+A+  +P+M   L+ +G L+
Sbjct:  406 WSYFNCIYFCFLCLLTIGYGDYAPRTGAGRAFFVIWALGAVPLMGAILSTVGDLL 460          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Nematostella
Match: EDO48564 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIT3])

HSP 1 Score: 85.1149 bits (209), Expect = 4.744e-18
Identity = 54/202 (26.73%), Postives = 83/202 (41.09%), Query Frame = 2
Query: 1280 WTFGGSILYCITVITTIGYGHITPKTIPGRFGTIIYAIFGIPIMLICLAHIGSLMANMFRLIYRVSCLXXXXXXXXXXXXXXXXXXXXXXTSNELLDKSDDEDNQISLTVVKNPHNPTGNYFGSTVQFRKILFHIPNPNRLLEAAKKSKSVEVPVSLVITVFIIYNLVGSVFFTICEGWKITDSFYFSFITLSTIGFGDFVP 1885
            W+   S L+  TV TT+GYG+I P TI GR   ++Y   GIP+  +    + S +  +   +++                      ++    +  + K DD         V  P  P                 +P              +E+ +  V  V   Y  +G+V F ICEGW + +SFY+ FITLST+G GD+VP
Sbjct:  126 WSLADSWLFACTVFTTVGYGNIAPLTIKGRVFCMLYGAVGIPLFSVVAGSLASFVTEIIHALHK-------------------EYHRRKRHESAAMHKKDD---------VIAPDEP-----------------VPE-------------LEIKLKHVAVVVAGYLCIGAVLFCICEGWSLFESFYYCFITLSTVGLGDYVP 269          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Nematostella
Match: EDO43464 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYH6])

HSP 1 Score: 66.2402 bits (160), Expect = 1.635e-11
Identity = 29/62 (46.77%), Postives = 40/62 (64.52%), Query Frame = 2
Query: 1265 SGKTLWTFGGSILYCITVITTIGYGHITPKTIPGRFGTIIYAIFGIPIMLICLAHIGSLMAN 1450
            S K  W    SI +C+TV TTIGYG + P T+PGR   +IYA+ GIP+ L  LA +G ++ +
Sbjct:  145 SAKPQWNILNSIYFCMTVTTTIGYGSLAPVTVPGRVICVIYALLGIPLTLALLAVVGKIVGD 206          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Nematostella
Match: EDO33193 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSX6])

HSP 1 Score: 64.6994 bits (156), Expect = 1.696e-11
Identity = 31/68 (45.59%), Postives = 41/68 (60.29%), Query Frame = 2
Query: 1280 WTFGGSILYCITVITTIGYGHITPKTIPGRFGTIIYAIFGIPIMLICLAHIG----SLMANMFRLIYR 1471
            W+F GS+ +  TVITTIGYGH  P+T  G+   +IYA  GIP+ L     IG    + +A MFR + R
Sbjct:   79 WSFAGSVYFATTVITTIGYGHTVPRTPRGKIFCMIYAAVGIPLALTMFQSIGERFNTFLACMFRRLKR 146          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Nematostella
Match: EDO35923 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SK42])

HSP 1 Score: 63.1586 bits (152), Expect = 3.621e-11
Identity = 32/68 (47.06%), Postives = 43/68 (63.24%), Query Frame = 2
Query: 1280 WTFGGSILYCITVITTIGYGHITPKTIPGRFGTIIYAIFGIPIMLICLAHIGSL----MANMFRLIYR 1471
            W+F GS+ +  TV+TTIGYG + P T+ GR   I YAIFGIPI  + L  IG      +A+ +R+I R
Sbjct:   67 WSFAGSLFFTGTVVTTIGYGQMAPATVWGRVFCIFYAIFGIPITGLMLKSIGERITEGIADFWRIIDR 134          

HSP 2 Score: 46.9802 bits (110), Expect = 9.689e-6
Identity = 32/100 (32.00%), Postives = 49/100 (49.00%), Query Frame = 2
Query: 1694 NRLLEAAKKS---KSVEVPVSLVITVFIIYNLVGSVFFTICEGWKITDSFYFSFITLSTIGFGDFVPVAIGNEAEQYKSIMCSF----YVLFGLSLCVMS 1972
             RL     KS   K+V    +LVIT+ ++   +   +    EGW      YF FITLSTIGFGD+VP     +   + + +  F    ++ F + L ++S
Sbjct:  134 RRLFNRDPKSIHMKTVLTVFALVITMLLVLAALAVEY----EGWTYFQGIYFGFITLSTIGFGDYVPAHPSKDETNHPAFVIIFTLITFLYFTVGLALVS 229          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Nematostella
Match: EDO47668 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLC5])

HSP 1 Score: 63.1586 bits (152), Expect = 6.649e-11
Identity = 26/52 (50.00%), Postives = 38/52 (73.08%), Query Frame = 2
Query: 1280 WTFGGSILYCITVITTIGYGHITPKTIPGRFGTIIYAIFGIPIMLICLAHIG 1435
            W++ GS+ +  TVITTIGYGH++P+T  GR   ++YA+FGIPI  + L  +G
Sbjct:   86 WSYTGSLFFSGTVITTIGYGHLSPETFFGRIFCMLYALFGIPITWLMLTSLG 137          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Medaka
Match: kcnk18 (potassium two pore domain channel subfamily K member 18 [Source:NCBI gene;Acc:101159039])

HSP 1 Score: 66.2402 bits (160), Expect = 4.373e-11
Identity = 27/63 (42.86%), Postives = 41/63 (65.08%), Query Frame = 2
Query: 1280 WTFGGSILYCITVITTIGYGHITPKTIPGRFGTIIYAIFGIPIMLICLAHIGSLMANMFRLIY 1468
            WTF GS+ +C TV TT+GYG I P T+ G+   ++YA+ GIP+ML+ +  +G  +A +    Y
Sbjct:  101 WTFFGSMFFCCTVFTTVGYGEIYPVTLSGKVVCVLYAMVGIPLMLLVILDVGDFLALLMTKAY 163          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Medaka
Match: kcnk15 (potassium channel subfamily K member 15 [Source:NCBI gene;Acc:101160319])

HSP 1 Score: 62.7734 bits (151), Expect = 6.490e-10
Identity = 26/55 (47.27%), Postives = 33/55 (60.00%), Query Frame = 2
Query: 1280 WTFGGSILYCITVITTIGYGHITPKTIPGRFGTIIYAIFGIPIMLICLAHIGSLM 1444
            W F GS  + ITVITTIGYGH  P T  G+   + YA+ GIP+ L+    +G  M
Sbjct:   83 WKFAGSFYFAITVITTIGYGHAAPGTDAGKVFCMFYAVLGIPLTLVMFQSLGERM 137          

HSP 2 Score: 51.2174 bits (121), Expect = 2.670e-6
Identity = 27/63 (42.86%), Postives = 39/63 (61.90%), Query Frame = 2
Query: 1781 VGSVFFTICEGWKITDSFYFSFITLSTIGFGDFVPVAIGNEAEQYKSIMCSF---YVLFGLSL 1960
            VG+  F+  EGW    ++Y+ FITL+TIGFGDFV +    E  Q K+   +F   Y+L GL++
Sbjct:  178 VGAAAFSHFEGWSFFHAYYYCFITLTTIGFGDFVALQ-KKEDLQEKTPYVAFSFMYILVGLTV 239          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Medaka
Match: kcnk9 (potassium two pore domain channel subfamily K member 9 [Source:NCBI gene;Acc:101171424])

HSP 1 Score: 62.3882 bits (150), Expect = 7.677e-10
Identity = 26/55 (47.27%), Postives = 33/55 (60.00%), Query Frame = 2
Query: 1280 WTFGGSILYCITVITTIGYGHITPKTIPGRFGTIIYAIFGIPIMLICLAHIGSLM 1444
            W F GS  + ITVITTIGYGH  P T  G+   + YA+ GIP+ L+    +G  M
Sbjct:   78 WKFAGSFYFAITVITTIGYGHAAPGTDAGKAFCMFYAVLGIPLTLVMFQSLGERM 132          

HSP 2 Score: 51.6026 bits (122), Expect = 1.578e-6
Identity = 27/63 (42.86%), Postives = 39/63 (61.90%), Query Frame = 2
Query: 1781 VGSVFFTICEGWKITDSFYFSFITLSTIGFGDFVPVAIGNEAEQYKSIMCSF---YVLFGLSL 1960
            +G+  F+  E W    S+Y+ FITL+TIGFGDFV +   N A Q K +  +F   Y+L GL++
Sbjct:  173 IGAAAFSHYEDWSFFQSYYYCFITLTTIGFGDFVALQ-KNRALQKKPLYVAFSFMYILVGLTV 234          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Medaka
Match: kcnk3b (potassium channel subfamily K member 3 [Source:NCBI gene;Acc:101165434])

HSP 1 Score: 60.8474 bits (146), Expect = 1.970e-9
Identity = 26/62 (41.94%), Postives = 36/62 (58.06%), Query Frame = 2
Query: 1280 WTFGGSILYCITVITTIGYGHITPKTIPGRFGTIIYAIFGIPIMLICLAHIGSLMANMFRLI 1465
            W F GS  + ITVITTIGYGH  P T  G+   + YA+ GIP+ L+    +G  +  + R +
Sbjct:   78 WKFAGSFYFAITVITTIGYGHAAPSTDSGKVFCMFYALLGIPLTLVMFQSLGERINTLVRYL 139          

HSP 2 Score: 58.9214 bits (141), Expect = 7.951e-9
Identity = 35/98 (35.71%), Postives = 55/98 (56.12%), Query Frame = 2
Query: 1700 LLEAAKKS---KSVEVPVSLVITVFIIYNL----VGSVFFTICEGWKITDSFYFSFITLSTIGFGDFVPV----AIGNEAEQYKSIMCSFYVLFGLSL 1960
            LL  +KK    +  +V ++ ++TV   + L    VG+  F+ CEGW    +FY+ FITL+TIGFGD+V +    A+ N+        C  Y+L GL++
Sbjct:  139 LLHQSKKGLGLRQTQVSMANMVTVGFFFCLSTLCVGAAAFSHCEGWSFLHAFYYCFITLTTIGFGDYVALQRDDALQNDPRYVA--FCFIYILMGLTV 234          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Medaka
Match: kcnk3a (potassium two pore domain channel subfamily K member 3 [Source:NCBI gene;Acc:101167669])

HSP 1 Score: 59.6918 bits (143), Expect = 4.742e-9
Identity = 26/62 (41.94%), Postives = 36/62 (58.06%), Query Frame = 2
Query: 1280 WTFGGSILYCITVITTIGYGHITPKTIPGRFGTIIYAIFGIPIMLICLAHIGSLMANMFRLI 1465
            W F GS  + ITVITTIGYGH  P T  G+   ++YA+ GIP+ L+    +G  +    R +
Sbjct:   78 WNFAGSFYFAITVITTIGYGHAAPSTDGGKVFCMLYALLGIPLTLVMFQSLGERINTFVRYL 139          

HSP 2 Score: 53.1434 bits (126), Expect = 6.869e-7
Identity = 27/63 (42.86%), Postives = 39/63 (61.90%), Query Frame = 2
Query: 1781 VGSVFFTICEGWKITDSFYFSFITLSTIGFGDFVPVAIGNEAEQYKS---IMCSFYVLFGLSL 1960
             G++ F+  EGW    ++Y+ FITL+TIGFGD+V +  G EA Q K    + C  Y+L GL +
Sbjct:  173 AGALAFSHFEGWTFFQAYYYCFITLTTIGFGDYVALQKG-EALQEKQGYVVFCFIYILMGLGV 234          
BLAST of Potassium channel subfamily K member 18 vs. Planmine SMEST
Match: SMESG000013544.1 (SMESG000013544.1)

HSP 1 Score: 1191.02 bits (3080), Expect = 0.000e+0
Identity = 641/648 (98.92%), Postives = 643/648 (99.23%), Query Frame = 2
Query:  128 KRQDIEYENEMSETPIIPKSNLEEVRSPRETKIVILESPDGDRGDDTILILNQVPFIEMKDNPIEKRDNNCFNKENEIKSKLPNETDRVQENSKKIFDNIEVETSFEDNDNLIYPSSNPNKFHNHKPKIKNEEALKFWKSKEHCIXXXXXXXXXXXXNIGLTLLIVTYILLGACMFQFFELKHELATFETNSNKVLRNLNKSKSRIESEHEQIVLDIKNETKINLMKFLNETFTENQIQIGNLTEIFHEIKIQIQSAQSEIDRSFKEEILCQSTVNNSCERNDSEAIGKTWKNISNKLQSVNENVEIILKKIDNLSNFINMKYNGKDINSLIGNNLSLRQKSSFIESLTKNFENLTETVFDVTKDGWIHENGHIGTEKGSGKTLWTFGGSILYCITVITTIGYGHITPKTIPGRFGTIIYAIFGIPIMLICLAHIGSLMANMFRLIYRVSCLXXXXXXXXXXXXXXXXXXXXXXTSNELLDKSDDEDNQISLTVVKNPHNPTGNYFGSTVQFRKILFHIPNPNRLLEAAKKSKSVEVPVSLVITVFIIYNLVGSVFFTICEGWKITDSFYFSFITLSTIGFGDFVPVAIGNEAEQYKSIMCSFYVLFGLSLCVMSFDLMEXXXXXXXXXXXXRIRNKIYKKDNKQRKT 2071
            K +  EYENEMSETPIIPKSNLEEVRSPRETKIVILESPDGDRGDDTILILNQVPFIEMKDN IEKRDNNCFNKE EIKSKLPNETDRVQENSKKIFDNIEVETSFEDNDNLIYPSSNPNKFHNHKPKIKNEEALKFWKSKEHCILFSKLALSLLFSNIGLTLLIVTYILLGACMFQFFELKHELATFETNSNKVLRNLNKSKSRIESEHEQIVLDIKNETKINLMKFLNETFTENQI+IGNLTEIFHEIKIQIQSAQSEIDRSFKEEILCQSTVNNSCERNDSEAIGKTWKNISNKLQSVNENVEIILKKIDNLSNFINMKYNGKDINSLIGNNLSLRQKSSFIESLTKNFENLTETVFDVTKDGWIHENGHIGTEKGSGKTLWTFGGSILYCITVITTIGYGHITPKTIPGRFGTIIYAIFGIPIMLICLAHIGSLMANMFRLIYRVSCLKAFKKYKKSQKSKCQNSEKQSSTSNELLDKSDDEDNQISLTVVKNPHNPTGNYFGSTVQFRKILFHIPNPNRLLEAAKKSKSVEVPVSLVITVFIIYNLVGSVFFTICEGWKITDSFYFSFITLSTIGFGDFVPVAIGNEAEQYKSIMCSFYVLFGLSLCVMSFDLMEKKCKSTIKKTVKRIRNKIYKKDNKQRKT
Sbjct:   42 KDRTSEYENEMSETPIIPKSNLEEVRSPRETKIVILESPDGDRGDDTILILNQVPFIEMKDNLIEKRDNNCFNKEKEIKSKLPNETDRVQENSKKIFDNIEVETSFEDNDNLIYPSSNPNKFHNHKPKIKNEEALKFWKSKEHCILFSKLALSLLFSNIGLTLLIVTYILLGACMFQFFELKHELATFETNSNKVLRNLNKSKSRIESEHEQIVLDIKNETKINLMKFLNETFTENQIKIGNLTEIFHEIKIQIQSAQSEIDRSFKEEILCQSTVNNSCERNDSEAIGKTWKNISNKLQSVNENVEIILKKIDNLSNFINMKYNGKDINSLIGNNLSLRQKSSFIESLTKNFENLTETVFDVTKDGWIHENGHIGTEKGSGKTLWTFGGSILYCITVITTIGYGHITPKTIPGRFGTIIYAIFGIPIMLICLAHIGSLMANMFRLIYRVSCLKAFKKYKKSQKSKCQNSEKQSSTSNELLDKSDDEDNQISLTVVKNPHNPTGNYFGSTVQFRKILFHIPNPNRLLEAAKKSKSVEVPVSLVITVFIIYNLVGSVFFTICEGWKITDSFYFSFITLSTIGFGDFVPVAIGNEAEQYKSIMCSFYVLFGLSLCVMSFDLMEKKCKSTIKKTVKRIRNKIYKKDNKQRKT 689          

HSP 2 Score: 76.6406 bits (187), Expect = 3.606e-14
Identity = 45/46 (97.83%), Postives = 45/46 (97.83%), Query Frame = 3
Query:    6 MKKENPAKNSFKFDYIDSDSENDTKKKETKIKNDSPNGYEEKDRTS 143
            MKKENPAKNSFKFDYIDSDSEND KKKETKIKNDSPNGYEEKDRTS
Sbjct:    1 MKKENPAKNSFKFDYIDSDSENDKKKKETKIKNDSPNGYEEKDRTS 46          
BLAST of Potassium channel subfamily K member 18 vs. Planmine SMEST
Match: SMESG000078172.1 (SMESG000078172.1)

HSP 1 Score: 288.886 bits (738), Expect = 8.507e-89
Identity = 198/531 (37.29%), Postives = 287/531 (54.05%), Query Frame = 2
Query:  419 DNIEVETSFEDNDNLIYPSSNPNKFHNHKPKIKNEEALKFWKSKEHCIXXXXXXXXXXXXNIGLTLLIVTYILLGACMFQFFELKHELATFET-NSNKVLRNLNKSKSRIESEHEQIVLDIKNETKINLMKFLNETFTENQIQIGNLTEIFHEIKIQIQSA--QSEIDRSFKE-----EILCQSTVNNSCERNDSEAIGKTWKNISNKLQSVNENVEIILKKIDNLSNFINMKYNGKDINSLIGNNLSLRQKSSFIESLTKNFENLTETVFDVTKDGWIHENGHIGTEKGSGKTLWTFGGSILYCITVITTIGYGHITPKTIPGRFGTIIYAIFGIPIMLICLAHIGSLMANMFRLIYRVSCLXXXXXXXXXXXXXXXXXXXXXXTSNELLDKSDDEDNQISLTVV-KNPHNPTGNYFGSTVQFRKILFHIPNPNRLLEAAKKSKSVEVPVSLVITVFIIYNLVGSVFFTICEGWKITDSFYFSFITLSTIGFGDFVPVAIGNEAEQYKSIMCSFYVLFGLSLCVMSFDLM 1984
            D IE  +      N++  S +     N+K  I  EE++KFWKS+ H    ++    ++FSNIGL+L ++ Y+LLGA +FQF E   E+  ++T   + VL  LN +        EQI++  +N       +F    F  N  Q  +    ++E +I +      SE  R F++     +ILC  T N    +N+ E     W         + +   +IL + +NL N +   YN  +     GN  S + +  F   +    E  +  +F+ + +G  H++ H  + K    T+W FGG++LY +TVITTIGYGHITP+T  GR  TI+YAI GIP+M+ICLA+IG+LMA++ RLIYR+  ++   K K                 N   D   D    +++TV+ KN      N F S  Q   + F +P PN +L+AA++SKS EVP +LV  +FI YNL+GS  F   E W   ++ YFSFITLSTIGFGD VP+    + EQYKSI+CS YVLFGLSLC+M FDL+
Sbjct:   53 DGIESLSGENCKSNILLESESFKNSFNNKTYITPEESIKFWKSRAHFKTCTQRFFEIVFSNIGLSLAVIVYVLLGAFIFQFLEEMSEITRYKTYKKDVVLAKLNIT--------EQIMMIHQN------FEFPKSKFHLNHSQASSNELNYYEFRIFLNKILFYSETFRDFQQNKTLFQILCNGTDN---FKNNEENCNFNW---------LADFYNLILPRFENLYNVL---YNTSED---FGN--SEQNQIKFKTLIKVEIEKFSNVIFNASSNGLSHKSFH-ESNKEEENTMWNFGGALLYAVTVITTIGYGHITPQTPLGRITTILYAIMGIPLMIICLANIGTLMADILRLIYRIFSMRKNNKPKMV---------------NVKSDSFSDIFKSLTITVIRKNKLETKDNNFQSIFQNCNVSFKLPTPNSILKAARQSKSTEVPATLVFFIFIFYNLIGSTIFMYWEDWNFLEAVYFSFITLSTIGFGDLVPIKSTRQTEQYKSIICSIYVLFGLSLCIMCFDLL 533          
BLAST of Potassium channel subfamily K member 18 vs. Planmine SMEST
Match: SMESG000031911.1 (SMESG000031911.1)

HSP 1 Score: 196.052 bits (497), Expect = 6.503e-54
Identity = 158/506 (31.23%), Postives = 260/506 (51.38%), Query Frame = 2
Query:  548 KEHCIXXXXXXXXXXXXNIGLTLLIVTYILLGACMFQFFELKHELATFETNSNKVLRNLNKSKSRIESEHEQIV---------LDIKNETKINLMKFLNETFTENQIQIGN----LTEIFHEIKIQIQSAQSEIDRSFKEEILCQSTVNNSCERNDSEAIGKTWKNISNKLQSVNENVEIILKKIDNLSN-FINMKYNGKDINSLIGNNLSLR--QKSSFI----ESLTKNFENLTETVFDVTKDGWIHENGHIGTEKGSGKTLWTFGGSILYCITVITTIGYGHITPKTIPGRFGTIIYAIFGIPIMLICLAHIGSLMANMFRLIYRVSCLXXXXXXXXXXXXXXXXXXXXXXTSNELLDKSDDEDNQISLTVV-KNPHNPTGNYFGSTVQFRKILFHIP--NPNRLLEAAKKSKSVEVPVSLVITVFIIYNLVGSVFFTICEGWKITDSFYFSFITLSTIGFGDFVP--VAIGNEAE-QYKSIMCSFYVLFGLSLCVMSFDLME 1987
            ++ CI   K +++  FS IG+  ++V YI+ G  +FQ  E K+E+   ++  + +  +L K   +I S  ++ V         L I   ++ NL   L E F  N+ Q+ N    L   F +++  IQ   + I  +       +   NNS     +  I      ISN+L  V E +    KK++ L N F      G+D   L      L+   K+ F     + +    + L  +VF+ T++G++  NG+I         LWTF G++LY IT+ITTIGYGHI PKT  GRF TI+YAI GIP+ML+CL ++G +MA++F+ +YR +C     K     + + +  +K   + N    +S +++    + ++ +NP +       +          +P  N N +    + S+ V+VP+ L +T+  +Y LVG+  F+  +GW   +S YF FITL+TIGFGD VP    +G +++ Q KSI C+FY++ GL++  M F L++
Sbjct:  117 RQKCIRCCKQSIAFFFSQIGVMCIVVAYIIAGGFLFQNLEAKNEINISKSGESNINDSLKKLMEKIRSSEQETVDKYKSFCKRLIINQSSESNLR--LTEFFNVNKKQLNNAIYTLQWNFQDMRTFIQEKITNIQSNLNLTKSSKFVSNNS-----ALVIKDNLIEISNRLWDVGEEI----KKLEALQNTFKTFPNQGEDPPLLKTKVKLLKTIDKTEFPNKDSDVINGKIKYLILSVFNATRNGYVF-NGNI---------LWTFSGALLYSITIITTIGYGHIVPKTFSGRFLTIVYAIIGIPLMLLCLTNLGKVMADLFKFMYRFTCF----KVYIKSRKRKECKQKLLDSQNNQRKRSGNQNKPEFINILSENPSSILKKEITTKPTMHSFRMSLPLGNANFMDSVHEISEEVDVPIWLPLTILGLYILVGAAVFSYWDGWTFFESCYFVFITLTTIGFGDLVPGNFELGEKSQDQTKSIFCAFYLVTGLAVFAMCFTLIQ 597          
BLAST of Potassium channel subfamily K member 18 vs. Planmine SMEST
Match: SMESG000024430.1 (SMESG000024430.1)

HSP 1 Score: 126.331 bits (316), Expect = 4.935e-31
Identity = 79/239 (33.05%), Postives = 126/239 (52.72%), Query Frame = 2
Query: 1280 WTFGGSILYCITVITTIGYGHITPKTIPGRFGTIIYAIFGIPIMLICLAHIGSLMANMFRLIYRVSCLXXXXXXXXXXXXXXXXXXXXXXTSNELLDKSDDEDNQISLTVVKNPHNPTGNYFGSTVQFRKILFHIPNPNRLLEAAKKSKSVEVPVSLVITVFIIYNLVGSVFFTICEG-WKITDSFYFSFITLSTIGFGDFVPVAIGNEAEQYKS--IMCSFYVLFGLSLCVMSFDLME 1987
            W    SI +C+T+ITTIGYG+ITP T  G+  ++IY+IFGIP+ML+ L ++G +MA  FR IY   C       ++                 E++D +++ D ++++     P    GN+    ++  + +F                 V +P+++V+ V  IY +VG+  F I E  W + D  YFS+ITL+TIGFGDFVP   G E  +  +  I+   Y L GL++  M  +L++
Sbjct:  126 WNIYNSIFFCVTIITTIGYGNITPLTDWGKINSMIYSIFGIPLMLLFLTNVGEIMATFFRFIYLNLCCCRCFISRRV----------------EIVDSTEN-DKKLNIEGQPPPKINEGNHPDYEIEDDENVF-----------------VVIPITVVLIVLFIYIIVGACLFRIWEQEWSMVDGTYFSYITLATIGFGDFVPGKDGFEKAETGTELIVGGMYCLLGLAILSMCLNLIQ 330          
BLAST of Potassium channel subfamily K member 18 vs. Planmine SMEST
Match: SMESG000016405.1 (SMESG000016405.1)

HSP 1 Score: 118.627 bits (296), Expect = 2.186e-28
Identity = 75/243 (30.86%), Postives = 124/243 (51.03%), Query Frame = 2
Query: 1280 WTFGGSILYCITVITTIGYGHITPKTIPGRFGTIIYAIFGIPIMLICLAHIGSLMANMFRLIYRVSCLXXXXXXXXXXXXXXXXXXXXXXTSNELLDKSDDEDNQISLTVVKNPHNPTGNYFGSTVQFRKI-----LFHIPNPNRLLEAAKKSKSVEVPVSLVITVFIIYNLVGSVFFTICEGWKITDSFYFSFITLSTIGFGDFVPV--AIGNEAEQYKSIMCSFYVLFGLSLCVMSFDLME 1987
            W    SI +C T+ITTIGYG+I P T+ GR   IIYA  GIP+ML+ L++ G ++A+ FR +Y   C                  + + ++ +E    S     +I    ++N  N   N   +T   + I     + ++ + N       + + + +P+++VI   IIY  +G++ F I E W +  + YFSFIT+STIGFGD  P    IG+     + I+ + Y + GL++  M  +L++
Sbjct:  118 WNLANSIFFCATIITTIGYGNIVPSTVWGRIVCIIYAFIGIPLMLLFLSNFGEVLASAFRFVYTNLCC------------CRCFVKGKYTSISEFESMSKRSAIEIKNFELENAENLNSNPVKATPPPKFIDEDLDIVYVDDEN------DQDEIINIPLTVVIGFLIIYMFLGALIFQIWETWDLVAAVYFSFITVSTIGFGDLYPAKNTIGSSVATLELIVGAVYCIIGLAILSMCLNLVK 342          
The following BLAST results are available for this feature:
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KCNK189.160e-1134.58potassium two pore domain channel subfamily K memb... [more]
KCNK91.127e-938.36potassium two pore domain channel subfamily K memb... [more]
KCNK91.127e-938.36potassium two pore domain channel subfamily K memb... [more]
KCNK91.127e-938.36potassium two pore domain channel subfamily K memb... [more]
KCNK91.127e-938.36potassium two pore domain channel subfamily K memb... [more]
back to top
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
twk-482.347e-3434.77TWiK family of potassium channels [Source:UniProt... [more]
twk-183.336e-2032.67TWiK family of potassium channels protein 18 [Sou... [more]
twk-183.336e-2032.67TWiK family of potassium channels protein 18 [Sou... [more]
twk-21.606e-1926.40TWiK family of potassium channels [Source:UniProt... [more]
twk-398.508e-1961.90TWiK family of potassium channels [Source:UniProt... [more]
back to top
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG343961.553e-2630.92gene:FBgn0085425 transcript:FBtr0112645[more]
CG343966.419e-2430.20gene:FBgn0085425 transcript:FBtr0112644[more]
CG91943.066e-2241.46gene:FBgn0035192 transcript:FBtr0072651[more]
CG108644.876e-2225.89gene:FBgn0038621 transcript:FBtr0083654[more]
CG16885.568e-1744.44gene:FBgn0027589 transcript:FBtr0088495[more]
back to top
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnk181.409e-1233.04potassium channel, subfamily K, member 18 [Source:... [more]
kcnk181.483e-1233.04potassium channel, subfamily K, member 18 [Source:... [more]
kcnk189.579e-1233.04potassium channel, subfamily K, member 18 [Source:... [more]
kcnk156.458e-1040.85potassium channel, subfamily K, member 15 [Source:... [more]
kcnk10b6.600e-1046.97potassium channel, subfamily K, member 10b [Source... [more]
back to top
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pole43.991e-1042.19polymerase (DNA-directed), epsilon 4, accessory su... [more]
pole48.169e-1030.09polymerase (DNA-directed), epsilon 4, accessory su... [more]
pole49.593e-1043.55polymerase (DNA-directed), epsilon 4, accessory su... [more]
ENSXETT00000028438.11.950e-941.98potassium channel subfamily K member 17 [Source:NC... [more]
tbc1d12.293e-942.19TBC1 domain family member 1 [Source:Xenbase;Acc:XB... [more]
back to top
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kcnk184.928e-1624.83potassium channel, subfamily K, member 18 [Source:... [more]
Kcnk152.270e-941.94potassium channel, subfamily K, member 15 [Source:... [more]
Kcnk152.640e-941.94potassium channel, subfamily K, member 15 [Source:... [more]
Kcnk92.840e-939.44potassium channel, subfamily K, member 9 [Source:M... [more]
Kcnk102.853e-946.97potassium channel, subfamily K, member 10 [Source:... [more]
back to top
BLAST of Potassium channel subfamily K member 18 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q18120|TWK18_CAEEL4.243e-1932.67TWiK family of potassium channels protein 18 OS=Ca... [more]
sp|Q6Q1P3|KCNKI_RAT1.924e-1525.46Potassium channel subfamily K member 18 OS=Rattus ... [more]
sp|Q6VV64|KCNKI_MOUSE3.447e-1524.83Potassium channel subfamily K member 18 OS=Mus mus... [more]
sp|A8X8I4|TWK12_CAEBR2.681e-1043.48TWiK family of potassium channels protein 12 OS=Ca... [more]
sp|Q7Z418|KCNKI_HUMAN4.399e-1034.58Potassium channel subfamily K member 18 OS=Homo sa... [more]
back to top
BLAST of Potassium channel subfamily K member 18 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A210QTX82.719e-4036.07TWiK family of potassium channels protein 18 OS=Mi... [more]
V3ZUS15.388e-3931.53Uncharacterized protein (Fragment) OS=Lottia gigan... [more]
A0A3R7JRV18.876e-3835.66TWiK family of potassium channels protein 18 OS=Cl... [more]
G7Y5R61.159e-3735.66Potassium channel subfamily K member 18 OS=Clonorc... [more]
A0A077ZBB54.818e-3734.97TWiK family of potassium channels protein 7 OS=Tri... [more]
back to top
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000047723.15.902e-1242.86pep primary_assembly:Astyanax_mexicanus-2.0:9:1589... [more]
KCNK162.331e-1037.25potassium channel subfamily K member 16 [Source:NC... [more]
ENSAMXT00000032793.13.415e-1045.00pep primary_assembly:Astyanax_mexicanus-2.0:22:285... [more]
kcnk154.421e-1044.29potassium channel subfamily K member 15-like [Sour... [more]
kcnk10b1.725e-947.46potassium two pore domain channel subfamily K memb... [more]
back to top
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000003416.11.685e-2732.06pep scaffold:Pmarinus_7.0:GL476517:78247:80718:1 g... [more]
kcnk13a1.944e-1125.56potassium channel, subfamily K, member 13a [Source... [more]
KCNK103.319e-841.18potassium two pore domain channel subfamily K memb... [more]
KCNK166.196e-737.50potassium two pore domain channel subfamily K memb... [more]
kcnk71.349e-639.34potassium channel, subfamily K, member 7 [Source:Z... [more]
back to top
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
TOK18.589e-634.55Outward-rectifier potassium channel of the plasma ... [more]
back to top
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO485644.744e-1826.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO434641.635e-1146.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO331931.696e-1145.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO359233.621e-1147.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO476686.649e-1150.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnk184.373e-1142.86potassium two pore domain channel subfamily K memb... [more]
kcnk156.490e-1047.27potassium channel subfamily K member 15 [Source:NC... [more]
kcnk97.677e-1047.27potassium two pore domain channel subfamily K memb... [more]
kcnk3b1.970e-941.94potassium channel subfamily K member 3 [Source:NCB... [more]
kcnk3a4.742e-941.94potassium two pore domain channel subfamily K memb... [more]
back to top
BLAST of Potassium channel subfamily K member 18 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000013544.13.606e-1498.92SMESG000013544.1[more]
SMESG000078172.18.507e-8937.29SMESG000078172.1[more]
SMESG000031911.16.503e-5431.23SMESG000031911.1[more]
SMESG000024430.14.935e-3133.05SMESG000024430.1[more]
SMESG000016405.12.186e-2830.86SMESG000016405.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024528 ID=SMED30024528|Name=Potassium channel subfamily K member 18|organism=Schmidtea mediterranea sexual|type=transcript|length=2093bp
AAACTATGAAAAAAGAAAATCCTGCCAAAAATTCTTTTAAATTCGATTAT
ATCGATTCCGATAGTGAAAATGATACGAAAAAAAAAGAAACCAAAATCAA
AAACGATTCACCAAATGGATATGAAGAAAAAGACAGGACATCGAATATGA
AAACGAAATGTCCGAAACACCAATTATTCCGAAATCGAATCTCGAAGAGG
TGAGATCACCAAGAGAAACAAAAATTGTCATTCTTGAATCACCGGATGGA
GATAGAGGGGACGACACAATACTCATATTAAACCAGGTGCCTTTTATTGA
AATGAAAGACAATCCTATCGAAAAGCGTGACAATAACTGTTTTAATAAAG
AAAATGAAATCAAATCAAAATTACCGAATGAAACCGACAGAGTTCAAGAA
AATTCTAAGAAAATCTTTGACAATATTGAAGTTGAAACTTCATTTGAAGA
TAATGATAATTTAATTTACCCATCATCAAATCCAAATAAGTTTCATAATC
ACAAACCAAAAATTAAAAATGAGGAAGCATTAAAGTTCTGGAAAAGTAAA
GAACATTGCATTTTATTTAGTAAGTTAGCCTTGTCTCTTTTGTTTAGCAA
TATCGGTTTGACATTATTAATCGTGACTTATATTTTACTTGGGGCCTGCA
TGTTCCAGTTTTTTGAATTGAAACATGAACTGGCAACATTTGAAACGAAT
TCAAACAAAGTTTTACGCAATTTAAACAAATCTAAAAGCAGAATCGAATC
GGAACATGAGCAAATTGTTTTAGATATTAAAAATGAAACTAAAATAAATC
TAATGAAATTTCTCAATGAAACATTCACTGAAAACCAAATCCAAATCGGA
AACCTCACAGAAATTTTCCATGAAATCAAGATCCAAATCCAATCTGCACA
GTCGGAAATAGATAGAAGCTTTAAAGAAGAAATCTTATGTCAGTCGACGG
TGAACAATTCATGCGAAAGAAATGATTCGGAAGCGATTGGAAAAACCTGG
AAAAATATCTCCAATAAGCTTCAAAGTGTCAATGAAAATGTGGAAATCAT
TTTAAAGAAAATTGACAACCTTTCCAATTTTATTAATATGAAATATAATG
GCAAAGATATTAATTCTCTCATAGGAAATAATTTGTCTTTGAGACAAAAA
AGTTCTTTTATTGAATCGCTAACTAAAAATTTCGAAAATTTGACTGAAAC
CGTTTTTGATGTAACAAAAGATGGCTGGATCCACGAAAATGGTCATATCG
GCACAGAAAAAGGATCCGGGAAAACTTTGTGGACTTTTGGCGGTTCAATT
CTATATTGCATAACTGTTATAACCACAATTGGTTATGGCCATATAACTCC
AAAAACGATTCCAGGTCGTTTCGGGACAATAATTTATGCAATATTCGGAA
TACCAATCATGTTGATATGCTTAGCTCACATAGGATCTCTCATGGCAAAC
ATGTTCCGATTGATTTACCGAGTCTCTTGCTTAAAAGCCTTTAAAAAGTA
CAAAAAATCTCAAAAATCAAAATGTCAGAATTCCGAAAAACAATCGAGCA
CTTCTAATGAATTGTTGGATAAATCCGATGATGAGGATAACCAAATCTCA
TTAACTGTTGTGAAAAATCCCCATAATCCAACAGGAAACTATTTCGGAAG
TACTGTCCAATTCCGGAAAATCCTTTTCCATATACCAAATCCAAACCGTT
TGCTGGAAGCTGCGAAAAAATCAAAATCTGTCGAAGTTCCTGTTTCATTG
GTTATCACAGTTTTCATCATTTACAATTTGGTTGGATCGGTATTTTTCAC
AATTTGTGAAGGTTGGAAAATCACTGATTCTTTCTATTTTTCTTTTATCA
CTCTCAGCACAATCGGTTTCGGGGATTTCGTTCCGGTAGCAATCGGAAAT
GAGGCGGAACAGTACAAATCGATAATGTGCTCTTTTTATGTCTTGTTCGG
CCTGTCTTTGTGTGTAATGTCATTTGATTTGATGGAGAAAAAATGTAAAA
GTACCATAAAAAAAACTGTTAAAAGAATTCGAAATAAAATATACAAGAAA
GATAATAAACAACGGAAAACTTAATTTACGACAAAAAACGGAC
back to top

protein sequence of SMED30024528-orf-1

>SMED30024528-orf-1 ID=SMED30024528-orf-1|Name=SMED30024528-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=639bp
MSETPIIPKSNLEEVRSPRETKIVILESPDGDRGDDTILILNQVPFIEMK
DNPIEKRDNNCFNKENEIKSKLPNETDRVQENSKKIFDNIEVETSFEDND
NLIYPSSNPNKFHNHKPKIKNEEALKFWKSKEHCILFSKLALSLLFSNIG
LTLLIVTYILLGACMFQFFELKHELATFETNSNKVLRNLNKSKSRIESEH
EQIVLDIKNETKINLMKFLNETFTENQIQIGNLTEIFHEIKIQIQSAQSE
IDRSFKEEILCQSTVNNSCERNDSEAIGKTWKNISNKLQSVNENVEIILK
KIDNLSNFINMKYNGKDINSLIGNNLSLRQKSSFIESLTKNFENLTETVF
DVTKDGWIHENGHIGTEKGSGKTLWTFGGSILYCITVITTIGYGHITPKT
IPGRFGTIIYAIFGIPIMLICLAHIGSLMANMFRLIYRVSCLKAFKKYKK
SQKSKCQNSEKQSSTSNELLDKSDDEDNQISLTVVKNPHNPTGNYFGSTV
QFRKILFHIPNPNRLLEAAKKSKSVEVPVSLVITVFIIYNLVGSVFFTIC
EGWKITDSFYFSFITLSTIGFGDFVPVAIGNEAEQYKSIMCSFYVLFGLS
LCVMSFDLMEKKCKSTIKKTVKRIRNKIYKKDNKQRKT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR0032802pore_dom_K_chnl
IPR013099K_chnl_dom
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0071805potassium ion transmembrane transport
GO:0006810transport
GO:0006811ion transport
Vocabulary: molecular function
TermDefinition
GO:0005267potassium channel activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..67
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..51