Cyclic nucleotide gated channel 1

Overview
NameCyclic nucleotide gated channel 1
Smed IDSMED30024524
Length (bp)2050
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cyclic nucleotide gated channel 1 (SMED30024524) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cyclic nucleotide gated channel 1 (SMED30024524) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024524

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30024524SMESG000069424.1 SmedASXL_000646SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30024524SMESG000069435.1 SmedASXL_001981SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30024524SMESG000069424.1 SmedASXL_000418SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30024524SMESG000069435.1 SMESG000069424.1 dd_Smed_v4_48357_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30024524SMESG000069435.1 SMESG000069424.1 dd_Smed_v6_48357_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30024524SMESG000069435.1 SMESG000069424.1 OX_Smed_1.0.13306ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Human
Match: HCN1 (hyperpolarization activated cyclic nucleotide gated potassium channel 1 [Source:HGNC Symbol;Acc:HGNC:4845])

HSP 1 Score: 435.261 bits (1118), Expect = 2.905e-144
Identity = 232/440 (52.73%), Postives = 313/440 (71.14%), Query Frame = 3
Query:  516 EYIGGGAPGYRHPRLSASMYLKEQICSLFQPGDNKLAMKLFGTQSALLKEKSRQKKHGHWIIHPCSSFRFYWDLLMLMVLVANLIVLPVAISFFNDDLSKRWLVFNGVSDTIFLLDIGVNFRTGIILNDFADEIILNPKQIAKHYARSWFIIDFLSSIPVDYIFLILNNTNHFSQFMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYISQWEEFF----NTASKFIGIFNLVLMMLLLGHWNACLQFLIPMMREFPNDCWIVKCNLKEANWFDQYTWSLFKAMSHMLSIGYGRFPPTSTSEAWVTIVSMMTGATCYALFVGHAAALIQSYDTSKRLYREKYKQVEEYMGYRKLPRLLRQKITDYYEHRYQGNMFNEIDILQELSECLREKVINYNCRGLVASVPFFKNADDILYRK*LSNFIMKSFN------REISLSKK 1805
            E   GG      PR     +++ Q  S+ QPG NK ++++FG+Q A+ KE+ R K  G WIIHP S FRFYWDL+ML+++V NL+++PV I+FF +  +  W++FN  SDT+FLLD+ +NFRTG + N+ + EIIL+PK I  +Y +SWF++DF+SSIPVDYIFLI+      S+     RALRI+R  K+LSLLRLLRLSRL+RYI QWEE F    + AS  + IFNL+ MMLLL HW+ CLQFL+P++++FP DCW+    +   +W  QY+++LFKAMSHML IGYG   P S S+ W+T++SM+ GATCYA+FVGHA ALIQS D+S+R Y+EKYKQVE+YM + KLP  +RQKI DYYEHRYQG +F+E +IL EL++ LRE+++N+NCR LVA++P F NAD       LS    + F       RE ++ KK
Sbjct:   75 EEPAGGFEDAEGPRRQYG-FMQRQFTSMLQPGVNKFSLRMFGSQKAVEKEQERVKTAGFWIIHPYSDFRFYWDLIMLIMMVGNLVIIPVGITFFTEQTTTPWIIFNVASDTVFLLDLIMNFRTGTV-NEDSSEIILDPKVIKMNYLKSWFVVDFISSIPVDYIFLIVEKGMD-SEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAVVRIFNLIGMMLLLCHWDGCLQFLVPLLQDFPPDCWVSLNEMVNDSWGKQYSYALFKAMSHMLCIGYGAQAPVSMSDLWITMLSMIVGATCYAMFVGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADMRQKIHDYYEHRYQGKIFDEENILNELNDPLREEIVNFNCRKLVATMPLFANADPNFVTAMLSKLRFEVFQPGDYIIREGAVGKK 511          

HSP 2 Score: 132.494 bits (332), Expect = 1.112e-31
Identity = 62/105 (59.05%), Postives = 78/105 (74.29%), Query Frame = 2
Query: 1736 FVSEVVVKLHYEVFQPGDFIIKEGTVGSQMYFIQEGIVDIITKDGEIATSLSDGSYFGEICLLADTRRVASVRAVTYCNVYSLDRESFLSVLEHYPIMRRTMESV 2050
            FV+ ++ KL +EVFQPGD+II+EG VG +MYFIQ G+  +ITK  +    L+DGSYFGEICLL   RR ASVRA TYC +YSL  ++F  VLE YP+MRR  E+V
Sbjct:  483 FVTAMLSKLRFEVFQPGDYIIREGAVGKKMYFIQHGVAGVITKSSK-EMKLTDGSYFGEICLLTKGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETV 586          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Human
Match: HCN4 (hyperpolarization activated cyclic nucleotide gated potassium channel 4 [Source:HGNC Symbol;Acc:HGNC:16882])

HSP 1 Score: 447.973 bits (1151), Expect = 1.546e-142
Identity = 234/427 (54.80%), Postives = 311/427 (72.83%), Query Frame = 3
Query:  555 RLSASMYLKEQICSLFQPGDNKLAMKLFGTQSALLKEKSRQKKHGHWIIHPCSSFRFYWDLLMLMVLVANLIVLPVAISFFNDDLSKRWLVFNGVSDTIFLLDIGVNFRTGIILNDFADEIILNPKQIAKHYARSWFIIDFLSSIPVDYIFLILNNTNHFSQFMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYISQWEEFF----NTASKFIGIFNLVLMMLLLGHWNACLQFLIPMMREFPNDCWIVKCNLKEANWFDQYTWSLFKAMSHMLSIGYGRFPPTSTSEAWVTIVSMMTGATCYALFVGHAAALIQSYDTSKRLYREKYKQVEEYMGYRKLPRLLRQKITDYYEHRYQGNMFNEIDILQELSECLREKVINYNCRGLVASVPFFKNADDILYRK*LSNFIMKSFN------REISLSKK 1805
            RL  + +++ Q  ++ QPG NK ++++FG+Q A+ +E+ R K  G WIIHP S FRFYWDL ML+++V NLI++PV I+FF D+ +  W+VFN VSDT FL+D+ +NFRTGI++ D   EIIL+P++I   Y +SWF++DF+SSIPVDYIFLI+  T   S+     RALRI+R  K+LSLLRLLRLSRL+RYI QWEE F    + AS  + I NL+ MMLLL HW+ CLQFL+PM+++FP+DCW+   N+   +W  QY+++LFKAMSHML IGYGR  P   S+ W+T++SM+ GATCYA+F+GHA ALIQS D+S+R Y+EKYKQVE+YM + KLP   RQ+I DYYEHRYQG MF+E  IL ELSE LRE++IN+NCR LVAS+P F NAD       L+    + F       RE ++ KK
Sbjct:  207 RLGQAGFMQRQFGAMLQPGVNKFSLRMFGSQKAVEREQERVKSAGFWIIHPYSDFRFYWDLTMLLLMVGNLIIIPVGITFFKDENTTPWIVFNVVSDTFFLIDLVLNFRTGIVVED-NTEIILDPQRIKMKYLKSWFMVDFISSIPVDYIFLIVE-TRIDSEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAVVRIVNLIGMMLLLCHWDGCLQFLVPMLQDFPDDCWVSINNMVNNSWGKQYSYALFKAMSHMLCIGYGRQAPVGMSDVWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPPDTRQRIHDYYEHRYQGKMFDEESILGELSEPLREEIINFNCRKLVASMPLFANADPNFVTSMLTKLRFEVFQPGDYIIREGTIGKK 631          

HSP 2 Score: 141.354 bits (355), Expect = 4.501e-34
Identity = 64/105 (60.95%), Postives = 81/105 (77.14%), Query Frame = 2
Query: 1736 FVSEVVVKLHYEVFQPGDFIIKEGTVGSQMYFIQEGIVDIITKDGEIATSLSDGSYFGEICLLADTRRVASVRAVTYCNVYSLDRESFLSVLEHYPIMRRTMESV 2050
            FV+ ++ KL +EVFQPGD+II+EGT+G +MYFIQ G+V ++TK G   T L+DGSYFGEICLL   RR ASVRA TYC +YSL  ++F  VLE YP+MRR  E+V
Sbjct:  603 FVTSMLTKLRFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTK-GNKETKLADGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETV 706          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Human
Match: HCN1 (hyperpolarization activated cyclic nucleotide gated potassium channel 1 [Source:HGNC Symbol;Acc:HGNC:4845])

HSP 1 Score: 438.728 bits (1127), Expect = 4.079e-142
Identity = 232/440 (52.73%), Postives = 313/440 (71.14%), Query Frame = 3
Query:  516 EYIGGGAPGYRHPRLSASMYLKEQICSLFQPGDNKLAMKLFGTQSALLKEKSRQKKHGHWIIHPCSSFRFYWDLLMLMVLVANLIVLPVAISFFNDDLSKRWLVFNGVSDTIFLLDIGVNFRTGIILNDFADEIILNPKQIAKHYARSWFIIDFLSSIPVDYIFLILNNTNHFSQFMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYISQWEEFF----NTASKFIGIFNLVLMMLLLGHWNACLQFLIPMMREFPNDCWIVKCNLKEANWFDQYTWSLFKAMSHMLSIGYGRFPPTSTSEAWVTIVSMMTGATCYALFVGHAAALIQSYDTSKRLYREKYKQVEEYMGYRKLPRLLRQKITDYYEHRYQGNMFNEIDILQELSECLREKVINYNCRGLVASVPFFKNADDILYRK*LSNFIMKSFN------REISLSKK 1805
            E   GG      PR     +++ Q  S+ QPG NK ++++FG+Q A+ KE+ R K  G WIIHP S FRFYWDL+ML+++V NL+++PV I+FF +  +  W++FN  SDT+FLLD+ +NFRTG + N+ + EIIL+PK I  +Y +SWF++DF+SSIPVDYIFLI+      S+     RALRI+R  K+LSLLRLLRLSRL+RYI QWEE F    + AS  + IFNL+ MMLLL HW+ CLQFL+P++++FP DCW+    +   +W  QY+++LFKAMSHML IGYG   P S S+ W+T++SM+ GATCYA+FVGHA ALIQS D+S+R Y+EKYKQVE+YM + KLP  +RQKI DYYEHRYQG +F+E +IL EL++ LRE+++N+NCR LVA++P F NAD       LS    + F       RE ++ KK
Sbjct:   75 EEPAGGFEDAEGPRRQYG-FMQRQFTSMLQPGVNKFSLRMFGSQKAVEKEQERVKTAGFWIIHPYSDFRFYWDLIMLIMMVGNLVIIPVGITFFTEQTTTPWIIFNVASDTVFLLDLIMNFRTGTV-NEDSSEIILDPKVIKMNYLKSWFVVDFISSIPVDYIFLIVEKGMD-SEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAVVRIFNLIGMMLLLCHWDGCLQFLVPLLQDFPPDCWVSLNEMVNDSWGKQYSYALFKAMSHMLCIGYGAQAPVSMSDLWITMLSMIVGATCYAMFVGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADMRQKIHDYYEHRYQGKIFDEENILNELNDPLREEIVNFNCRKLVATMPLFANADPNFVTAMLSKLRFEVFQPGDYIIREGAVGKK 511          

HSP 2 Score: 132.88 bits (333), Expect = 1.758e-31
Identity = 62/105 (59.05%), Postives = 78/105 (74.29%), Query Frame = 2
Query: 1736 FVSEVVVKLHYEVFQPGDFIIKEGTVGSQMYFIQEGIVDIITKDGEIATSLSDGSYFGEICLLADTRRVASVRAVTYCNVYSLDRESFLSVLEHYPIMRRTMESV 2050
            FV+ ++ KL +EVFQPGD+II+EG VG +MYFIQ G+  +ITK  +    L+DGSYFGEICLL   RR ASVRA TYC +YSL  ++F  VLE YP+MRR  E+V
Sbjct:  483 FVTAMLSKLRFEVFQPGDYIIREGAVGKKMYFIQHGVAGVITKSSK-EMKLTDGSYFGEICLLTKGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETV 586          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Human
Match: HCN2 (hyperpolarization activated cyclic nucleotide gated potassium and sodium channel 2 [Source:HGNC Symbol;Acc:HGNC:4846])

HSP 1 Score: 437.958 bits (1125), Expect = 7.377e-142
Identity = 234/446 (52.47%), Postives = 315/446 (70.63%), Query Frame = 3
Query:  498 SEQSLSEYIGGGAPGYRHPRLSASMYLKEQICSLFQPGDNKLAMKLFGTQSALLKEKSRQKKHGHWIIHPCSSFRFYWDLLMLMVLVANLIVLPVAISFFNDDLSKRWLVFNGVSDTIFLLDIGVNFRTGIILNDFADEIILNPKQIAKHYARSWFIIDFLSSIPVDYIFLILNNTNHFSQFMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYISQWEEFF----NTASKFIGIFNLVLMMLLLGHWNACLQFLIPMMREFPNDCWIVKCNLKEANWFDQYTWSLFKAMSHMLSIGYGRFPPTSTSEAWVTIVSMMTGATCYALFVGHAAALIQSYDTSKRLYREKYKQVEEYMGYRKLPRLLRQKITDYYEHRYQGNMFNEIDILQELSECLREKVINYNCRGLVASVPFFKNADDILYRK*LSNFIMKSFN------REISLSKK 1805
            +E++ SE  G        PR S + +++ Q  +L QPG NK ++++FG+Q A+ +E+ R K  G WIIHP S FRFYWD  ML+ +V NLI++PV I+FF D+ +  W+VFN VSDT FL+D+ +NFRTGI++ D   EIIL+P++I K Y R+WF++DF+SSIPVDYIFLI+      S+     RALRI+R  K+LSLLRLLRLSRL+RYI QWEE F    + AS  + I NL+ MMLLL HW+ CLQFL+PM+++FP +CW+    +   +W + Y+++LFKAMSHML IGYGR  P S ++ W+T++SM+ GATCYA+F+GHA ALIQS D+S+R Y+EKYKQVE+YM + KLP   RQKI DYYEHRYQG MF+E  IL EL+  LRE+++N+NCR LVAS+P F NAD       L+    + F       RE ++ KK
Sbjct:  141 AEEAGSEEAGPAG----EPRGSQASFMQRQFGALLQPGVNKFSLRMFGSQKAVEREQERVKSAGAWIIHPYSDFRFYWDFTMLLFMVGNLIIIPVGITFFKDETTAPWIVFNVVSDTFFLMDLVLNFRTGIVIED-NTEIILDPEKIKKKYLRTWFVVDFVSSIPVDYIFLIVEKGID-SEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAVMRICNLISMMLLLCHWDGCLQFLVPMLQDFPRNCWVSINGMVNHSWSELYSFALFKAMSHMLCIGYGRQAPESMTDIWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKK 580          

HSP 2 Score: 137.502 bits (345), Expect = 6.286e-33
Identity = 64/105 (60.95%), Postives = 80/105 (76.19%), Query Frame = 2
Query: 1736 FVSEVVVKLHYEVFQPGDFIIKEGTVGSQMYFIQEGIVDIITKDGEIATSLSDGSYFGEICLLADTRRVASVRAVTYCNVYSLDRESFLSVLEHYPIMRRTMESV 2050
            FV+ ++ KL +EVFQPGD+II+EGT+G +MYFIQ G+V ++TK G     LSDGSYFGEICLL   RR ASVRA TYC +YSL  ++F  VLE YP+MRR  E+V
Sbjct:  552 FVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTK-GNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETV 655          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Human
Match: HCN3 (hyperpolarization activated cyclic nucleotide gated potassium channel 3 [Source:HGNC Symbol;Acc:HGNC:19183])

HSP 1 Score: 419.468 bits (1077), Expect = 3.927e-136
Identity = 222/420 (52.86%), Postives = 298/420 (70.95%), Query Frame = 3
Query:  579 KEQICSLFQPGDNKLAMKLFGTQSALLKEKSRQKKHGHWIIHPCSSFRFYWDLLMLMVLVANLIVLPVAISFFNDDLSKRWLVFNGVSDTIFLLDIGVNFRTGIILNDFADEIILNPKQIAKHYARSWFIIDFLSSIPVDYIFLILNNTNHF-SQFMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYISQWEEFF----NTASKFIGIFNLVLMMLLLGHWNACLQFLIPMMREFPNDCWIVKCNLKEANWFDQYTWSLFKAMSHMLSIGYGRFPPTSTSEAWVTIVSMMTGATCYALFVGHAAALIQSYDTSKRLYREKYKQVEEYMGYRKLPRLLRQKITDYYEHRYQGNMFNEIDILQELSECLREKVINYNCRGLVASVPFFKNADDILYRK*LSNFIMKSFN------REISLSKK 1805
            +  + +L QP  NK ++++FG+  A+  E+ R K  G WIIHP S FRFYWDL+ML+++V NLIVLPV I+FF ++ S  W+VFN +SDT FLLD+ +NFRTGI++ + A EI+L P+ I   Y R+WF++D +SSIPVDYIFL++       ++     RALRI+R  K+LSLLRLLRLSRL+RYI QWEE F    + AS  + IFNL+ MMLLL HW+ CLQFL+PM+++FP DCW+   ++   +W  QY+ +LFKAMSHML IGYG+  P    + W+T++SM+ GATCYA+F+GHA ALIQS D+S+R Y+EKYKQVE+YM + KLP   RQ+I +YYEHRYQG MF+E  IL ELSE LRE++IN+ CRGLVA +P F +AD       L+    + F       RE S+ +K
Sbjct:   46 RRHLGTLLQPTVNKFSLRVFGSHKAVEIEQERVKSAGAWIIHPYSDFRFYWDLIMLLLMVGNLIVLPVGITFFKEENSPPWIVFNVLSDTFFLLDLVLNFRTGIVVEEGA-EILLAPRAIRTRYLRTWFLVDLISSIPVDYIFLVVELEPRLDAEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAVVRIFNLIGMMLLLCHWDGCLQFLVPMLQDFPPDCWVSINHMVNHSWGRQYSHALFKAMSHMLCIGYGQQAPVGMPDVWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADTRQRIHEYYEHRYQGKMFDEESILGELSEPLREEIINFTCRGLVAHMPLFAHADPSFVTAVLTKLRFEVFQPGDLVVREGSVGRK 464          

HSP 2 Score: 130.183 bits (326), Expect = 1.003e-30
Identity = 59/105 (56.19%), Postives = 79/105 (75.24%), Query Frame = 2
Query: 1736 FVSEVVVKLHYEVFQPGDFIIKEGTVGSQMYFIQEGIVDIITKDGEIATSLSDGSYFGEICLLADTRRVASVRAVTYCNVYSLDRESFLSVLEHYPIMRRTMESV 2050
            FV+ V+ KL +EVFQPGD +++EG+VG +MYFIQ G++ ++ + G   T L+DGSYFGEICLL   RR ASVRA TYC +YSL  + F +VLE +P+MRR  E+V
Sbjct:  436 FVTAVLTKLRFEVFQPGDLVVREGSVGRKMYFIQHGLLSVLAR-GARDTRLTDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDHFNAVLEEFPMMRRAFETV 539          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Celegans
Match: unc-103 (Potassium voltage-gated channel unc-103 [Source:UniProtKB/Swiss-Prot;Acc:G5EFJ9])

HSP 1 Score: 118.242 bits (295), Expect = 8.993e-35
Identity = 109/435 (25.06%), Postives = 207/435 (47.59%), Query Frame = 3
Query:  534 APGYRHPRLSASMYLKEQICSLFQPGDNKLAMKLFGTQSALLKEKSRQKKHGH--WIIHPCSSFRFYWDLLMLMVLVANLIVLPVAISFFNDDL---------SKRWLVFNGVSDTIFLLDIGVNFRTGII-LNDFADEIILNPKQIAKHYARSWFIIDFLSSIPVDYIFLILNNTNHFSQFMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYISQWEEFFNTASKFIGIFNLVLMML---LLGHWNACLQFLIPMM----REFPNDCWIVKCNLKEANWF---------------DQYTWSLFKAMSHMLSIGYGRFPPTSTSEAWVTIVSMMTGATCYALFVGHAAALIQSYDTSKRLYREKYKQVEEYMGYRKLPRLLRQKITDYYEHRYQGNMFNEID---ILQELSECLREKVINYNCRGLVASVPFFKNA 1727
            APG   PR S S     ++       +N  A+ +    + +L E   Q    H   I+H  S F+  WD ++L++++   +  P   +F   +L         ++   + + + D +F++DI +NFRT  +  ND A +++ +P +IA HY + WFIID ++++P D + L+  N++  +  +             LL   RLLRL R+ R + ++ E+        G   L+L+M    L+ HW AC+ + I       +E+    W+ + + + A  +                +Y  SL+  +S + SIG+G    T+ SE   TI+ M+ G+  YA   G+ +A+IQ   +    Y  +  ++ E++ + ++P  LRQ++ +Y++H +  +  N ID   +L+   +CL+  +  +  R L++    F  +
Sbjct:   61 APGAGGPRASHSSRRTSRL------HNNVSALGVLSLGADVLPEYKLQPTRIHHCTIVH-YSPFKAVWDWIILLLVIYTAVFTPYVAAFLLRELQDTAKKSRFTEPLEIVDLIVDIMFIVDIIINFRTTYVNENDEACQVVSDPGKIATHYFKGWFIIDMVAAVPFD-LLLVSTNSDETTTLI------------GLLKTARLLRLVRVARKLDRYSEY--------GAAVLLLLMATFALIAHWLACIWYAIGSAELSHKEY---TWLHQLSKQLAQPYTSTNGTIPTGGPTLKSRYVTSLYFTLSTITSIGFGNVSATTDSEKIFTIIMMILGSLMYASVFGNVSAIIQRLYSGTARYHTEMSRLREFIRFHQIPNPLRQRLEEYFQHAW--SYTNGIDMNLVLKGFPDCLQADICLHLNRNLLSGCAAFAGS 462          

HSP 2 Score: 48.9062 bits (115), Expect = 8.993e-35
Identity = 30/83 (36.14%), Postives = 47/83 (56.63%), Query Frame = 2
Query: 1781 PGDFIIKEGTVGSQMYFIQEGIVDIITKDGEIATSLSDGSYFGEICLLADT--RRVASVRAVTYCNVYSLDRESFLSVLEHYP 2023
            PGD ++  G + + +YFI  G V+I+  D  +   L     FGE  LL D   +   +VRA+TYC+++ + R+  L VL+ YP
Sbjct:  481 PGDTLVHRGDILTGLYFIARGSVEILNDDNTVMGILGKDDIFGENPLLYDEVGKSSCNVRALTYCDLHKILRDDLLDVLDMYP 563          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Celegans
Match: unc-103 (Potassium voltage-gated channel unc-103 [Source:UniProtKB/Swiss-Prot;Acc:G5EFJ9])

HSP 1 Score: 115.161 bits (287), Expect = 6.791e-34
Identity = 102/405 (25.19%), Postives = 196/405 (48.40%), Query Frame = 3
Query:  624 AMKLFGTQSALLKEKSRQKKHGH--WIIHPCSSFRFYWDLLMLMVLVANLIVLPVAISFFNDDL---------SKRWLVFNGVSDTIFLLDIGVNFRTGII-LNDFADEIILNPKQIAKHYARSWFIIDFLSSIPVDYIFLILNNTNHFSQFMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYISQWEEFFNTASKFIGIFNLVLMML---LLGHWNACLQFLIPMM----REFPNDCWIVKCNLKEANWF---------------DQYTWSLFKAMSHMLSIGYGRFPPTSTSEAWVTIVSMMTGATCYALFVGHAAALIQSYDTSKRLYREKYKQVEEYMGYRKLPRLLRQKITDYYEHRYQGNMFNEID---ILQELSECLREKVINYNCRGLVASVPFFKNA 1727
            A K+    + +L E   Q    H   I+H  S F+  WD ++L++++   +  P   +F   +L         ++   + + + D +F++DI +NFRT  +  ND A +++ +P +IA HY + WFIID ++++P D + L+  N++  +  +             LL   RLLRL R+ R + ++ E+        G   L+L+M    L+ HW AC+ + I       +E+    W+ + + + A  +                +Y  SL+  +S + SIG+G    T+ SE   TI+ M+ G+  YA   G+ +A+IQ   +    Y  +  ++ E++ + ++P  LRQ++ +Y++H +  +  N ID   +L+   +CL+  +  +  R L++    F  +
Sbjct:  119 AQKVLSLGADVLPEYKLQPTRIHHCTIVH-YSPFKAVWDWIILLLVIYTAVFTPYVAAFLLRELQDTAKKSRFTEPLEIVDLIVDIMFIVDIIINFRTTYVNENDEACQVVSDPGKIATHYFKGWFIIDMVAAVPFD-LLLVSTNSDETTTLI------------GLLKTARLLRLVRVARKLDRYSEY--------GAAVLLLLMATFALIAHWLACIWYAIGSAELSHKEY---TWLHQLSKQLAQPYTSTNGTIPTGGPTLKSRYVTSLYFTLSTITSIGFGNVSATTDSEKIFTIIMMILGSLMYASVFGNVSAIIQRLYSGTARYHTEMSRLREFIRFHQIPNPLRQRLEEYFQHAW--SYTNGIDMNLVLKGFPDCLQADICLHLNRNLLSGCAAFAGS 496          

HSP 2 Score: 48.9062 bits (115), Expect = 6.791e-34
Identity = 30/83 (36.14%), Postives = 47/83 (56.63%), Query Frame = 2
Query: 1781 PGDFIIKEGTVGSQMYFIQEGIVDIITKDGEIATSLSDGSYFGEICLLADT--RRVASVRAVTYCNVYSLDRESFLSVLEHYP 2023
            PGD ++  G + + +YFI  G V+I+  D  +   L     FGE  LL D   +   +VRA+TYC+++ + R+  L VL+ YP
Sbjct:  515 PGDTLVHRGDILTGLYFIARGSVEILNDDNTVMGILGKDDIFGENPLLYDEVGKSSCNVRALTYCDLHKILRDDLLDVLDMYP 597          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Celegans
Match: unc-103 (Potassium voltage-gated channel unc-103 [Source:UniProtKB/Swiss-Prot;Acc:G5EFJ9])

HSP 1 Score: 114.39 bits (285), Expect = 1.153e-33
Identity = 102/409 (24.94%), Postives = 198/409 (48.41%), Query Frame = 3
Query:  612 DNKLAMKLFGTQSALLKEKSRQKKHGH--WIIHPCSSFRFYWDLLMLMVLVANLIVLPVAISFFNDDL---------SKRWLVFNGVSDTIFLLDIGVNFRTGII-LNDFADEIILNPKQIAKHYARSWFIIDFLSSIPVDYIFLILNNTNHFSQFMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYISQWEEFFNTASKFIGIFNLVLMML---LLGHWNACLQFLIPMM----REFPNDCWIVKCNLKEANWF---------------DQYTWSLFKAMSHMLSIGYGRFPPTSTSEAWVTIVSMMTGATCYALFVGHAAALIQSYDTSKRLYREKYKQVEEYMGYRKLPRLLRQKITDYYEHRYQGNMFNEID---ILQELSECLREKVINYNCRGLVASVPFFKNA 1727
            D++   K+    + +L E   Q    H   I+H  S F+  WD ++L++++   +  P   +F   +L         ++   + + + D +F++DI +NFRT  +  ND A +++ +P +IA HY + WFIID ++++P D + L+  N++  +  +             LL   RLLRL R+ R + ++ E+        G   L+L+M    L+ HW AC+ + I       +E+    W+ + + + A  +                +Y  SL+  +S + SIG+G    T+ SE   TI+ M+ G+  YA   G+ +A+IQ   +    Y  +  ++ E++ + ++P  LRQ++ +Y++H +  +  N ID   +L+   +CL+  +  +  R L++    F  +
Sbjct:   57 DDEEENKVLSLGADVLPEYKLQPTRIHHCTIVH-YSPFKAVWDWIILLLVIYTAVFTPYVAAFLLRELQDTAKKSRFTEPLEIVDLIVDIMFIVDIIINFRTTYVNENDEACQVVSDPGKIATHYFKGWFIIDMVAAVPFD-LLLVSTNSDETTTLI------------GLLKTARLLRLVRVARKLDRYSEY--------GAAVLLLLMATFALIAHWLACIWYAIGSAELSHKEY---TWLHQLSKQLAQPYTSTNGTIPTGGPTLKSRYVTSLYFTLSTITSIGFGNVSATTDSEKIFTIIMMILGSLMYASVFGNVSAIIQRLYSGTARYHTEMSRLREFIRFHQIPNPLRQRLEEYFQHAW--SYTNGIDMNLVLKGFPDCLQADICLHLNRNLLSGCAAFAGS 438          

HSP 2 Score: 48.9062 bits (115), Expect = 1.153e-33
Identity = 30/83 (36.14%), Postives = 47/83 (56.63%), Query Frame = 2
Query: 1781 PGDFIIKEGTVGSQMYFIQEGIVDIITKDGEIATSLSDGSYFGEICLLADT--RRVASVRAVTYCNVYSLDRESFLSVLEHYP 2023
            PGD ++  G + + +YFI  G V+I+  D  +   L     FGE  LL D   +   +VRA+TYC+++ + R+  L VL+ YP
Sbjct:  457 PGDTLVHRGDILTGLYFIARGSVEILNDDNTVMGILGKDDIFGENPLLYDEVGKSSCNVRALTYCDLHKILRDDLLDVLDMYP 539          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Celegans
Match: unc-103 (Potassium voltage-gated channel unc-103 [Source:UniProtKB/Swiss-Prot;Acc:G5EFJ9])

HSP 1 Score: 114.39 bits (285), Expect = 1.254e-33
Identity = 104/419 (24.82%), Postives = 202/419 (48.21%), Query Frame = 3
Query:  582 EQICSLFQPGDNKLAMKLFGTQSALLKEKSRQKKHGH--WIIHPCSSFRFYWDLLMLMVLVANLIVLPVAISFFNDDL---------SKRWLVFNGVSDTIFLLDIGVNFRTGII-LNDFADEIILNPKQIAKHYARSWFIIDFLSSIPVDYIFLILNNTNHFSQFMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYISQWEEFFNTASKFIGIFNLVLMML---LLGHWNACLQFLIPMM----REFPNDCWIVKCNLKEANWF---------------DQYTWSLFKAMSHMLSIGYGRFPPTSTSEAWVTIVSMMTGATCYALFVGHAAALIQSYDTSKRLYREKYKQVEEYMGYRKLPRLLRQKITDYYEHRYQGNMFNEID---ILQELSECLREKVINYNCRGLVASVPFFKNA 1727
            +Q+  + Q G    + K+    + +L E   Q    H   I+H  S F+  WD ++L++++   +  P   +F   +L         ++   + + + D +F++DI +NFRT  +  ND A +++ +P +IA HY + WFIID ++++P D + L+  N++  +  +             LL   RLLRL R+ R + ++ E+        G   L+L+M    L+ HW AC+ + I       +E+    W+ + + + A  +                +Y  SL+  +S + SIG+G    T+ SE   TI+ M+ G+  YA   G+ +A+IQ   +    Y  +  ++ E++ + ++P  LRQ++ +Y++H +  +  N ID   +L+   +CL+  +  +  R L++    F  +
Sbjct:   37 KQLMVVLQSG----SYKVLSLGADVLPEYKLQPTRIHHCTIVH-YSPFKAVWDWIILLLVIYTAVFTPYVAAFLLRELQDTAKKSRFTEPLEIVDLIVDIMFIVDIIINFRTTYVNENDEACQVVSDPGKIATHYFKGWFIIDMVAAVPFD-LLLVSTNSDETTTLI------------GLLKTARLLRLVRVARKLDRYSEY--------GAAVLLLLMATFALIAHWLACIWYAIGSAELSHKEY---TWLHQLSKQLAQPYTSTNGTIPTGGPTLKSRYVTSLYFTLSTITSIGFGNVSATTDSEKIFTIIMMILGSLMYASVFGNVSAIIQRLYSGTARYHTEMSRLREFIRFHQIPNPLRQRLEEYFQHAW--SYTNGIDMNLVLKGFPDCLQADICLHLNRNLLSGCAAFAGS 424          

HSP 2 Score: 48.9062 bits (115), Expect = 1.254e-33
Identity = 30/83 (36.14%), Postives = 47/83 (56.63%), Query Frame = 2
Query: 1781 PGDFIIKEGTVGSQMYFIQEGIVDIITKDGEIATSLSDGSYFGEICLLADT--RRVASVRAVTYCNVYSLDRESFLSVLEHYP 2023
            PGD ++  G + + +YFI  G V+I+  D  +   L     FGE  LL D   +   +VRA+TYC+++ + R+  L VL+ YP
Sbjct:  443 PGDTLVHRGDILTGLYFIARGSVEILNDDNTVMGILGKDDIFGENPLLYDEVGKSSCNVRALTYCDLHKILRDDLLDVLDMYP 525          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Celegans
Match: unc-103 (Potassium voltage-gated channel unc-103 [Source:UniProtKB/Swiss-Prot;Acc:G5EFJ9])

HSP 1 Score: 114.39 bits (285), Expect = 1.284e-33
Identity = 104/419 (24.82%), Postives = 202/419 (48.21%), Query Frame = 3
Query:  582 EQICSLFQPGDNKLAMKLFGTQSALLKEKSRQKKHGH--WIIHPCSSFRFYWDLLMLMVLVANLIVLPVAISFFNDDL---------SKRWLVFNGVSDTIFLLDIGVNFRTGII-LNDFADEIILNPKQIAKHYARSWFIIDFLSSIPVDYIFLILNNTNHFSQFMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYISQWEEFFNTASKFIGIFNLVLMML---LLGHWNACLQFLIPMM----REFPNDCWIVKCNLKEANWF---------------DQYTWSLFKAMSHMLSIGYGRFPPTSTSEAWVTIVSMMTGATCYALFVGHAAALIQSYDTSKRLYREKYKQVEEYMGYRKLPRLLRQKITDYYEHRYQGNMFNEID---ILQELSECLREKVINYNCRGLVASVPFFKNA 1727
            +Q+  + Q G    + K+    + +L E   Q    H   I+H  S F+  WD ++L++++   +  P   +F   +L         ++   + + + D +F++DI +NFRT  +  ND A +++ +P +IA HY + WFIID ++++P D + L+  N++  +  +             LL   RLLRL R+ R + ++ E+        G   L+L+M    L+ HW AC+ + I       +E+    W+ + + + A  +                +Y  SL+  +S + SIG+G    T+ SE   TI+ M+ G+  YA   G+ +A+IQ   +    Y  +  ++ E++ + ++P  LRQ++ +Y++H +  +  N ID   +L+   +CL+  +  +  R L++    F  +
Sbjct:   37 KQLMVVLQSG----SYKVLSLGADVLPEYKLQPTRIHHCTIVH-YSPFKAVWDWIILLLVIYTAVFTPYVAAFLLRELQDTAKKSRFTEPLEIVDLIVDIMFIVDIIINFRTTYVNENDEACQVVSDPGKIATHYFKGWFIIDMVAAVPFD-LLLVSTNSDETTTLI------------GLLKTARLLRLVRVARKLDRYSEY--------GAAVLLLLMATFALIAHWLACIWYAIGSAELSHKEY---TWLHQLSKQLAQPYTSTNGTIPTGGPTLKSRYVTSLYFTLSTITSIGFGNVSATTDSEKIFTIIMMILGSLMYASVFGNVSAIIQRLYSGTARYHTEMSRLREFIRFHQIPNPLRQRLEEYFQHAW--SYTNGIDMNLVLKGFPDCLQADICLHLNRNLLSGCAAFAGS 424          

HSP 2 Score: 48.9062 bits (115), Expect = 1.284e-33
Identity = 30/83 (36.14%), Postives = 47/83 (56.63%), Query Frame = 2
Query: 1781 PGDFIIKEGTVGSQMYFIQEGIVDIITKDGEIATSLSDGSYFGEICLLADT--RRVASVRAVTYCNVYSLDRESFLSVLEHYP 2023
            PGD ++  G + + +YFI  G V+I+  D  +   L     FGE  LL D   +   +VRA+TYC+++ + R+  L VL+ YP
Sbjct:  443 PGDTLVHRGDILTGLYFIARGSVEILNDDNTVMGILGKDDIFGENPLLYDEVGKSSCNVRALTYCDLHKILRDDLLDVLDMYP 525          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Fly
Match: Ih (gene:FBgn0263397 transcript:FBtr0100369)

HSP 1 Score: 526.554 bits (1355), Expect = 0.000e+0
Identity = 269/390 (68.97%), Postives = 327/390 (83.85%), Query Frame = 3
Query:  573 YLKEQICSLFQPGDNKLAMKLFGTQSALLKEKSRQKKHGHWIIHPCSSFRFYWDLLMLMVLVANLIVLPVAISFFNDDLSKRWLVFNGVSDTIFLLDIGVNFRTGIILNDFADEIILNPKQIAKHYARSWFIIDFLSSIPVDYIFLILNN--TNHFSQFMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYISQWEE--FFNTASKFIGIFNLVLMMLLLGHWNACLQFLIPMMREFPNDCWIVKCNLKEANWFDQYTWSLFKAMSHMLSIGYGRFPPTSTSEAWVTIVSMMTGATCYALFVGHAAALIQSYDTSKRLYREKYKQVEEYMGYRKLPRLLRQKITDYYEHRYQGNMFNEIDILQELSECLREKVINYNCRGLVASVPFFKNAD 1730
            +LK Q+ S FQP DN+LAMKLFG++ AL+KE+ RQK  GHW+IHPCSSFRFYWDL ML++LVANLI+LPVAISFFNDDLS RW+ FN +SDTIFL+DI VNFRTGI+  D A+++IL+PK IAKHY R+WF +D +SSIP+DYIFLI N   ++ F Q +HAGRALRILRLAKLLSL+RLLRLSRLVRY+SQWEE  F N AS F+ IFNL+ MMLL+GHW+ CLQFL+PM++ FP++ W+    L+E+ W +QY+W+LFKAMSHML IGYGRFPP S ++ W+T++SM++GATCYALF+GHA  LIQS D+S+R YREK KQVEEYM YRKLPR +RQ+IT+Y+EHRYQG  F+E  IL ELSE LRE VINYNCR LVASVPFF NAD
Sbjct:  704 FLKSQLQSWFQPTDNRLAMKLFGSRKALVKERIRQKTSGHWVIHPCSSFRFYWDLCMLLLLVANLIILPVAISFFNDDLSTRWIAFNCLSDTIFLIDIVVNFRTGIMQQDNAEQVILDPKLIAKHYLRTWFFLDLISSIPLDYIFLIFNQDFSDSF-QILHAGRALRILRLAKLLSLVRLLRLSRLVRYVSQWEEVYFLNMASVFMRIFNLICMMLLIGHWSGCLQFLVPMLQGFPSNSWVSINELQESYWLEQYSWALFKAMSHMLCIGYGRFPPQSLTDMWLTMLSMISGATCYALFLGHATNLIQSLDSSRRQYREKVKQVEEYMAYRKLPRDMRQRITEYFEHRYQGKFFDEELILGELSEKLREDVINYNCRSLVASVPFFANAD 1092          

HSP 2 Score: 168.703 bits (426), Expect = 0.000e+0
Identity = 75/105 (71.43%), Postives = 91/105 (86.67%), Query Frame = 2
Query: 1736 FVSEVVVKLHYEVFQPGDFIIKEGTVGSQMYFIQEGIVDIITKDGEIATSLSDGSYFGEICLLADTRRVASVRAVTYCNVYSLDRESFLSVLEHYPIMRRTMESV 2050
            FVS+VV KL YEVFQPGD IIKEGT+G++MYFIQEG+VDI+  +GE+ATSLSDGSYFGEICLL + RRVASVRA TYCN++SL  + F  VL+ YP+MR+TME+V
Sbjct: 1095 FVSDVVTKLKYEVFQPGDIIIKEGTIGTKMYFIQEGVVDIVMANGEVATSLSDGSYFGEICLLTNARRVASVRAETYCNLFSLSVDHFNCVLDQYPLMRKTMETV 1199          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Fly
Match: Ih (gene:FBgn0263397 transcript:FBtr0290109)

HSP 1 Score: 525.398 bits (1352), Expect = 0.000e+0
Identity = 270/394 (68.53%), Postives = 326/394 (82.74%), Query Frame = 3
Query:  573 YLKEQICSLFQPGDNKLAMKLFGTQSALLKEKSRQKKHGHWIIHPCSSFRFYWDLLMLMVLVANLIVLPVAISFFNDDLSKRWLVFNGVSDTIFLLDIGVNFRTGIILNDFADEIILNPKQIAKHYARSWFIIDFLSSIPVDYIFLILNNT---NHFS---QFMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYISQWEE--FFNTASKFIGIFNLVLMMLLLGHWNACLQFLIPMMREFPNDCWIVKCNLKEANWFDQYTWSLFKAMSHMLSIGYGRFPPTSTSEAWVTIVSMMTGATCYALFVGHAAALIQSYDTSKRLYREKYKQVEEYMGYRKLPRLLRQKITDYYEHRYQGNMFNEIDILQELSECLREKVINYNCRGLVASVPFFKNAD 1730
            +LK Q+ S FQP DN+LAMKLFG++ AL+KE+ RQK  GHW+IHPCSSFRFYWDL ML++LVANLI+LPVAISFFNDDLS RW+ FN +SDTIFL+DI VNFRTGI+  D A+++IL+PK IAKHY R+WF +D +SSIP+DYIFLI N       FS   Q +HAGRALRILRLAKLLSL+RLLRLSRLVRY+SQWEE  F N AS F+ IFNL+ MMLL+GHW+ CLQFL+PM++ FP++ W+    L+E+ W +QY+W+LFKAMSHML IGYGRFPP S ++ W+T++SM++GATCYALF+GHA  LIQS D+S+R YREK KQVEEYM YRKLPR +RQ+IT+Y+EHRYQG  F+E  IL ELSE LRE VINYNCR LVASVPFF NAD
Sbjct:  704 FLKSQLQSWFQPTDNRLAMKLFGSRKALVKERIRQKTSGHWVIHPCSSFRFYWDLCMLLLLVANLIILPVAISFFNDDLSTRWIAFNCLSDTIFLIDIVVNFRTGIMQQDNAEQVILDPKLIAKHYLRTWFFLDLISSIPLDYIFLIFNQIMKLQDFSDSFQILHAGRALRILRLAKLLSLVRLLRLSRLVRYVSQWEEVYFLNMASVFMRIFNLICMMLLIGHWSGCLQFLVPMLQGFPSNSWVSINELQESYWLEQYSWALFKAMSHMLCIGYGRFPPQSLTDMWLTMLSMISGATCYALFLGHATNLIQSLDSSRRQYREKVKQVEEYMAYRKLPRDMRQRITEYFEHRYQGKFFDEELILGELSEKLREDVINYNCRSLVASVPFFANAD 1097          

HSP 2 Score: 168.703 bits (426), Expect = 0.000e+0
Identity = 75/105 (71.43%), Postives = 91/105 (86.67%), Query Frame = 2
Query: 1736 FVSEVVVKLHYEVFQPGDFIIKEGTVGSQMYFIQEGIVDIITKDGEIATSLSDGSYFGEICLLADTRRVASVRAVTYCNVYSLDRESFLSVLEHYPIMRRTMESV 2050
            FVS+VV KL YEVFQPGD IIKEGT+G++MYFIQEG+VDI+  +GE+ATSLSDGSYFGEICLL + RRVASVRA TYCN++SL  + F  VL+ YP+MR+TME+V
Sbjct: 1100 FVSDVVTKLKYEVFQPGDIIIKEGTIGTKMYFIQEGVVDIVMANGEVATSLSDGSYFGEICLLTNARRVASVRAETYCNLFSLSVDHFNCVLDQYPLMRKTMETV 1204          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Fly
Match: Ih (gene:FBgn0263397 transcript:FBtr0308835)

HSP 1 Score: 521.161 bits (1341), Expect = 0.000e+0
Identity = 269/390 (68.97%), Postives = 327/390 (83.85%), Query Frame = 3
Query:  573 YLKEQICSLFQPGDNKLAMKLFGTQSALLKEKSRQKKHGHWIIHPCSSFRFYWDLLMLMVLVANLIVLPVAISFFNDDLSKRWLVFNGVSDTIFLLDIGVNFRTGIILNDFADEIILNPKQIAKHYARSWFIIDFLSSIPVDYIFLILNN--TNHFSQFMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYISQWEE--FFNTASKFIGIFNLVLMMLLLGHWNACLQFLIPMMREFPNDCWIVKCNLKEANWFDQYTWSLFKAMSHMLSIGYGRFPPTSTSEAWVTIVSMMTGATCYALFVGHAAALIQSYDTSKRLYREKYKQVEEYMGYRKLPRLLRQKITDYYEHRYQGNMFNEIDILQELSECLREKVINYNCRGLVASVPFFKNAD 1730
            +LK Q+ S FQP DN+LAMKLFG++ AL+KE+ RQK  GHW+IHPCSSFRFYWDL ML++LVANLI+LPVAISFFNDDLS RW+ FN +SDTIFL+DI VNFRTGI+  D A+++IL+PK IAKHY R+WF +D +SSIP+DYIFLI N   ++ F Q +HAGRALRILRLAKLLSL+RLLRLSRLVRY+SQWEE  F N AS F+ IFNL+ MMLL+GHW+ CLQFL+PM++ FP++ W+    L+E+ W +QY+W+LFKAMSHML IGYGRFPP S ++ W+T++SM++GATCYALF+GHA  LIQS D+S+R YREK KQVEEYM YRKLPR +RQ+IT+Y+EHRYQG  F+E  IL ELSE LRE VINYNCR LVASVPFF NAD
Sbjct:   32 FLKSQLQSWFQPTDNRLAMKLFGSRKALVKERIRQKTSGHWVIHPCSSFRFYWDLCMLLLLVANLIILPVAISFFNDDLSTRWIAFNCLSDTIFLIDIVVNFRTGIMQQDNAEQVILDPKLIAKHYLRTWFFLDLISSIPLDYIFLIFNQDFSDSF-QILHAGRALRILRLAKLLSLVRLLRLSRLVRYVSQWEEVYFLNMASVFMRIFNLICMMLLIGHWSGCLQFLVPMLQGFPSNSWVSINELQESYWLEQYSWALFKAMSHMLCIGYGRFPPQSLTDMWLTMLSMISGATCYALFLGHATNLIQSLDSSRRQYREKVKQVEEYMAYRKLPRDMRQRITEYFEHRYQGKFFDEELILGELSEKLREDVINYNCRSLVASVPFFANAD 420          

HSP 2 Score: 165.622 bits (418), Expect = 0.000e+0
Identity = 75/105 (71.43%), Postives = 91/105 (86.67%), Query Frame = 2
Query: 1736 FVSEVVVKLHYEVFQPGDFIIKEGTVGSQMYFIQEGIVDIITKDGEIATSLSDGSYFGEICLLADTRRVASVRAVTYCNVYSLDRESFLSVLEHYPIMRRTMESV 2050
            FVS+VV KL YEVFQPGD IIKEGT+G++MYFIQEG+VDI+  +GE+ATSLSDGSYFGEICLL + RRVASVRA TYCN++SL  + F  VL+ YP+MR+TME+V
Sbjct:  423 FVSDVVTKLKYEVFQPGDIIIKEGTIGTKMYFIQEGVVDIVMANGEVATSLSDGSYFGEICLLTNARRVASVRAETYCNLFSLSVDHFNCVLDQYPLMRKTMETV 527          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Fly
Match: Ih (gene:FBgn0263397 transcript:FBtr0290292)

HSP 1 Score: 521.161 bits (1341), Expect = 0.000e+0
Identity = 269/390 (68.97%), Postives = 327/390 (83.85%), Query Frame = 3
Query:  573 YLKEQICSLFQPGDNKLAMKLFGTQSALLKEKSRQKKHGHWIIHPCSSFRFYWDLLMLMVLVANLIVLPVAISFFNDDLSKRWLVFNGVSDTIFLLDIGVNFRTGIILNDFADEIILNPKQIAKHYARSWFIIDFLSSIPVDYIFLILNN--TNHFSQFMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYISQWEE--FFNTASKFIGIFNLVLMMLLLGHWNACLQFLIPMMREFPNDCWIVKCNLKEANWFDQYTWSLFKAMSHMLSIGYGRFPPTSTSEAWVTIVSMMTGATCYALFVGHAAALIQSYDTSKRLYREKYKQVEEYMGYRKLPRLLRQKITDYYEHRYQGNMFNEIDILQELSECLREKVINYNCRGLVASVPFFKNAD 1730
            +LK Q+ S FQP DN+LAMKLFG++ AL+KE+ RQK  GHW+IHPCSSFRFYWDL ML++LVANLI+LPVAISFFNDDLS RW+ FN +SDTIFL+DI VNFRTGI+  D A+++IL+PK IAKHY R+WF +D +SSIP+DYIFLI N   ++ F Q +HAGRALRILRLAKLLSL+RLLRLSRLVRY+SQWEE  F N AS F+ IFNL+ MMLL+GHW+ CLQFL+PM++ FP++ W+    L+E+ W +QY+W+LFKAMSHML IGYGRFPP S ++ W+T++SM++GATCYALF+GHA  LIQS D+S+R YREK KQVEEYM YRKLPR +RQ+IT+Y+EHRYQG  F+E  IL ELSE LRE VINYNCR LVASVPFF NAD
Sbjct:   15 FLKSQLQSWFQPTDNRLAMKLFGSRKALVKERIRQKTSGHWVIHPCSSFRFYWDLCMLLLLVANLIILPVAISFFNDDLSTRWIAFNCLSDTIFLIDIVVNFRTGIMQQDNAEQVILDPKLIAKHYLRTWFFLDLISSIPLDYIFLIFNQDFSDSF-QILHAGRALRILRLAKLLSLVRLLRLSRLVRYVSQWEEVYFLNMASVFMRIFNLICMMLLIGHWSGCLQFLVPMLQGFPSNSWVSINELQESYWLEQYSWALFKAMSHMLCIGYGRFPPQSLTDMWLTMLSMISGATCYALFLGHATNLIQSLDSSRRQYREKVKQVEEYMAYRKLPRDMRQRITEYFEHRYQGKFFDEELILGELSEKLREDVINYNCRSLVASVPFFANAD 403          

HSP 2 Score: 166.007 bits (419), Expect = 0.000e+0
Identity = 75/105 (71.43%), Postives = 91/105 (86.67%), Query Frame = 2
Query: 1736 FVSEVVVKLHYEVFQPGDFIIKEGTVGSQMYFIQEGIVDIITKDGEIATSLSDGSYFGEICLLADTRRVASVRAVTYCNVYSLDRESFLSVLEHYPIMRRTMESV 2050
            FVS+VV KL YEVFQPGD IIKEGT+G++MYFIQEG+VDI+  +GE+ATSLSDGSYFGEICLL + RRVASVRA TYCN++SL  + F  VL+ YP+MR+TME+V
Sbjct:  406 FVSDVVTKLKYEVFQPGDIIIKEGTIGTKMYFIQEGVVDIVMANGEVATSLSDGSYFGEICLLTNARRVASVRAETYCNLFSLSVDHFNCVLDQYPLMRKTMETV 510          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Fly
Match: Ih (gene:FBgn0263397 transcript:FBtr0308836)

HSP 1 Score: 521.161 bits (1341), Expect = 0.000e+0
Identity = 269/390 (68.97%), Postives = 327/390 (83.85%), Query Frame = 3
Query:  573 YLKEQICSLFQPGDNKLAMKLFGTQSALLKEKSRQKKHGHWIIHPCSSFRFYWDLLMLMVLVANLIVLPVAISFFNDDLSKRWLVFNGVSDTIFLLDIGVNFRTGIILNDFADEIILNPKQIAKHYARSWFIIDFLSSIPVDYIFLILNN--TNHFSQFMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYISQWEE--FFNTASKFIGIFNLVLMMLLLGHWNACLQFLIPMMREFPNDCWIVKCNLKEANWFDQYTWSLFKAMSHMLSIGYGRFPPTSTSEAWVTIVSMMTGATCYALFVGHAAALIQSYDTSKRLYREKYKQVEEYMGYRKLPRLLRQKITDYYEHRYQGNMFNEIDILQELSECLREKVINYNCRGLVASVPFFKNAD 1730
            +LK Q+ S FQP DN+LAMKLFG++ AL+KE+ RQK  GHW+IHPCSSFRFYWDL ML++LVANLI+LPVAISFFNDDLS RW+ FN +SDTIFL+DI VNFRTGI+  D A+++IL+PK IAKHY R+WF +D +SSIP+DYIFLI N   ++ F Q +HAGRALRILRLAKLLSL+RLLRLSRLVRY+SQWEE  F N AS F+ IFNL+ MMLL+GHW+ CLQFL+PM++ FP++ W+    L+E+ W +QY+W+LFKAMSHML IGYGRFPP S ++ W+T++SM++GATCYALF+GHA  LIQS D+S+R YREK KQVEEYM YRKLPR +RQ+IT+Y+EHRYQG  F+E  IL ELSE LRE VINYNCR LVASVPFF NAD
Sbjct:   32 FLKSQLQSWFQPTDNRLAMKLFGSRKALVKERIRQKTSGHWVIHPCSSFRFYWDLCMLLLLVANLIILPVAISFFNDDLSTRWIAFNCLSDTIFLIDIVVNFRTGIMQQDNAEQVILDPKLIAKHYLRTWFFLDLISSIPLDYIFLIFNQDFSDSF-QILHAGRALRILRLAKLLSLVRLLRLSRLVRYVSQWEEVYFLNMASVFMRIFNLICMMLLIGHWSGCLQFLVPMLQGFPSNSWVSINELQESYWLEQYSWALFKAMSHMLCIGYGRFPPQSLTDMWLTMLSMISGATCYALFLGHATNLIQSLDSSRRQYREKVKQVEEYMAYRKLPRDMRQRITEYFEHRYQGKFFDEELILGELSEKLREDVINYNCRSLVASVPFFANAD 420          

HSP 2 Score: 165.622 bits (418), Expect = 0.000e+0
Identity = 75/105 (71.43%), Postives = 91/105 (86.67%), Query Frame = 2
Query: 1736 FVSEVVVKLHYEVFQPGDFIIKEGTVGSQMYFIQEGIVDIITKDGEIATSLSDGSYFGEICLLADTRRVASVRAVTYCNVYSLDRESFLSVLEHYPIMRRTMESV 2050
            FVS+VV KL YEVFQPGD IIKEGT+G++MYFIQEG+VDI+  +GE+ATSLSDGSYFGEICLL + RRVASVRA TYCN++SL  + F  VL+ YP+MR+TME+V
Sbjct:  423 FVSDVVTKLKYEVFQPGDIIIKEGTIGTKMYFIQEGVVDIVMANGEVATSLSDGSYFGEICLLTNARRVASVRAETYCNLFSLSVDHFNCVLDQYPLMRKTMETV 527          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Zebrafish
Match: hcn2b (hyperpolarization activated cyclic nucleotide-gated potassium channel 2b [Source:ZFIN;Acc:ZDB-GENE-030131-8228])

HSP 1 Score: 441.425 bits (1134), Expect = 5.298e-159
Identity = 223/390 (57.18%), Postives = 297/390 (76.15%), Query Frame = 3
Query:  573 YLKEQICSLFQPGDNKLAMKLFGTQSALLKEKSRQKKHGHWIIHPCSSFRFYWDLLMLMVLVANLIVLPVAISFFNDDLSKRWLVFNGVSDTIFLLDIGVNFRTGIILNDFADEIILNPKQIAKHYARSWFIIDFLSSIPVDYIFLILNNTNHFSQFMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYISQWEEFF----NTASKFIGIFNLVLMMLLLGHWNACLQFLIPMMREFPNDCWIVKCNLKEANWFDQYTWSLFKAMSHMLSIGYGRFPPTSTSEAWVTIVSMMTGATCYALFVGHAAALIQSYDTSKRLYREKYKQVEEYMGYRKLPRLLRQKITDYYEHRYQGNMFNEIDILQELSECLREKVINYNCRGLVASVPFFKNAD 1730
            Y++ Q  ++ QPG NK ++++FG+Q A+ KE+ R K  G+WIIHP S FRFYWD  MLM +V NLI++PV I+FF ++ +  W++FN VSDT FL+D+ +NFRTGI+  D   EIIL+P++I K Y ++WF++DF+SSIPVDYIFLI+      S+     RALRI+R  K+LSLLRLLRLSRL+RYI QWEE F    + AS  + I NL+ MMLLL HW+ CLQFL+PM+++FP+DCW+    +   +W + Y+++LFKAMSHML IGYGR  P S S+ W+T++SM+ GATCYA+F+GHA ALIQS D+S+R Y+EKYKQVE+YM + KLP   RQKI DYYEHRYQG MF+E  IL+EL+E LRE+++N+NCR LVAS+P F NAD
Sbjct:   81 YMQRQFSAMLQPGVNKFSLRMFGSQKAVEKEQERVKSAGNWIIHPYSDFRFYWDFTMLMFMVGNLIIIPVGITFFKEETTTPWIIFNVVSDTFFLMDLVLNFRTGIVYED-NTEIILDPEKIKKKYLKTWFVVDFVSSIPVDYIFLIVEKGID-SEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAVMRIINLIGMMLLLCHWDGCLQFLVPMLQDFPSDCWVSLNKMVNDSWSELYSFALFKAMSHMLCIGYGRQAPESMSDIWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEESILEELNEPLREEIVNFNCRKLVASMPLFANAD 468          

HSP 2 Score: 141.354 bits (355), Expect = 5.298e-159
Identity = 65/105 (61.90%), Postives = 81/105 (77.14%), Query Frame = 2
Query: 1736 FVSEVVVKLHYEVFQPGDFIIKEGTVGSQMYFIQEGIVDIITKDGEIATSLSDGSYFGEICLLADTRRVASVRAVTYCNVYSLDRESFLSVLEHYPIMRRTMESV 2050
            FV+ ++ KL +EVFQPGD+II+EGT+G +MYFIQ G+V ++TK G I   LSDGSYFGEICLL   RR ASVRA TYC +YSL  ++F  VLE YP+MRR  E+V
Sbjct:  471 FVTAMLTKLRFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTK-GNIGMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETV 574          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Zebrafish
Match: hcn2b (hyperpolarization activated cyclic nucleotide-gated potassium channel 2b [Source:ZFIN;Acc:ZDB-GENE-030131-8228])

HSP 1 Score: 437.958 bits (1125), Expect = 1.222e-157
Identity = 223/390 (57.18%), Postives = 297/390 (76.15%), Query Frame = 3
Query:  573 YLKEQICSLFQPGDNKLAMKLFGTQSALLKEKSRQKKHGHWIIHPCSSFRFYWDLLMLMVLVANLIVLPVAISFFNDDLSKRWLVFNGVSDTIFLLDIGVNFRTGIILNDFADEIILNPKQIAKHYARSWFIIDFLSSIPVDYIFLILNNTNHFSQFMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYISQWEEFF----NTASKFIGIFNLVLMMLLLGHWNACLQFLIPMMREFPNDCWIVKCNLKEANWFDQYTWSLFKAMSHMLSIGYGRFPPTSTSEAWVTIVSMMTGATCYALFVGHAAALIQSYDTSKRLYREKYKQVEEYMGYRKLPRLLRQKITDYYEHRYQGNMFNEIDILQELSECLREKVINYNCRGLVASVPFFKNAD 1730
            Y++ Q  ++ QPG NK ++++FG+Q A+ KE+ R K  G+WIIHP S FRFYWD  MLM +V NLI++PV I+FF ++ +  W++FN VSDT FL+D+ +NFRTGI+  D   EIIL+P++I K Y ++WF++DF+SSIPVDYIFLI+      S+     RALRI+R  K+LSLLRLLRLSRL+RYI QWEE F    + AS  + I NL+ MMLLL HW+ CLQFL+PM+++FP+DCW+    +   +W + Y+++LFKAMSHML IGYGR  P S S+ W+T++SM+ GATCYA+F+GHA ALIQS D+S+R Y+EKYKQVE+YM + KLP   RQKI DYYEHRYQG MF+E  IL+EL+E LRE+++N+NCR LVAS+P F NAD
Sbjct:  136 YMQRQFSAMLQPGVNKFSLRMFGSQKAVEKEQERVKSAGNWIIHPYSDFRFYWDFTMLMFMVGNLIIIPVGITFFKEETTTPWIIFNVVSDTFFLMDLVLNFRTGIVYED-NTEIILDPEKIKKKYLKTWFVVDFVSSIPVDYIFLIVEKGID-SEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAVMRIINLIGMMLLLCHWDGCLQFLVPMLQDFPSDCWVSLNKMVNDSWSELYSFALFKAMSHMLCIGYGRQAPESMSDIWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEESILEELNEPLREEIVNFNCRKLVASMPLFANAD 523          

HSP 2 Score: 139.813 bits (351), Expect = 1.222e-157
Identity = 65/105 (61.90%), Postives = 81/105 (77.14%), Query Frame = 2
Query: 1736 FVSEVVVKLHYEVFQPGDFIIKEGTVGSQMYFIQEGIVDIITKDGEIATSLSDGSYFGEICLLADTRRVASVRAVTYCNVYSLDRESFLSVLEHYPIMRRTMESV 2050
            FV+ ++ KL +EVFQPGD+II+EGT+G +MYFIQ G+V ++TK G I   LSDGSYFGEICLL   RR ASVRA TYC +YSL  ++F  VLE YP+MRR  E+V
Sbjct:  526 FVTAMLTKLRFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTK-GNIGMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETV 629          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Zebrafish
Match: hcn4 (hyperpolarization activated cyclic nucleotide-gated potassium channel 4 [Source:ZFIN;Acc:ZDB-GENE-050420-360])

HSP 1 Score: 452.595 bits (1163), Expect = 3.425e-145
Identity = 235/421 (55.82%), Postives = 307/421 (72.92%), Query Frame = 3
Query:  573 YLKEQICSLFQPGDNKLAMKLFGTQSALLKEKSRQKKHGHWIIHPCSSFRFYWDLLMLMVLVANLIVLPVAISFFNDDLSKRWLVFNGVSDTIFLLDIGVNFRTGIILNDFADEIILNPKQIAKHYARSWFIIDFLSSIPVDYIFLILNNTNHFSQFMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYISQWEEFF----NTASKFIGIFNLVLMMLLLGHWNACLQFLIPMMREFPNDCWIVKCNLKEANWFDQYTWSLFKAMSHMLSIGYGRFPPTSTSEAWVTIVSMMTGATCYALFVGHAAALIQSYDTSKRLYREKYKQVEEYMGYRKLPRLLRQKITDYYEHRYQGNMFNEIDILQELSECLREKVINYNCRGLVASVPFFKNADDILYRK*LSNFIMKSFN------REISLSKK 1805
            ++  Q  ++ QPG NK ++++FG++ A+ +E+ R K  G WIIHP S FRFYWDL ML+++V NLI++PV I+FF D+ +  W+VFN VSDT FL+D+ +NFRTGI+  D A EIIL+P+QI   Y RSWF++DF+SSIPVDYIFLI+  T   S F    RALRI+R  K+LSLLRLLRLSRL+RYI QWEE F    + AS  + I NL+ MMLLL HW+ CLQFL+PM+++FP DCW+ K  +    W  QY+++LFKAMSHML IGYG +PP   ++ W+TI+SM+ GATCYA+FVGHA ALIQS D+S+R Y+EKYKQVE+YM + KLP  +RQ+I DYYEHRYQG MF+E  IL EL+E LRE++IN+NCR LVAS+P F NAD       L+    + F       RE ++ KK
Sbjct:  174 FMHRQFGAMLQPGVNKFSLRMFGSEKAVEREQERVKSAGFWIIHPYSDFRFYWDLTMLLLMVGNLIIIPVGITFFKDEHTPPWIVFNVVSDTFFLMDLVLNFRTGIVKEDNA-EIILDPQQIKIKYLRSWFVVDFISSIPVDYIFLIVE-TRIDSDFYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAMVRIVNLIGMMLLLCHWDGCLQFLVPMLQDFPADCWVAKNKMVNDTWGQQYSYALFKAMSHMLCIGYGMYPPVGMTDVWLTILSMIVGATCYAMFVGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADMRQRIHDYYEHRYQGKMFDEESILGELNEPLREEIINFNCRKLVASMPLFANADPNFVTSMLTKLRFEVFQPGDYIIREGTIGKK 592          

HSP 2 Score: 142.51 bits (358), Expect = 1.150e-34
Identity = 65/105 (61.90%), Postives = 81/105 (77.14%), Query Frame = 2
Query: 1736 FVSEVVVKLHYEVFQPGDFIIKEGTVGSQMYFIQEGIVDIITKDGEIATSLSDGSYFGEICLLADTRRVASVRAVTYCNVYSLDRESFLSVLEHYPIMRRTMESV 2050
            FV+ ++ KL +EVFQPGD+II+EGT+G +MYFIQ G+V ++TK G   T LSDGSYFGEICLL   RR ASVRA TYC +YSL  ++F  VLE YP+MRR  E+V
Sbjct:  564 FVTSMLTKLRFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTK-GNKETKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETV 667          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Zebrafish
Match: hcn4l (hyperpolarization activated cyclic nucleotide-gated potassium channel 4l [Source:ZFIN;Acc:ZDB-GENE-110411-3])

HSP 1 Score: 444.891 bits (1143), Expect = 1.511e-143
Identity = 233/420 (55.48%), Postives = 305/420 (72.62%), Query Frame = 3
Query:  576 LKEQICSLFQPGDNKLAMKLFGTQSALLKEKSRQKKHGHWIIHPCSSFRFYWDLLMLMVLVANLIVLPVAISFFNDDLSKRWLVFNGVSDTIFLLDIGVNFRTGIILNDFADEIILNPKQIAKHYARSWFIIDFLSSIPVDYIFLILNNTNHFSQFMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYISQWEEFF----NTASKFIGIFNLVLMMLLLGHWNACLQFLIPMMREFPNDCWIVKCNLKEANWFDQYTWSLFKAMSHMLSIGYGRFPPTSTSEAWVTIVSMMTGATCYALFVGHAAALIQSYDTSKRLYREKYKQVEEYMGYRKLPRLLRQKITDYYEHRYQGNMFNEIDILQELSECLREKVINYNCRGLVASVPFFKNADDILYRK*LSNFIMKSFN------REISLSKK 1805
            LK  + +   PG NK ++++FG++ A+  E+ R K  G WIIHP S FRFYWDL+ML+++V NLI++PV I+FF D+ +  W+VFN VSDT FL+D+ +NFRTGI+  D + EIIL+P+QI   Y RSWF +DFLSSIPVDYIFLI+  T   S F    RALRI+R  K+LSLLRLLRLSRL+RYI QWEE F    + AS  + I NL+ MMLLL HW+ CLQFL+PM+++FP+DCW+ K  +    W  QY+++LFKAMSHML IGYG +PP   ++ W+TI+SM+ GATCYA+FVGHA ALIQS D+S+R Y+EKYKQVE+YM + KLP  +RQ+I DYYEHRYQG MF+E  IL EL+E LRE++I++NCR LVA++P F NAD       L+    + F       RE ++ KK
Sbjct:   18 LKRHLFTFLLPGVNKFSLRMFGSEKAVEHEQERVKSAGFWIIHPYSDFRFYWDLIMLLLMVGNLIIIPVGITFFKDEHTPAWIVFNVVSDTFFLVDLVLNFRTGIVKED-STEIILDPQQIKVRYLRSWFAVDFLSSIPVDYIFLIVE-TRIDSDFYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAMVRIVNLIGMMLLLCHWDGCLQFLVPMLQDFPSDCWVAKNKMVNDTWGQQYSYALFKAMSHMLCIGYGMYPPVGMTDVWLTILSMIVGATCYAMFVGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADMRQRIHDYYEHRYQGKMFDEESILGELNEPLREEIISFNCRKLVATMPLFANADPNFVTSMLTKLRFEVFQPGDYIIREGTVGKK 435          

HSP 2 Score: 140.198 bits (352), Expect = 7.154e-34
Identity = 64/105 (60.95%), Postives = 80/105 (76.19%), Query Frame = 2
Query: 1736 FVSEVVVKLHYEVFQPGDFIIKEGTVGSQMYFIQEGIVDIITKDGEIATSLSDGSYFGEICLLADTRRVASVRAVTYCNVYSLDRESFLSVLEHYPIMRRTMESV 2050
            FV+ ++ KL +EVFQPGD+II+EGTVG +MYFIQ G++ ++TK G   T +SDGSYFGEICLL   RR ASVRA TYC +YSL  + F  VLE YP+MRR  E+V
Sbjct:  407 FVTSMLTKLRFEVFQPGDYIIREGTVGKKMYFIQHGVLTVLTK-GSKETKISDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDHFNEVLEEYPMMRRAFETV 510          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Zebrafish
Match: hcn1 (hyperpolarization activated cyclic nucleotide-gated potassium channel 1 [Source:ZFIN;Acc:ZDB-GENE-110520-1])

HSP 1 Score: 439.499 bits (1129), Expect = 1.990e-142
Identity = 228/421 (54.16%), Postives = 310/421 (73.63%), Query Frame = 3
Query:  573 YLKEQICSLFQPGDNKLAMKLFGTQSALLKEKSRQKKHGHWIIHPCSSFRFYWDLLMLMVLVANLIVLPVAISFFNDDLSKRWLVFNGVSDTIFLLDIGVNFRTGIILNDFADEIILNPKQIAKHYARSWFIIDFLSSIPVDYIFLILNNTNHFSQFMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYISQWEEFF----NTASKFIGIFNLVLMMLLLGHWNACLQFLIPMMREFPNDCWIVKCNLKEANWFDQYTWSLFKAMSHMLSIGYGRFPPTSTSEAWVTIVSMMTGATCYALFVGHAAALIQSYDTSKRLYREKYKQVEEYMGYRKLPRLLRQKITDYYEHRYQGNMFNEIDILQELSECLREKVINYNCRGLVASVPFFKNADDILYRK*LSNFIMKSFN------REISLSKK 1805
            +++ Q  ++ QPG NK ++++FG+Q A+ KE+ R +  G+WIIHP S FRFYWDL+ML++++ NLI++PV I+FF++  +  WLVFN  SDTIFL+D+ +NFRTGI+ N+ + EIIL+PK I  +Y +SWF++DFLSSIPVDYIFLI+      S+     RALRI+R  K+LSLLRLLRLSRL+RYI QWEE F    + AS  + IFNL+ MMLLL HW+ CLQFL+P++++FP DCW+    +   +W  QY+++LFKAMSHML IGYG   P S S+ W+T++SM+ GATCYA+FVGHA ALIQS D+S+R Y+EKYKQVE+YM + KLP  +RQKI DYYEHRYQG +F+E  IL EL++ L+E+++N+NCR LVA++P F NAD       LS    + F       RE ++ KK
Sbjct:   70 FMQRQFGAMMQPGVNKFSLRMFGSQKAVEKEQERVQTAGYWIIHPYSDFRFYWDLIMLIMMMGNLIIIPVGITFFSEQTTTSWLVFNVASDTIFLVDLVMNFRTGIV-NEESSEIILDPKVIKMNYLKSWFVVDFLSSIPVDYIFLIVEK-GFDSEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAVVRIFNLIGMMLLLCHWDGCLQFLVPLLQDFPPDCWVSLNGMVNDSWGKQYSYALFKAMSHMLCIGYGARAPVSMSDLWITMLSMIVGATCYAMFVGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADMRQKIHDYYEHRYQGKIFDEDSILNELNDPLKEEIVNFNCRKLVATMPLFANADPNFVTGMLSKLKFEVFQPNDYIIREGTVGKK 488          

HSP 2 Score: 129.028 bits (323), Expect = 1.878e-30
Identity = 62/106 (58.49%), Postives = 79/106 (74.53%), Query Frame = 2
Query: 1736 FVSEVVVKLHYEVFQPGDFIIKEGTVGSQMYFIQEGIVDIITK-DGEIATSLSDGSYFGEICLLADTRRVASVRAVTYCNVYSLDRESFLSVLEHYPIMRRTMESV 2050
            FV+ ++ KL +EVFQP D+II+EGTVG +MYFIQ G+  +ITK + E+   L+DGSYFGEICLL   RR ASVRA TYC ++SL  + F  VLE YP+MRR  E+V
Sbjct:  460 FVTGMLSKLKFEVFQPNDYIIREGTVGKKMYFIQHGVASVITKFNKEL--KLTDGSYFGEICLLTKGRRTASVRADTYCRLFSLSVDHFNEVLEEYPMMRRAFETV 563          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Xenopus
Match: ENSXETT00000054880.1 (potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4 [Source:NCBI gene;Acc:100495521])

HSP 1 Score: 441.039 bits (1133), Expect = 1.796e-158
Identity = 227/390 (58.21%), Postives = 298/390 (76.41%), Query Frame = 3
Query:  573 YLKEQICSLFQPGDNKLAMKLFGTQSALLKEKSRQKKHGHWIIHPCSSFRFYWDLLMLMVLVANLIVLPVAISFFNDDLSKRWLVFNGVSDTIFLLDIGVNFRTGIILNDFADEIILNPKQIAKHYARSWFIIDFLSSIPVDYIFLILNNTNHFSQFMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYISQWEEFF----NTASKFIGIFNLVLMMLLLGHWNACLQFLIPMMREFPNDCWIVKCNLKEANWFDQYTWSLFKAMSHMLSIGYGRFPPTSTSEAWVTIVSMMTGATCYALFVGHAAALIQSYDTSKRLYREKYKQVEEYMGYRKLPRLLRQKITDYYEHRYQGNMFNEIDILQELSECLREKVINYNCRGLVASVPFFKNAD 1730
            ++  Q  +L QPG NK ++++FG+Q A+ +E+ R K  G WIIHP S FRFYWDL ML+++V NLI++PV I+FF ++ +  W+VFN VSDT FL+D+ +NFRTGI+L D   EIIL P++I   Y +SWF++DF+SSIPVDYIFLI+  T   S+     RALRI+R AK+LSLLRLLRLSRL+RYI QWEE F    + AS  + I NL+ MMLLL HW+ CLQFL+PM+++FP DCW+   +++ A+W  QY+++LFKAMSHML IGYG+  P    + W+T++SM+ GATCYA+F+GHA ALIQS D+S+R Y+EKYKQVE+YM + KLP  LRQ+I DYYEHRYQG MF+E  IL ELSE LRE++IN+NCR LVAS+P F NAD
Sbjct:   73 FMHRQFGALLQPGVNKFSLRMFGSQKAVEREQDRVKSAGFWIIHPYSDFRFYWDLTMLLLMVGNLIIIPVGITFFKEENTPAWIVFNVVSDTFFLVDLVLNFRTGIVLED-NTEIILEPQRIKIRYLKSWFLVDFVSSIPVDYIFLIVE-TRIDSEVYKTARALRIVRFAKVLSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAVVRIVNLIGMMLLLCHWDGCLQFLVPMLQDFPEDCWVSLNHMQNASWGKQYSYALFKAMSHMLCIGYGQQAPVGMGDVWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADLRQRIHDYYEHRYQGKMFDEESILGELSEPLREEIINFNCRKLVASMPLFANAD 460          

HSP 2 Score: 140.198 bits (352), Expect = 1.796e-158
Identity = 65/105 (61.90%), Postives = 80/105 (76.19%), Query Frame = 2
Query: 1736 FVSEVVVKLHYEVFQPGDFIIKEGTVGSQMYFIQEGIVDIITKDGEIATSLSDGSYFGEICLLADTRRVASVRAVTYCNVYSLDRESFLSVLEHYPIMRRTMESV 2050
            FV+ ++ KL +EVFQPGD++I+EGTVG +M+FIQ G+V I++K G   T LSDGSYFGEICLL   RR ASVRA TYC +YSL  + F  VLE YP+MRR  ESV
Sbjct:  463 FVTSMLTKLRFEVFQPGDYLIREGTVGKKMFFIQHGVVSILSK-GSKETKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDHFNEVLEEYPMMRRAFESV 566          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Xenopus
Match: ENSXETT00000054882.1 (potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4 [Source:NCBI gene;Acc:100495521])

HSP 1 Score: 441.039 bits (1133), Expect = 1.935e-158
Identity = 227/390 (58.21%), Postives = 298/390 (76.41%), Query Frame = 3
Query:  573 YLKEQICSLFQPGDNKLAMKLFGTQSALLKEKSRQKKHGHWIIHPCSSFRFYWDLLMLMVLVANLIVLPVAISFFNDDLSKRWLVFNGVSDTIFLLDIGVNFRTGIILNDFADEIILNPKQIAKHYARSWFIIDFLSSIPVDYIFLILNNTNHFSQFMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYISQWEEFF----NTASKFIGIFNLVLMMLLLGHWNACLQFLIPMMREFPNDCWIVKCNLKEANWFDQYTWSLFKAMSHMLSIGYGRFPPTSTSEAWVTIVSMMTGATCYALFVGHAAALIQSYDTSKRLYREKYKQVEEYMGYRKLPRLLRQKITDYYEHRYQGNMFNEIDILQELSECLREKVINYNCRGLVASVPFFKNAD 1730
            ++  Q  +L QPG NK ++++FG+Q A+ +E+ R K  G WIIHP S FRFYWDL ML+++V NLI++PV I+FF ++ +  W+VFN VSDT FL+D+ +NFRTGI+L D   EIIL P++I   Y +SWF++DF+SSIPVDYIFLI+  T   S+     RALRI+R AK+LSLLRLLRLSRL+RYI QWEE F    + AS  + I NL+ MMLLL HW+ CLQFL+PM+++FP DCW+   +++ A+W  QY+++LFKAMSHML IGYG+  P    + W+T++SM+ GATCYA+F+GHA ALIQS D+S+R Y+EKYKQVE+YM + KLP  LRQ+I DYYEHRYQG MF+E  IL ELSE LRE++IN+NCR LVAS+P F NAD
Sbjct:  178 FMHRQFGALLQPGVNKFSLRMFGSQKAVEREQDRVKSAGFWIIHPYSDFRFYWDLTMLLLMVGNLIIIPVGITFFKEENTPAWIVFNVVSDTFFLVDLVLNFRTGIVLED-NTEIILEPQRIKIRYLKSWFLVDFVSSIPVDYIFLIVE-TRIDSEVYKTARALRIVRFAKVLSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAVVRIVNLIGMMLLLCHWDGCLQFLVPMLQDFPEDCWVSLNHMQNASWGKQYSYALFKAMSHMLCIGYGQQAPVGMGDVWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADLRQRIHDYYEHRYQGKMFDEESILGELSEPLREEIINFNCRKLVASMPLFANAD 565          

HSP 2 Score: 140.198 bits (352), Expect = 1.935e-158
Identity = 65/105 (61.90%), Postives = 80/105 (76.19%), Query Frame = 2
Query: 1736 FVSEVVVKLHYEVFQPGDFIIKEGTVGSQMYFIQEGIVDIITKDGEIATSLSDGSYFGEICLLADTRRVASVRAVTYCNVYSLDRESFLSVLEHYPIMRRTMESV 2050
            FV+ ++ KL +EVFQPGD++I+EGTVG +M+FIQ G+V I++K G   T LSDGSYFGEICLL   RR ASVRA TYC +YSL  + F  VLE YP+MRR  ESV
Sbjct:  568 FVTSMLTKLRFEVFQPGDYLIREGTVGKKMFFIQHGVVSILSK-GSKETKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDHFNEVLEEYPMMRRAFESV 671          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Xenopus
Match: ENSXETT00000054879.1 (potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4 [Source:NCBI gene;Acc:100495521])

HSP 1 Score: 440.654 bits (1132), Expect = 1.439e-157
Identity = 227/390 (58.21%), Postives = 298/390 (76.41%), Query Frame = 3
Query:  573 YLKEQICSLFQPGDNKLAMKLFGTQSALLKEKSRQKKHGHWIIHPCSSFRFYWDLLMLMVLVANLIVLPVAISFFNDDLSKRWLVFNGVSDTIFLLDIGVNFRTGIILNDFADEIILNPKQIAKHYARSWFIIDFLSSIPVDYIFLILNNTNHFSQFMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYISQWEEFF----NTASKFIGIFNLVLMMLLLGHWNACLQFLIPMMREFPNDCWIVKCNLKEANWFDQYTWSLFKAMSHMLSIGYGRFPPTSTSEAWVTIVSMMTGATCYALFVGHAAALIQSYDTSKRLYREKYKQVEEYMGYRKLPRLLRQKITDYYEHRYQGNMFNEIDILQELSECLREKVINYNCRGLVASVPFFKNAD 1730
            ++  Q  +L QPG NK ++++FG+Q A+ +E+ R K  G WIIHP S FRFYWDL ML+++V NLI++PV I+FF ++ +  W+VFN VSDT FL+D+ +NFRTGI+L D   EIIL P++I   Y +SWF++DF+SSIPVDYIFLI+  T   S+     RALRI+R AK+LSLLRLLRLSRL+RYI QWEE F    + AS  + I NL+ MMLLL HW+ CLQFL+PM+++FP DCW+   +++ A+W  QY+++LFKAMSHML IGYG+  P    + W+T++SM+ GATCYA+F+GHA ALIQS D+S+R Y+EKYKQVE+YM + KLP  LRQ+I DYYEHRYQG MF+E  IL ELSE LRE++IN+NCR LVAS+P F NAD
Sbjct:   26 FMHRQFGALLQPGVNKFSLRMFGSQKAVEREQDRVKSAGFWIIHPYSDFRFYWDLTMLLLMVGNLIIIPVGITFFKEENTPAWIVFNVVSDTFFLVDLVLNFRTGIVLED-NTEIILEPQRIKIRYLKSWFLVDFVSSIPVDYIFLIVE-TRIDSEVYKTARALRIVRFAKVLSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAVVRIVNLIGMMLLLCHWDGCLQFLVPMLQDFPEDCWVSLNHMQNASWGKQYSYALFKAMSHMLCIGYGQQAPVGMGDVWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADLRQRIHDYYEHRYQGKMFDEESILGELSEPLREEIINFNCRKLVASMPLFANAD 413          

HSP 2 Score: 137.502 bits (345), Expect = 1.439e-157
Identity = 65/105 (61.90%), Postives = 80/105 (76.19%), Query Frame = 2
Query: 1736 FVSEVVVKLHYEVFQPGDFIIKEGTVGSQMYFIQEGIVDIITKDGEIATSLSDGSYFGEICLLADTRRVASVRAVTYCNVYSLDRESFLSVLEHYPIMRRTMESV 2050
            FV+ ++ KL +EVFQPGD++I+EGTVG +M+FIQ G+V I++K G   T LSDGSYFGEICLL   RR ASVRA TYC +YSL  + F  VLE YP+MRR  ESV
Sbjct:  416 FVTSMLTKLRFEVFQPGDYLIREGTVGKKMFFIQHGVVSILSK-GSKETKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDHFNEVLEEYPMMRRAFESV 519          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Xenopus
Match: ENSXETT00000054883.1 (potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4 [Source:NCBI gene;Acc:100495521])

HSP 1 Score: 440.654 bits (1132), Expect = 1.616e-157
Identity = 227/390 (58.21%), Postives = 298/390 (76.41%), Query Frame = 3
Query:  573 YLKEQICSLFQPGDNKLAMKLFGTQSALLKEKSRQKKHGHWIIHPCSSFRFYWDLLMLMVLVANLIVLPVAISFFNDDLSKRWLVFNGVSDTIFLLDIGVNFRTGIILNDFADEIILNPKQIAKHYARSWFIIDFLSSIPVDYIFLILNNTNHFSQFMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYISQWEEFF----NTASKFIGIFNLVLMMLLLGHWNACLQFLIPMMREFPNDCWIVKCNLKEANWFDQYTWSLFKAMSHMLSIGYGRFPPTSTSEAWVTIVSMMTGATCYALFVGHAAALIQSYDTSKRLYREKYKQVEEYMGYRKLPRLLRQKITDYYEHRYQGNMFNEIDILQELSECLREKVINYNCRGLVASVPFFKNAD 1730
            ++  Q  +L QPG NK ++++FG+Q A+ +E+ R K  G WIIHP S FRFYWDL ML+++V NLI++PV I+FF ++ +  W+VFN VSDT FL+D+ +NFRTGI+L D   EIIL P++I   Y +SWF++DF+SSIPVDYIFLI+  T   S+     RALRI+R AK+LSLLRLLRLSRL+RYI QWEE F    + AS  + I NL+ MMLLL HW+ CLQFL+PM+++FP DCW+   +++ A+W  QY+++LFKAMSHML IGYG+  P    + W+T++SM+ GATCYA+F+GHA ALIQS D+S+R Y+EKYKQVE+YM + KLP  LRQ+I DYYEHRYQG MF+E  IL ELSE LRE++IN+NCR LVAS+P F NAD
Sbjct:   48 FMHRQFGALLQPGVNKFSLRMFGSQKAVEREQDRVKSAGFWIIHPYSDFRFYWDLTMLLLMVGNLIIIPVGITFFKEENTPAWIVFNVVSDTFFLVDLVLNFRTGIVLED-NTEIILEPQRIKIRYLKSWFLVDFVSSIPVDYIFLIVE-TRIDSEVYKTARALRIVRFAKVLSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAVVRIVNLIGMMLLLCHWDGCLQFLVPMLQDFPEDCWVSLNHMQNASWGKQYSYALFKAMSHMLCIGYGQQAPVGMGDVWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADLRQRIHDYYEHRYQGKMFDEESILGELSEPLREEIINFNCRKLVASMPLFANAD 435          

HSP 2 Score: 137.887 bits (346), Expect = 1.616e-157
Identity = 65/105 (61.90%), Postives = 80/105 (76.19%), Query Frame = 2
Query: 1736 FVSEVVVKLHYEVFQPGDFIIKEGTVGSQMYFIQEGIVDIITKDGEIATSLSDGSYFGEICLLADTRRVASVRAVTYCNVYSLDRESFLSVLEHYPIMRRTMESV 2050
            FV+ ++ KL +EVFQPGD++I+EGTVG +M+FIQ G+V I++K G   T LSDGSYFGEICLL   RR ASVRA TYC +YSL  + F  VLE YP+MRR  ESV
Sbjct:  438 FVTSMLTKLRFEVFQPGDYLIREGTVGKKMFFIQHGVVSILSK-GSKETKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDHFNEVLEEYPMMRRAFESV 541          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Xenopus
Match: ENSXETT00000054881.1 (potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4 [Source:NCBI gene;Acc:100495521])

HSP 1 Score: 439.884 bits (1130), Expect = 3.447e-157
Identity = 227/390 (58.21%), Postives = 298/390 (76.41%), Query Frame = 3
Query:  573 YLKEQICSLFQPGDNKLAMKLFGTQSALLKEKSRQKKHGHWIIHPCSSFRFYWDLLMLMVLVANLIVLPVAISFFNDDLSKRWLVFNGVSDTIFLLDIGVNFRTGIILNDFADEIILNPKQIAKHYARSWFIIDFLSSIPVDYIFLILNNTNHFSQFMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYISQWEEFF----NTASKFIGIFNLVLMMLLLGHWNACLQFLIPMMREFPNDCWIVKCNLKEANWFDQYTWSLFKAMSHMLSIGYGRFPPTSTSEAWVTIVSMMTGATCYALFVGHAAALIQSYDTSKRLYREKYKQVEEYMGYRKLPRLLRQKITDYYEHRYQGNMFNEIDILQELSECLREKVINYNCRGLVASVPFFKNAD 1730
            ++  Q  +L QPG NK ++++FG+Q A+ +E+ R K  G WIIHP S FRFYWDL ML+++V NLI++PV I+FF ++ +  W+VFN VSDT FL+D+ +NFRTGI+L D   EIIL P++I   Y +SWF++DF+SSIPVDYIFLI+  T   S+     RALRI+R AK+LSLLRLLRLSRL+RYI QWEE F    + AS  + I NL+ MMLLL HW+ CLQFL+PM+++FP DCW+   +++ A+W  QY+++LFKAMSHML IGYG+  P    + W+T++SM+ GATCYA+F+GHA ALIQS D+S+R Y+EKYKQVE+YM + KLP  LRQ+I DYYEHRYQG MF+E  IL ELSE LRE++IN+NCR LVAS+P F NAD
Sbjct:   40 FMHRQFGALLQPGVNKFSLRMFGSQKAVEREQDRVKSAGFWIIHPYSDFRFYWDLTMLLLMVGNLIIIPVGITFFKEENTPAWIVFNVVSDTFFLVDLVLNFRTGIVLED-NTEIILEPQRIKIRYLKSWFLVDFVSSIPVDYIFLIVE-TRIDSEVYKTARALRIVRFAKVLSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAVVRIVNLIGMMLLLCHWDGCLQFLVPMLQDFPEDCWVSLNHMQNASWGKQYSYALFKAMSHMLCIGYGQQAPVGMGDVWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADLRQRIHDYYEHRYQGKMFDEESILGELSEPLREEIINFNCRKLVASMPLFANAD 427          

HSP 2 Score: 137.502 bits (345), Expect = 3.447e-157
Identity = 65/105 (61.90%), Postives = 80/105 (76.19%), Query Frame = 2
Query: 1736 FVSEVVVKLHYEVFQPGDFIIKEGTVGSQMYFIQEGIVDIITKDGEIATSLSDGSYFGEICLLADTRRVASVRAVTYCNVYSLDRESFLSVLEHYPIMRRTMESV 2050
            FV+ ++ KL +EVFQPGD++I+EGTVG +M+FIQ G+V I++K G   T LSDGSYFGEICLL   RR ASVRA TYC +YSL  + F  VLE YP+MRR  ESV
Sbjct:  430 FVTSMLTKLRFEVFQPGDYLIREGTVGKKMFFIQHGVVSILSK-GSKETKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDHFNEVLEEYPMMRRAFESV 533          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Mouse
Match: Hcn2 (hyperpolarization-activated, cyclic nucleotide-gated K+ 2 [Source:MGI Symbol;Acc:MGI:1298210])

HSP 1 Score: 441.039 bits (1133), Expect = 1.463e-143
Identity = 233/429 (54.31%), Postives = 310/429 (72.26%), Query Frame = 3
Query:  549 HPRLSASMYLKEQICSLFQPGDNKLAMKLFGTQSALLKEKSRQKKHGHWIIHPCSSFRFYWDLLMLMVLVANLIVLPVAISFFNDDLSKRWLVFNGVSDTIFLLDIGVNFRTGIILNDFADEIILNPKQIAKHYARSWFIIDFLSSIPVDYIFLILNNTNHFSQFMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYISQWEEFF----NTASKFIGIFNLVLMMLLLGHWNACLQFLIPMMREFPNDCWIVKCNLKEANWFDQYTWSLFKAMSHMLSIGYGRFPPTSTSEAWVTIVSMMTGATCYALFVGHAAALIQSYDTSKRLYREKYKQVEEYMGYRKLPRLLRQKITDYYEHRYQGNMFNEIDILQELSECLREKVINYNCRGLVASVPFFKNADDILYRK*LSNFIMKSFN------REISLSKK 1805
             PR S + +L+ Q  +L QPG NK ++++FG+Q A+ +E+ R K  G WIIHP S FRFYWD  ML+ +V NLI++PV I+FF D+ +  W+VFN VSDT FL+D+ +NFRTGI++ D   EIIL+P++I K Y R+WF++DF+SSIPVDYIFLI+      S+     RALRI+R  K+LSLLRLLRLSRL+RYI QWEE F    + AS  + I NL+ MMLLL HW+ CLQFL+PM+++FP+DCW+   N+   +W + Y+++LFKAMSHML IGYGR  P S ++ W+T++SM+ GATCYA+F+GHA ALIQS D+S+R Y+EKYKQVE+YM + KLP   RQKI DYYEHRYQG MF+E  IL EL+  LRE+++N+NCR LVAS+P F NAD       L+    + F       RE ++ KK
Sbjct:  127 EPRGSQASFLQRQFGALLQPGVNKFSLRMFGSQKAVEREQERVKSAGAWIIHPYSDFRFYWDFTMLLFMVGNLIIIPVGITFFKDETTAPWIVFNVVSDTFFLMDLVLNFRTGIVIED-NTEIILDPEKIKKKYLRTWFVVDFVSSIPVDYIFLIVEKGID-SEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAVMRICNLISMMLLLCHWDGCLQFLVPMLQDFPSDCWVSINNMVNHSWSELYSFALFKAMSHMLCIGYGRQAPESMTDIWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKK 553          

HSP 2 Score: 137.502 bits (345), Expect = 4.851e-33
Identity = 64/105 (60.95%), Postives = 80/105 (76.19%), Query Frame = 2
Query: 1736 FVSEVVVKLHYEVFQPGDFIIKEGTVGSQMYFIQEGIVDIITKDGEIATSLSDGSYFGEICLLADTRRVASVRAVTYCNVYSLDRESFLSVLEHYPIMRRTMESV 2050
            FV+ ++ KL +EVFQPGD+II+EGT+G +MYFIQ G+V ++TK G     LSDGSYFGEICLL   RR ASVRA TYC +YSL  ++F  VLE YP+MRR  E+V
Sbjct:  525 FVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTK-GNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETV 628          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Mouse
Match: Hcn2 (hyperpolarization-activated, cyclic nucleotide-gated K+ 2 [Source:MGI Symbol;Acc:MGI:1298210])

HSP 1 Score: 441.039 bits (1133), Expect = 1.463e-143
Identity = 233/429 (54.31%), Postives = 310/429 (72.26%), Query Frame = 3
Query:  549 HPRLSASMYLKEQICSLFQPGDNKLAMKLFGTQSALLKEKSRQKKHGHWIIHPCSSFRFYWDLLMLMVLVANLIVLPVAISFFNDDLSKRWLVFNGVSDTIFLLDIGVNFRTGIILNDFADEIILNPKQIAKHYARSWFIIDFLSSIPVDYIFLILNNTNHFSQFMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYISQWEEFF----NTASKFIGIFNLVLMMLLLGHWNACLQFLIPMMREFPNDCWIVKCNLKEANWFDQYTWSLFKAMSHMLSIGYGRFPPTSTSEAWVTIVSMMTGATCYALFVGHAAALIQSYDTSKRLYREKYKQVEEYMGYRKLPRLLRQKITDYYEHRYQGNMFNEIDILQELSECLREKVINYNCRGLVASVPFFKNADDILYRK*LSNFIMKSFN------REISLSKK 1805
             PR S + +L+ Q  +L QPG NK ++++FG+Q A+ +E+ R K  G WIIHP S FRFYWD  ML+ +V NLI++PV I+FF D+ +  W+VFN VSDT FL+D+ +NFRTGI++ D   EIIL+P++I K Y R+WF++DF+SSIPVDYIFLI+      S+     RALRI+R  K+LSLLRLLRLSRL+RYI QWEE F    + AS  + I NL+ MMLLL HW+ CLQFL+PM+++FP+DCW+   N+   +W + Y+++LFKAMSHML IGYGR  P S ++ W+T++SM+ GATCYA+F+GHA ALIQS D+S+R Y+EKYKQVE+YM + KLP   RQKI DYYEHRYQG MF+E  IL EL+  LRE+++N+NCR LVAS+P F NAD       L+    + F       RE ++ KK
Sbjct:  127 EPRGSQASFLQRQFGALLQPGVNKFSLRMFGSQKAVEREQERVKSAGAWIIHPYSDFRFYWDFTMLLFMVGNLIIIPVGITFFKDETTAPWIVFNVVSDTFFLMDLVLNFRTGIVIED-NTEIILDPEKIKKKYLRTWFVVDFVSSIPVDYIFLIVEKGID-SEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAVMRICNLISMMLLLCHWDGCLQFLVPMLQDFPSDCWVSINNMVNHSWSELYSFALFKAMSHMLCIGYGRQAPESMTDIWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKK 553          

HSP 2 Score: 137.502 bits (345), Expect = 4.851e-33
Identity = 64/105 (60.95%), Postives = 80/105 (76.19%), Query Frame = 2
Query: 1736 FVSEVVVKLHYEVFQPGDFIIKEGTVGSQMYFIQEGIVDIITKDGEIATSLSDGSYFGEICLLADTRRVASVRAVTYCNVYSLDRESFLSVLEHYPIMRRTMESV 2050
            FV+ ++ KL +EVFQPGD+II+EGT+G +MYFIQ G+V ++TK G     LSDGSYFGEICLL   RR ASVRA TYC +YSL  ++F  VLE YP+MRR  E+V
Sbjct:  525 FVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTK-GNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETV 628          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Mouse
Match: Hcn4 (hyperpolarization-activated, cyclic nucleotide-gated K+ 4 [Source:MGI Symbol;Acc:MGI:1298209])

HSP 1 Score: 446.432 bits (1147), Expect = 4.119e-142
Identity = 234/427 (54.80%), Postives = 310/427 (72.60%), Query Frame = 3
Query:  555 RLSASMYLKEQICSLFQPGDNKLAMKLFGTQSALLKEKSRQKKHGHWIIHPCSSFRFYWDLLMLMVLVANLIVLPVAISFFNDDLSKRWLVFNGVSDTIFLLDIGVNFRTGIILNDFADEIILNPKQIAKHYARSWFIIDFLSSIPVDYIFLILNNTNHFSQFMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYISQWEEFF----NTASKFIGIFNLVLMMLLLGHWNACLQFLIPMMREFPNDCWIVKCNLKEANWFDQYTWSLFKAMSHMLSIGYGRFPPTSTSEAWVTIVSMMTGATCYALFVGHAAALIQSYDTSKRLYREKYKQVEEYMGYRKLPRLLRQKITDYYEHRYQGNMFNEIDILQELSECLREKVINYNCRGLVASVPFFKNADDILYRK*LSNFIMKSFN------REISLSKK 1805
            RL  S +++ Q  ++ QPG NK ++++FG+Q A+ +E+ R K  G WIIHP S FRFYWDL ML+++V NLI++PV I+FF D+ +  W+VFN VSDT FL+D+ +NFRTGI++ D   EIIL+P++I   Y +SWF++DF+SSIPVDYIFLI+  T   S+     RALRI+R  K+LSLLRLLRLSRL+RYI QWEE F    + AS  + I NL+ MMLLL HW+ CLQFL+PM+++FP+DCW+    +   +W  QY+++LFKAMSHML IGYGR  P   S+ W+T++SM+ GATCYA+F+GHA ALIQS D+S+R Y+EKYKQVE+YM + KLP   RQ+I DYYEHRYQG MF+E  IL ELSE LRE++IN+NCR LVAS+P F NAD       L+    + F       RE ++ KK
Sbjct:  207 RLGQSGFMQRQFGAMLQPGVNKFSLRMFGSQKAVEREQERVKSAGFWIIHPYSDFRFYWDLTMLLLMVGNLIIIPVGITFFKDENTTPWIVFNVVSDTFFLIDLVLNFRTGIVVED-NTEIILDPQRIKMKYLKSWFVVDFISSIPVDYIFLIVE-TRIDSEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAVVRIVNLIGMMLLLCHWDGCLQFLVPMLQDFPHDCWVSINGMVNNSWGKQYSYALFKAMSHMLCIGYGRQAPVGMSDVWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPPDTRQRIHDYYEHRYQGKMFDEESILGELSEPLREEIINFNCRKLVASMPLFANADPNFVTSMLTKLRFEVFQPGDYIIREGTIGKK 631          

HSP 2 Score: 141.354 bits (355), Expect = 3.086e-34
Identity = 64/105 (60.95%), Postives = 81/105 (77.14%), Query Frame = 2
Query: 1736 FVSEVVVKLHYEVFQPGDFIIKEGTVGSQMYFIQEGIVDIITKDGEIATSLSDGSYFGEICLLADTRRVASVRAVTYCNVYSLDRESFLSVLEHYPIMRRTMESV 2050
            FV+ ++ KL +EVFQPGD+II+EGT+G +MYFIQ G+V ++TK G   T L+DGSYFGEICLL   RR ASVRA TYC +YSL  ++F  VLE YP+MRR  E+V
Sbjct:  603 FVTSMLTKLRFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTK-GNKETKLADGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETV 706          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Mouse
Match: Hcn1 (hyperpolarization activated cyclic nucleotide gated potassium channel 1 [Source:MGI Symbol;Acc:MGI:1096392])

HSP 1 Score: 437.187 bits (1123), Expect = 1.690e-141
Identity = 227/421 (53.92%), Postives = 308/421 (73.16%), Query Frame = 3
Query:  573 YLKEQICSLFQPGDNKLAMKLFGTQSALLKEKSRQKKHGHWIIHPCSSFRFYWDLLMLMVLVANLIVLPVAISFFNDDLSKRWLVFNGVSDTIFLLDIGVNFRTGIILNDFADEIILNPKQIAKHYARSWFIIDFLSSIPVDYIFLILNNTNHFSQFMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYISQWEEFF----NTASKFIGIFNLVLMMLLLGHWNACLQFLIPMMREFPNDCWIVKCNLKEANWFDQYTWSLFKAMSHMLSIGYGRFPPTSTSEAWVTIVSMMTGATCYALFVGHAAALIQSYDTSKRLYREKYKQVEEYMGYRKLPRLLRQKITDYYEHRYQGNMFNEIDILQELSECLREKVINYNCRGLVASVPFFKNADDILYRK*LSNFIMKSFN------REISLSKK 1805
            +++ Q  S+ QPG NK ++++FG+Q A+ KE+ R K  G WIIHP S FRFYWDL+ML+++V NL+++PV I+FF +  +  W++FN  SDT+FLLD+ +NFRTG + N+ + EIIL+PK I  +Y +SWF++DF+SSIPVDYIFLI+      S+     RALRI+R  K+LSLLRLLRLSRL+RYI QWEE F    + AS  + IFNL+ MMLLL HW+ CLQFL+P++++FP DCW+    +   +W  QY+++LFKAMSHML IGYG   P S S+ W+T++SM+ GATCYA+FVGHA ALIQS D+S+R Y+EKYKQVE+YM + KLP  +RQKI DYYEHRYQG +F+E +IL EL++ LRE+++N+NCR LVA++P F NAD       LS    + F       RE ++ KK
Sbjct:   82 FMQRQFTSMLQPGVNKFSLRMFGSQKAVEKEQERVKTAGFWIIHPYSDFRFYWDLIMLIMMVGNLVIIPVGITFFTEQTTTPWIIFNVASDTVFLLDLIMNFRTGTV-NEDSSEIILDPKVIKMNYLKSWFVVDFISSIPVDYIFLIVEKGMD-SEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAVVRIFNLIGMMLLLCHWDGCLQFLVPLLQDFPPDCWVSLNEMVNDSWGKQYSYALFKAMSHMLCIGYGAQAPVSMSDLWITMLSMIVGATCYAMFVGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADMRQKIHDYYEHRYQGKIFDEENILSELNDPLREEIVNFNCRKLVATMPLFANADPNFVTAMLSKLRFEVFQPGDYIIREGAVGKK 500          

HSP 2 Score: 133.265 bits (334), Expect = 1.116e-31
Identity = 62/105 (59.05%), Postives = 78/105 (74.29%), Query Frame = 2
Query: 1736 FVSEVVVKLHYEVFQPGDFIIKEGTVGSQMYFIQEGIVDIITKDGEIATSLSDGSYFGEICLLADTRRVASVRAVTYCNVYSLDRESFLSVLEHYPIMRRTMESV 2050
            FV+ ++ KL +EVFQPGD+II+EG VG +MYFIQ G+  +ITK  +    L+DGSYFGEICLL   RR ASVRA TYC +YSL  ++F  VLE YP+MRR  E+V
Sbjct:  472 FVTAMLSKLRFEVFQPGDYIIREGAVGKKMYFIQHGVAGVITKSSK-EMKLTDGSYFGEICLLTKGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETV 575          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Mouse
Match: Hcn3 (hyperpolarization-activated, cyclic nucleotide-gated K+ 3 [Source:MGI Symbol;Acc:MGI:1298211])

HSP 1 Score: 423.705 bits (1088), Expect = 7.254e-138
Identity = 225/426 (52.82%), Postives = 301/426 (70.66%), Query Frame = 3
Query:  561 SASMYLKEQICSLFQPGDNKLAMKLFGTQSALLKEKSRQKKHGHWIIHPCSSFRFYWDLLMLMVLVANLIVLPVAISFFNDDLSKRWLVFNGVSDTIFLLDIGVNFRTGIILNDFADEIILNPKQIAKHYARSWFIIDFLSSIPVDYIFLILNNTNHF-SQFMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYISQWEEFF----NTASKFIGIFNLVLMMLLLGHWNACLQFLIPMMREFPNDCWIVKCNLKEANWFDQYTWSLFKAMSHMLSIGYGRFPPTSTSEAWVTIVSMMTGATCYALFVGHAAALIQSYDTSKRLYREKYKQVEEYMGYRKLPRLLRQKITDYYEHRYQGNMFNEIDILQELSECLREKVINYNCRGLVASVPFFKNADDILYRK*LSNFIMKSFN------REISLSKK 1805
            SA    + Q+ +L QP  NK ++++FG+  A+  E+ R K  G WIIHP S FRFYWDL+ML+++V NLIVLPV I+FF ++ S  W+VFN +SDT FLLD+ +NFRTGI++ + A EI+L P+ I   Y R+WF++D +SSIPVDYIFL++       ++     RALRI+R  K+LSLLRLLRLSRL+RYI QWEE F    + AS  + IFNL+ MMLLL HW+ CLQFL+PM+++FP+DCW+    +   +W  QY+ +LFKAMSHML IGYG+  P    + W+T++SM+ GATCYA+F+GHA ALIQS D+S+R Y+EKYKQVE+YM + KLP   RQ+I +YYEHRYQG MF+E  IL ELSE LRE++IN+ CRGLVA +P F +AD       L+    + F       RE S+ +K
Sbjct:   39 SAPEPKRRQLGTLLQPTVNKFSLRVFGSHKAVEIEQERVKSAGAWIIHPYSDFRFYWDLIMLLLMVGNLIVLPVGITFFKEENSPPWIVFNVLSDTFFLLDLVLNFRTGIVVEEGA-EILLAPRAIRTRYLRTWFLVDLISSIPVDYIFLVVELEPRLDAEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAVVRIFNLIGMMLLLCHWDGCLQFLVPMLQDFPSDCWVSMNRMVNHSWGRQYSHALFKAMSHMLCIGYGQQAPVGMPDVWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADTRQRIHEYYEHRYQGKMFDEESILGELSEPLREEIINFTCRGLVAHMPLFAHADPSFVTAVLTKLRFEVFQPGDLVVREGSVGRK 463          

HSP 2 Score: 130.568 bits (327), Expect = 6.431e-31
Identity = 59/105 (56.19%), Postives = 79/105 (75.24%), Query Frame = 2
Query: 1736 FVSEVVVKLHYEVFQPGDFIIKEGTVGSQMYFIQEGIVDIITKDGEIATSLSDGSYFGEICLLADTRRVASVRAVTYCNVYSLDRESFLSVLEHYPIMRRTMESV 2050
            FV+ V+ KL +EVFQPGD +++EG+VG +MYFIQ G++ ++ + G   T L+DGSYFGEICLL   RR ASVRA TYC +YSL  + F +VLE +P+MRR  E+V
Sbjct:  435 FVTAVLTKLRFEVFQPGDLVVREGSVGRKMYFIQHGLLSVLAR-GARDTRLTDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDHFNAVLEEFPMMRRAFETV 538          
BLAST of Cyclic nucleotide gated channel 1 vs. UniProt/SwissProt
Match: sp|O88703|HCN2_MOUSE (Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2 OS=Mus musculus OX=10090 GN=Hcn2 PE=1 SV=1)

HSP 1 Score: 441.039 bits (1133), Expect = 1.023e-142
Identity = 233/429 (54.31%), Postives = 310/429 (72.26%), Query Frame = 3
Query:  549 HPRLSASMYLKEQICSLFQPGDNKLAMKLFGTQSALLKEKSRQKKHGHWIIHPCSSFRFYWDLLMLMVLVANLIVLPVAISFFNDDLSKRWLVFNGVSDTIFLLDIGVNFRTGIILNDFADEIILNPKQIAKHYARSWFIIDFLSSIPVDYIFLILNNTNHFSQFMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYISQWEEFF----NTASKFIGIFNLVLMMLLLGHWNACLQFLIPMMREFPNDCWIVKCNLKEANWFDQYTWSLFKAMSHMLSIGYGRFPPTSTSEAWVTIVSMMTGATCYALFVGHAAALIQSYDTSKRLYREKYKQVEEYMGYRKLPRLLRQKITDYYEHRYQGNMFNEIDILQELSECLREKVINYNCRGLVASVPFFKNADDILYRK*LSNFIMKSFN------REISLSKK 1805
             PR S + +L+ Q  +L QPG NK ++++FG+Q A+ +E+ R K  G WIIHP S FRFYWD  ML+ +V NLI++PV I+FF D+ +  W+VFN VSDT FL+D+ +NFRTGI++ D   EIIL+P++I K Y R+WF++DF+SSIPVDYIFLI+      S+     RALRI+R  K+LSLLRLLRLSRL+RYI QWEE F    + AS  + I NL+ MMLLL HW+ CLQFL+PM+++FP+DCW+   N+   +W + Y+++LFKAMSHML IGYGR  P S ++ W+T++SM+ GATCYA+F+GHA ALIQS D+S+R Y+EKYKQVE+YM + KLP   RQKI DYYEHRYQG MF+E  IL EL+  LRE+++N+NCR LVAS+P F NAD       L+    + F       RE ++ KK
Sbjct:  127 EPRGSQASFLQRQFGALLQPGVNKFSLRMFGSQKAVEREQERVKSAGAWIIHPYSDFRFYWDFTMLLFMVGNLIIIPVGITFFKDETTAPWIVFNVVSDTFFLMDLVLNFRTGIVIED-NTEIILDPEKIKKKYLRTWFVVDFVSSIPVDYIFLIVEKGID-SEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAVMRICNLISMMLLLCHWDGCLQFLVPMLQDFPSDCWVSINNMVNHSWSELYSFALFKAMSHMLCIGYGRQAPESMTDIWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKK 553          

HSP 2 Score: 137.502 bits (345), Expect = 3.393e-32
Identity = 64/105 (60.95%), Postives = 80/105 (76.19%), Query Frame = 2
Query: 1736 FVSEVVVKLHYEVFQPGDFIIKEGTVGSQMYFIQEGIVDIITKDGEIATSLSDGSYFGEICLLADTRRVASVRAVTYCNVYSLDRESFLSVLEHYPIMRRTMESV 2050
            FV+ ++ KL +EVFQPGD+II+EGT+G +MYFIQ G+V ++TK G     LSDGSYFGEICLL   RR ASVRA TYC +YSL  ++F  VLE YP+MRR  E+V
Sbjct:  525 FVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTK-GNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETV 628          
BLAST of Cyclic nucleotide gated channel 1 vs. UniProt/SwissProt
Match: sp|Q9JKA9|HCN2_RAT (Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2 OS=Rattus norvegicus OX=10116 GN=Hcn2 PE=1 SV=3)

HSP 1 Score: 440.654 bits (1132), Expect = 1.602e-142
Identity = 233/429 (54.31%), Postives = 310/429 (72.26%), Query Frame = 3
Query:  549 HPRLSASMYLKEQICSLFQPGDNKLAMKLFGTQSALLKEKSRQKKHGHWIIHPCSSFRFYWDLLMLMVLVANLIVLPVAISFFNDDLSKRWLVFNGVSDTIFLLDIGVNFRTGIILNDFADEIILNPKQIAKHYARSWFIIDFLSSIPVDYIFLILNNTNHFSQFMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYISQWEEFF----NTASKFIGIFNLVLMMLLLGHWNACLQFLIPMMREFPNDCWIVKCNLKEANWFDQYTWSLFKAMSHMLSIGYGRFPPTSTSEAWVTIVSMMTGATCYALFVGHAAALIQSYDTSKRLYREKYKQVEEYMGYRKLPRLLRQKITDYYEHRYQGNMFNEIDILQELSECLREKVINYNCRGLVASVPFFKNADDILYRK*LSNFIMKSFN------REISLSKK 1805
             PR S + +L+ Q  +L QPG NK ++++FG+Q A+ +E+ R K  G WIIHP S FRFYWD  ML+ +V NLI++PV I+FF D+ +  W+VFN VSDT FL+D+ +NFRTGI++ D   EIIL+P++I K Y R+WF++DF+SSIPVDYIFLI+      S+     RALRI+R  K+LSLLRLLRLSRL+RYI QWEE F    + AS  + I NL+ MMLLL HW+ CLQFL+PM+++FP+DCW+   N+   +W + Y+++LFKAMSHML IGYGR  P S ++ W+T++SM+ GATCYA+F+GHA ALIQS D+S+R Y+EKYKQVE+YM + KLP   RQKI DYYEHRYQG MF+E  IL EL+  LRE+++N+NCR LVAS+P F NAD       L+    + F       RE ++ KK
Sbjct:  127 EPRGSQASFLQRQFGALLQPGVNKFSLRMFGSQKAVEREQERVKSAGAWIIHPYSDFRFYWDFTMLLFMVGNLIIIPVGITFFKDETTAPWIVFNVVSDTFFLMDLVLNFRTGIVIED-NTEIILDPEKIKKKYLRTWFVVDFVSSIPVDYIFLIVEKGID-SEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAVMRICNLISMMLLLCHWDGCLQFLVPMLQDFPSDCWVSINNMVNHSWSELYSFALFKAMSHMLCIGYGRQAPESMTDIWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKK 553          

HSP 2 Score: 137.117 bits (344), Expect = 3.454e-32
Identity = 64/105 (60.95%), Postives = 80/105 (76.19%), Query Frame = 2
Query: 1736 FVSEVVVKLHYEVFQPGDFIIKEGTVGSQMYFIQEGIVDIITKDGEIATSLSDGSYFGEICLLADTRRVASVRAVTYCNVYSLDRESFLSVLEHYPIMRRTMESV 2050
            FV+ ++ KL +EVFQPGD+II+EGT+G +MYFIQ G+V ++TK G     LSDGSYFGEICLL   RR ASVRA TYC +YSL  ++F  VLE YP+MRR  E+V
Sbjct:  525 FVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTK-GNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETV 628          
BLAST of Cyclic nucleotide gated channel 1 vs. UniProt/SwissProt
Match: sp|Q9TV66|HCN4_RABIT (Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4 OS=Oryctolagus cuniculus OX=9986 GN=HCN4 PE=2 SV=1)

HSP 1 Score: 447.588 bits (1150), Expect = 5.298e-142
Identity = 238/442 (53.85%), Postives = 316/442 (71.49%), Query Frame = 3
Query:  525 GGGAPGYR-----HPRLSASMYLKEQICSLFQPGDNKLAMKLFGTQSALLKEKSRQKKHGHWIIHPCSSFRFYWDLLMLMVLVANLIVLPVAISFFNDDLSKRWLVFNGVSDTIFLLDIGVNFRTGIILNDFADEIILNPKQIAKHYARSWFIIDFLSSIPVDYIFLILNNTNHFSQFMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYISQWEEFF----NTASKFIGIFNLVLMMLLLGHWNACLQFLIPMMREFPNDCWIVKCNLKEANWFDQYTWSLFKAMSHMLSIGYGRFPPTSTSEAWVTIVSMMTGATCYALFVGHAAALIQSYDTSKRLYREKYKQVEEYMGYRKLPRLLRQKITDYYEHRYQGNMFNEIDILQELSECLREKVINYNCRGLVASVPFFKNADDILYRK*LSNFIMKSFN------REISLSKK 1805
            GG A G +       RL  + +++ Q  ++ QPG NK ++++FG+Q A+ +E+ R K  G WIIHP S FRFYWDL ML+++V NLI++PV I+FF D+ +  W+VFN VSDT FL+D+ +NFRTGI++ D  D IIL+P++I   Y +SWF++DF+SSIPVDYIFLI+  T   S+     RALRI+R  K+LSLLRLLRLSRL+RYI QWEE F    + AS  + I NL+ MMLLL HW+ CLQFL+PM+++FP+DCW+   N+   +W  QY+++LFKAMSHML IGYGR  P   S+ W+T++SM+ GATCYA+F+GHA ALIQS D+S+R Y+EKYKQVE+YM + KLP   RQ+I DYYEHRYQG MF+E  IL ELSE LRE++IN+NCR LVAS+P F NAD       L+    + F       RE ++ KK
Sbjct:  193 GGAAAGDQILPEAEARLGQAGFMQRQFGAMLQPGVNKFSLRMFGSQKAVEREQERVKSAGFWIIHPYSDFRFYWDLTMLLLMVGNLIIIPVGITFFKDENTTPWIVFNVVSDTFFLIDLVLNFRTGIVVEDNTD-IILDPRRIKMKYLKSWFVVDFVSSIPVDYIFLIVE-TRIDSEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAVVRIVNLIGMMLLLCHWDGCLQFLVPMLQDFPDDCWVSLNNMVNNSWGKQYSYALFKAMSHMLCIGYGRQAPMGMSDVWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPPDTRQRIHDYYEHRYQGKMFDEESILGELSEPLREEIINFNCRKLVASMPLFANADPNFVTSMLTKLRFEVFQPGDYIIREGTIGKK 632          

HSP 2 Score: 141.354 bits (355), Expect = 2.123e-33
Identity = 64/105 (60.95%), Postives = 81/105 (77.14%), Query Frame = 2
Query: 1736 FVSEVVVKLHYEVFQPGDFIIKEGTVGSQMYFIQEGIVDIITKDGEIATSLSDGSYFGEICLLADTRRVASVRAVTYCNVYSLDRESFLSVLEHYPIMRRTMESV 2050
            FV+ ++ KL +EVFQPGD+II+EGT+G +MYFIQ G+V ++TK G   T L+DGSYFGEICLL   RR ASVRA TYC +YSL  ++F  VLE YP+MRR  E+V
Sbjct:  604 FVTSMLTKLRFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTK-GNKETKLADGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETV 707          
BLAST of Cyclic nucleotide gated channel 1 vs. UniProt/SwissProt
Match: sp|Q9MZS1|HCN1_RABIT (Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 1 OS=Oryctolagus cuniculus OX=9986 GN=HCN1 PE=2 SV=2)

HSP 1 Score: 437.958 bits (1125), Expect = 7.065e-142
Identity = 227/421 (53.92%), Postives = 308/421 (73.16%), Query Frame = 3
Query:  573 YLKEQICSLFQPGDNKLAMKLFGTQSALLKEKSRQKKHGHWIIHPCSSFRFYWDLLMLMVLVANLIVLPVAISFFNDDLSKRWLVFNGVSDTIFLLDIGVNFRTGIILNDFADEIILNPKQIAKHYARSWFIIDFLSSIPVDYIFLILNNTNHFSQFMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYISQWEEFF----NTASKFIGIFNLVLMMLLLGHWNACLQFLIPMMREFPNDCWIVKCNLKEANWFDQYTWSLFKAMSHMLSIGYGRFPPTSTSEAWVTIVSMMTGATCYALFVGHAAALIQSYDTSKRLYREKYKQVEEYMGYRKLPRLLRQKITDYYEHRYQGNMFNEIDILQELSECLREKVINYNCRGLVASVPFFKNADDILYRK*LSNFIMKSFN------REISLSKK 1805
            +++ Q  S+ QPG NK ++++FG+Q A+ KE+ R K  G WIIHP S FRFYWDL+ML+++V NL+++PV I+FF +  +  W++FN  SDT+FLLD+ +NFRTG + N+ + EIIL+PK I  +Y +SWF++DF+SSIPVDYIFLI+      S+     RALRI+R  K+LSLLRLLRLSRL+RYI QWEE F    + AS  + IFNL+ MMLLL HW+ CLQFL+P++++FP DCW+    +   +W  QY+++LFKAMSHML IGYG   P S S+ W+T++SM+ GATCYA+FVGHA ALIQS D+S+R Y+EKYKQVE+YM + KLP  +RQKI DYYEHRYQG +F+E +IL EL++ LRE+++N+NCR LVA++P F NAD       LS    + F       RE ++ KK
Sbjct:   29 FMQRQFTSMLQPGVNKFSLRMFGSQKAVEKEQERVKTAGFWIIHPYSDFRFYWDLIMLIMMVGNLVIIPVGITFFTEQTTTPWIIFNVASDTVFLLDLIMNFRTGTV-NEDSSEIILDPKVIKMNYLKSWFVVDFISSIPVDYIFLIVEKGMD-SEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAVVRIFNLIGMMLLLCHWDGCLQFLVPLLQDFPPDCWVSLNEMVNDSWGKQYSYALFKAMSHMLCIGYGAQAPVSMSDLWITMLSMIVGATCYAMFVGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADMRQKIHDYYEHRYQGKIFDEENILNELNDPLREEIVNFNCRKLVATMPLFANADPNFVTAMLSKLRFEVFQPGDYIIREGAVGKK 447          

HSP 2 Score: 133.265 bits (334), Expect = 6.291e-31
Identity = 62/105 (59.05%), Postives = 78/105 (74.29%), Query Frame = 2
Query: 1736 FVSEVVVKLHYEVFQPGDFIIKEGTVGSQMYFIQEGIVDIITKDGEIATSLSDGSYFGEICLLADTRRVASVRAVTYCNVYSLDRESFLSVLEHYPIMRRTMESV 2050
            FV+ ++ KL +EVFQPGD+II+EG VG +MYFIQ G+  +ITK  +    L+DGSYFGEICLL   RR ASVRA TYC +YSL  ++F  VLE YP+MRR  E+V
Sbjct:  419 FVTAMLSKLRFEVFQPGDYIIREGAVGKKMYFIQHGVAGVITKSSK-EMKLTDGSYFGEICLLTKGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETV 522          
BLAST of Cyclic nucleotide gated channel 1 vs. UniProt/SwissProt
Match: sp|Q9Y3Q4|HCN4_HUMAN (Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4 OS=Homo sapiens OX=9606 GN=HCN4 PE=1 SV=1)

HSP 1 Score: 447.973 bits (1151), Expect = 7.422e-142
Identity = 234/427 (54.80%), Postives = 311/427 (72.83%), Query Frame = 3
Query:  555 RLSASMYLKEQICSLFQPGDNKLAMKLFGTQSALLKEKSRQKKHGHWIIHPCSSFRFYWDLLMLMVLVANLIVLPVAISFFNDDLSKRWLVFNGVSDTIFLLDIGVNFRTGIILNDFADEIILNPKQIAKHYARSWFIIDFLSSIPVDYIFLILNNTNHFSQFMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYISQWEEFF----NTASKFIGIFNLVLMMLLLGHWNACLQFLIPMMREFPNDCWIVKCNLKEANWFDQYTWSLFKAMSHMLSIGYGRFPPTSTSEAWVTIVSMMTGATCYALFVGHAAALIQSYDTSKRLYREKYKQVEEYMGYRKLPRLLRQKITDYYEHRYQGNMFNEIDILQELSECLREKVINYNCRGLVASVPFFKNADDILYRK*LSNFIMKSFN------REISLSKK 1805
            RL  + +++ Q  ++ QPG NK ++++FG+Q A+ +E+ R K  G WIIHP S FRFYWDL ML+++V NLI++PV I+FF D+ +  W+VFN VSDT FL+D+ +NFRTGI++ D   EIIL+P++I   Y +SWF++DF+SSIPVDYIFLI+  T   S+     RALRI+R  K+LSLLRLLRLSRL+RYI QWEE F    + AS  + I NL+ MMLLL HW+ CLQFL+PM+++FP+DCW+   N+   +W  QY+++LFKAMSHML IGYGR  P   S+ W+T++SM+ GATCYA+F+GHA ALIQS D+S+R Y+EKYKQVE+YM + KLP   RQ+I DYYEHRYQG MF+E  IL ELSE LRE++IN+NCR LVAS+P F NAD       L+    + F       RE ++ KK
Sbjct:  207 RLGQAGFMQRQFGAMLQPGVNKFSLRMFGSQKAVEREQERVKSAGFWIIHPYSDFRFYWDLTMLLLMVGNLIIIPVGITFFKDENTTPWIVFNVVSDTFFLIDLVLNFRTGIVVED-NTEIILDPQRIKMKYLKSWFMVDFISSIPVDYIFLIVE-TRIDSEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAVVRIVNLIGMMLLLCHWDGCLQFLVPMLQDFPDDCWVSINNMVNNSWGKQYSYALFKAMSHMLCIGYGRQAPVGMSDVWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPPDTRQRIHDYYEHRYQGKMFDEESILGELSEPLREEIINFNCRKLVASMPLFANADPNFVTSMLTKLRFEVFQPGDYIIREGTIGKK 631          

HSP 2 Score: 141.354 bits (355), Expect = 2.161e-33
Identity = 64/105 (60.95%), Postives = 81/105 (77.14%), Query Frame = 2
Query: 1736 FVSEVVVKLHYEVFQPGDFIIKEGTVGSQMYFIQEGIVDIITKDGEIATSLSDGSYFGEICLLADTRRVASVRAVTYCNVYSLDRESFLSVLEHYPIMRRTMESV 2050
            FV+ ++ KL +EVFQPGD+II+EGT+G +MYFIQ G+V ++TK G   T L+DGSYFGEICLL   RR ASVRA TYC +YSL  ++F  VLE YP+MRR  E+V
Sbjct:  603 FVTSMLTKLRFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTK-GNKETKLADGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETV 706          
BLAST of Cyclic nucleotide gated channel 1 vs. TrEMBL
Match: A0A267GGH4 (Cyclic nucleotide-binding domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig003625g4 PE=4 SV=1)

HSP 1 Score: 597.816 bits (1540), Expect = 0.000e+0
Identity = 298/393 (75.83%), Postives = 342/393 (87.02%), Query Frame = 3
Query:  552 PRLSASMYLKEQICSLFQPGDNKLAMKLFGTQSALLKEKSRQKKHGHWIIHPCSSFRFYWDLLMLMVLVANLIVLPVAISFFNDDLSKRWLVFNGVSDTIFLLDIGVNFRTGIILNDFADEIILNPKQIAKHYARSWFIIDFLSSIPVDYIFLILNNTNHFSQFMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYISQWEEFFNTASKFIGIFNLVLMMLLLGHWNACLQFLIPMMREFPNDCWIVKCNLKEANWFDQYTWSLFKAMSHMLSIGYGRFPPTSTSEAWVTIVSMMTGATCYALFVGHAAALIQSYDTSKRLYREKYKQVEEYMGYRKLPRLLRQKITDYYEHRYQGNMFNEIDILQELSECLREKVINYNCRGLVASVPFFKNAD 1730
            P+ S S YLKEQ  + FQP DNKLAMKLFG ++ALLKEK RQ++ G WIIHPCS+FRFYWDLLML++L+ NL+VLPVAISFFNDDLS +W++FN VSDTIFL DI VNFRTG+I NDFA+EI+L+PK IA+HY +SWF +D +SSIP+DYIFL+LN  N+ SQ MHAGRALRILRLAKLLSLLRLLRLSRLVRY+SQWEEFF  ASK  GI  LVL+M+LLGHWNAC QFLIP + +FP D W+ K  LKEA+WF QYTW+LFKAMSHMLSIGYG+ PPTS SEAW+TIVSMMTG++CYALFVGHAAALIQS+DTSKRLYREK+KQVEEYM YRKLPR LRQ+I +YYEHRYQG MFNE DIL ELSECLRE++INYNCR LVA+VPFF  AD
Sbjct:  291 PKQSTSSYLKEQFFAFFQPSDNKLAMKLFGNKNALLKEKRRQQQSGKWIIHPCSNFRFYWDLLMLVLLITNLVVLPVAISFFNDDLSPQWIIFNCVSDTIFLSDIAVNFRTGVITNDFAEEIVLDPKMIAQHYMKSWFFLDLISSIPMDYIFLVLNQRNNMSQLMHAGRALRILRLAKLLSLLRLLRLSRLVRYVSQWEEFFQIASKCFGIIKLVLIMMLLGHWNACFQFLIPFLNDFPPDSWVAKRGLKEAHWFRQYTWALFKAMSHMLSIGYGQHPPTSISEAWITIVSMMTGSSCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIANYYEHRYQGKMFNENDILSELSECLREQIINYNCRALVAAVPFFTYAD 683          

HSP 2 Score: 190.66 bits (483), Expect = 0.000e+0
Identity = 86/105 (81.90%), Postives = 99/105 (94.29%), Query Frame = 2
Query: 1736 FVSEVVVKLHYEVFQPGDFIIKEGTVGSQMYFIQEGIVDIITKDGEIATSLSDGSYFGEICLLADTRRVASVRAVTYCNVYSLDRESFLSVLEHYPIMRRTMESV 2050
            FVSEVV +L YEVFQPGD IIKEGT+G++MYFIQEGIVDIIT+DGE+ATSLSDGSYFGEICLL + RRVASVRA TYCN+YSL+RE+FLSVL++YP+MRRTMESV
Sbjct:  686 FVSEVVTRLKYEVFQPGDLIIKEGTIGTKMYFIQEGIVDIITRDGEVATSLSDGSYFGEICLLTNARRVASVRAETYCNLYSLERENFLSVLDNYPLMRRTMESV 790          
BLAST of Cyclic nucleotide gated channel 1 vs. TrEMBL
Match: A0A267GPW9 (Cyclic nucleotide-binding domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig003625g3 PE=4 SV=1)

HSP 1 Score: 597.816 bits (1540), Expect = 0.000e+0
Identity = 298/393 (75.83%), Postives = 342/393 (87.02%), Query Frame = 3
Query:  552 PRLSASMYLKEQICSLFQPGDNKLAMKLFGTQSALLKEKSRQKKHGHWIIHPCSSFRFYWDLLMLMVLVANLIVLPVAISFFNDDLSKRWLVFNGVSDTIFLLDIGVNFRTGIILNDFADEIILNPKQIAKHYARSWFIIDFLSSIPVDYIFLILNNTNHFSQFMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYISQWEEFFNTASKFIGIFNLVLMMLLLGHWNACLQFLIPMMREFPNDCWIVKCNLKEANWFDQYTWSLFKAMSHMLSIGYGRFPPTSTSEAWVTIVSMMTGATCYALFVGHAAALIQSYDTSKRLYREKYKQVEEYMGYRKLPRLLRQKITDYYEHRYQGNMFNEIDILQELSECLREKVINYNCRGLVASVPFFKNAD 1730
            P+ S S YLKEQ  + FQP DNKLAMKLFG ++ALLKEK RQ++ G WIIHPCS+FRFYWDLLML++L+ NL+VLPVAISFFNDDLS +W++FN VSDTIFL DI VNFRTG+I NDFA+EI+L+PK IA+HY +SWF +D +SSIP+DYIFL+LN  N+ SQ MHAGRALRILRLAKLLSLLRLLRLSRLVRY+SQWEEFF  ASK  GI  LVL+M+LLGHWNAC QFLIP + +FP D W+ K  LKEA+WF QYTW+LFKAMSHMLSIGYG+ PPTS SEAW+TIVSMMTG++CYALFVGHAAALIQS+DTSKRLYREK+KQVEEYM YRKLPR LRQ+I +YYEHRYQG MFNE DIL ELSECLRE++INYNCR LVA+VPFF  AD
Sbjct:  295 PKQSTSSYLKEQFFAFFQPSDNKLAMKLFGNKNALLKEKRRQQQSGKWIIHPCSNFRFYWDLLMLVLLITNLVVLPVAISFFNDDLSPQWIIFNCVSDTIFLSDIAVNFRTGVITNDFAEEIVLDPKMIAQHYMKSWFFLDLISSIPMDYIFLVLNQRNNMSQLMHAGRALRILRLAKLLSLLRLLRLSRLVRYVSQWEEFFQIASKCFGIIKLVLIMMLLGHWNACFQFLIPFLNDFPPDSWVAKRGLKEAHWFRQYTWALFKAMSHMLSIGYGQHPPTSISEAWITIVSMMTGSSCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIANYYEHRYQGKMFNENDILSELSECLREQIINYNCRALVAAVPFFTYAD 687          

HSP 2 Score: 191.045 bits (484), Expect = 0.000e+0
Identity = 86/105 (81.90%), Postives = 99/105 (94.29%), Query Frame = 2
Query: 1736 FVSEVVVKLHYEVFQPGDFIIKEGTVGSQMYFIQEGIVDIITKDGEIATSLSDGSYFGEICLLADTRRVASVRAVTYCNVYSLDRESFLSVLEHYPIMRRTMESV 2050
            FVSEVV +L YEVFQPGD IIKEGT+G++MYFIQEGIVDIIT+DGE+ATSLSDGSYFGEICLL + RRVASVRA TYCN+YSL+RE+FLSVL++YP+MRRTMESV
Sbjct:  690 FVSEVVTRLKYEVFQPGDLIIKEGTIGTKMYFIQEGIVDIITRDGEVATSLSDGSYFGEICLLTNARRVASVRAETYCNLYSLERENFLSVLDNYPLMRRTMESV 794          
BLAST of Cyclic nucleotide gated channel 1 vs. TrEMBL
Match: A0A4Z2DGN8 (Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2 OS=Schistosoma japonicum OX=6182 GN=EWB00_001166 PE=4 SV=1)

HSP 1 Score: 597.43 bits (1539), Expect = 0.000e+0
Identity = 292/392 (74.49%), Postives = 344/392 (87.76%), Query Frame = 3
Query:  555 RLSASMYLKEQICSLFQPGDNKLAMKLFGTQSALLKEKSRQKKHGHWIIHPCSSFRFYWDLLMLMVLVANLIVLPVAISFFNDDLSKRWLVFNGVSDTIFLLDIGVNFRTGIILNDFADEIILNPKQIAKHYARSWFIIDFLSSIPVDYIFLILNNTNHFSQFMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYISQWEEFFNTASKFIGIFNLVLMMLLLGHWNACLQFLIPMMREFPNDCWIVKCNLKEANWFDQYTWSLFKAMSHMLSIGYGRFPPTSTSEAWVTIVSMMTGATCYALFVGHAAALIQSYDTSKRLYREKYKQVEEYMGYRKLPRLLRQKITDYYEHRYQGNMFNEIDILQELSECLREKVINYNCRGLVASVPFFKNAD 1730
            + S S YLKEQ  + FQP DNKLAMKLFG+++ALLKEK RQ + G W+IHPCS+FRFYWDLLMLM+L+ANLI+LPVAISFFNDDLS  W++FN +SD +F+ DI V FRTG++ ND+ADEIILNPK+IA+HY +SWF++DF+SSIP+DY++LI N  +H++QF  AGR LRILRLAKLLS+LRLLRL+RLVRY+SQWEEF N ASKF+GIFNLVL+MLLLGHWNACLQ+LIPM+ EFP D W+ +C L+ A+WF QYTW+LFKAMSHMLSIGYGRFPPTS  EAW+TIVSMM+GATCYALFVGHAAALIQS+DTSKRLYREK+KQVEEYM YRKLPR LRQ+I +YYEHRYQG MF+E  IL E SECLRE+VINYNCR LVA+VPFF  AD
Sbjct:  592 KQSTSSYLKEQFQAFFQPSDNKLAMKLFGSKNALLKEKRRQVQQGKWVIHPCSNFRFYWDLLMLMLLIANLIILPVAISFFNDDLSIHWIIFNSISDVVFIADIAVKFRTGVVANDYADEIILNPKEIARHYLKSWFVLDFISSIPMDYLYLIFNKKDHYNQFFSAGRTLRILRLAKLLSMLRLLRLTRLVRYVSQWEEFLNIASKFMGIFNLVLLMLLLGHWNACLQYLIPMLMEFPPDSWVKRCKLENADWFQQYTWALFKAMSHMLSIGYGRFPPTSIGEAWITIVSMMSGATCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIANYYEHRYQGKMFDEAQILNEFSECLREQVINYNCRALVAAVPFFTYAD 983          

HSP 2 Score: 187.193 bits (474), Expect = 0.000e+0
Identity = 87/105 (82.86%), Postives = 97/105 (92.38%), Query Frame = 2
Query: 1736 FVSEVVVKLHYEVFQPGDFIIKEGTVGSQMYFIQEGIVDIITKDGEIATSLSDGSYFGEICLLADTRRVASVRAVTYCNVYSLDRESFLSVLEHYPIMRRTMESV 2050
            FVSEVV KL +EVFQPGD IIKEGT+G++MYFIQEGIVDIITKDGE+ATSLSDGSYFGEI LL + RRVASV+AV Y N+YSLDRESFLSVLE+YP+MRRTMESV
Sbjct:  986 FVSEVVTKLKFEVFQPGDLIIKEGTIGNKMYFIQEGIVDIITKDGEVATSLSDGSYFGEITLLTNARRVASVKAVVYSNLYSLDRESFLSVLENYPLMRRTMESV 1090          
BLAST of Cyclic nucleotide gated channel 1 vs. TrEMBL
Match: A0A158QHD6 (Cyclic nucleotide-binding domain-containing protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS7251 PE=4 SV=1)

HSP 1 Score: 594.734 bits (1532), Expect = 0.000e+0
Identity = 307/447 (68.68%), Postives = 365/447 (81.66%), Query Frame = 3
Query:  468 TPKDNDDGTQSEQSLSEYIGGGAP----GYRH-----PRLSASMYLKEQICSLFQPGDNKLAMKLFGTQSALLKEKSRQKKHGHWIIHPCSSFRFYWDLLMLMVLVANLIVLPVAISFFNDDLSKRWLVFNGVSDTIFLLDIGVNFRTGIILNDFADEIILNPKQIAKHYARSWFIIDFLSSIPVDYIFLILNNTNHFSQFMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYISQWEEFFNTASKFIGIFNLVLMMLLLGHWNACLQFLIPMMREFPNDCWIVKCNLKEANWFDQYTWSLFKAMSHMLSIGYGRFPPTSTSEAWVTIVSMMTGATCYALFVGHAAALIQSYDTSKRLYREKYKQVEEYMGYRKLPRLLRQKITDYYEHRYQGNMFNEIDILQELSECLREKVINYNCRGLVASVPFFKNADDILYRK*LSNFIMKSFN 1781
            T + ND G +++ S+   I   A     GY        + S S YLKEQ  + FQP DNKLAMKLFG++SAL KEK RQ++HG WIIHPCSSFRFYWDLLML +L+ANLI+LPVAISFFNDDL  +W+VFN VSD +F+ DI V FRTGII ND+AD+IIL+PK+IA+ Y RSWF++DF+SSIP+DYIF +LN    ++Q   AGR LRILRLAKLLS++RLLRLSRLVRY+SQWEEF N ASKF+GIFNLVL+MLLLGHWNACLQFLIP++ ++P D W+ +C L++A+WF+QYTW+LFKAMSHMLSIGYGRFPPTS SEAW+TIVSMMTGATCYALFVGHAAALIQS+DTSKRLYREK+KQVEEYM YRKLPR LRQ+I DYYEHRYQG MF+E  ILQELSECLRE++INYNCR LVA+VPFF  AD     + ++N   + F 
Sbjct:  385 TSQTNDTGLEAQASVESQIPSNAAAMADGYVEELCDPSKQSTSSYLKEQFFAFFQPSDNKLAMKLFGSKSALNKEKRRQQQHGKWIIHPCSSFRFYWDLLMLTLLIANLIILPVAISFFNDDLRPQWVVFNTVSDAVFIADIVVKFRTGIITNDYADDIILDPKEIARQYVRSWFLLDFISSIPLDYIFRVLNKHESYNQIFSAGRTLRILRLAKLLSMIRLLRLSRLVRYVSQWEEFLNIASKFMGIFNLVLLMLLLGHWNACLQFLIPLLMDYPEDSWVQRCRLRDADWFEQYTWALFKAMSHMLSIGYGRFPPTSISEAWITIVSMMTGATCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIADYYEHRYQGKMFDEAQILQELSECLREQIINYNCRELVAAVPFFTYADQDFVSEMVANLKFEVFQ 831          

HSP 2 Score: 107.457 bits (267), Expect = 2.934e-20
Identity = 49/63 (77.78%), Postives = 56/63 (88.89%), Query Frame = 2
Query: 1736 FVSEVVVKLHYEVFQPGDFIIKEGTVGSQMYFIQEGIVDIITKDGEIATSLSDGSYFGEICLL 1924
            FVSE+V  L +EVFQPGD IIKEGT+G++MYFIQEGIVDIITKDGEIAT+LSDGSYFG +  L
Sbjct:  817 FVSEMVANLKFEVFQPGDLIIKEGTIGTKMYFIQEGIVDIITKDGEIATTLSDGSYFGGMSFL 879          
BLAST of Cyclic nucleotide gated channel 1 vs. TrEMBL
Match: A0A3Q0KVG7 (Cyclic nucleotide-binding domain-containing protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 593.578 bits (1529), Expect = 0.000e+0
Identity = 293/392 (74.74%), Postives = 344/392 (87.76%), Query Frame = 3
Query:  555 RLSASMYLKEQICSLFQPGDNKLAMKLFGTQSALLKEKSRQKKHGHWIIHPCSSFRFYWDLLMLMVLVANLIVLPVAISFFNDDLSKRWLVFNGVSDTIFLLDIGVNFRTGIILNDFADEIILNPKQIAKHYARSWFIIDFLSSIPVDYIFLILNNTNHFSQFMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYISQWEEFFNTASKFIGIFNLVLMMLLLGHWNACLQFLIPMMREFPNDCWIVKCNLKEANWFDQYTWSLFKAMSHMLSIGYGRFPPTSTSEAWVTIVSMMTGATCYALFVGHAAALIQSYDTSKRLYREKYKQVEEYMGYRKLPRLLRQKITDYYEHRYQGNMFNEIDILQELSECLREKVINYNCRGLVASVPFFKNAD 1730
            + S S YLKEQ  + FQP DNKLAMKLFG+++ALLKEK RQ + G W+IHPCS+FRFYWDLLMLM+L+ANLI+LPVAISFFNDDLS  W++FN +SD +F+ DI V FRTGI+ ND+ADEIILNPK+IA+HY +SWFI+DF+SSIP+DY++LI N  +H++QF  AGR LRILRLAKLLS+LRLLRL+RLVRY+SQWEEF N ASKF+GIFNLVL+MLLLGHWNACLQ+LIPM+ +FP D W+ +C L+ A+WF QYTW+LFKAMSHMLSIGYGRFPPTS  EAW+TIVSMM+GATCYALFVGHAAALIQS+DTSKRLYREK+KQVEEYM YRKLPR LRQ+I +YYEHRYQG MF+E  IL E SECLRE+VINYNCR LVA+VPFF  AD
Sbjct:  596 KQSTSSYLKEQFQAFFQPSDNKLAMKLFGSKNALLKEKRRQVQQGKWVIHPCSNFRFYWDLLMLMLLIANLIILPVAISFFNDDLSIHWIIFNSISDVVFIADIAVKFRTGIVTNDYADEIILNPKEIARHYLKSWFILDFISSIPMDYLYLIFNKKDHYNQFFSAGRTLRILRLAKLLSMLRLLRLTRLVRYVSQWEEFLNIASKFMGIFNLVLLMLLLGHWNACLQYLIPMLMDFPPDSWVKRCKLENADWFQQYTWALFKAMSHMLSIGYGRFPPTSIGEAWITIVSMMSGATCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIANYYEHRYQGKMFDEAQILNEFSECLREQVINYNCRALVAAVPFFTYAD 987          

HSP 2 Score: 187.578 bits (475), Expect = 0.000e+0
Identity = 87/105 (82.86%), Postives = 97/105 (92.38%), Query Frame = 2
Query: 1736 FVSEVVVKLHYEVFQPGDFIIKEGTVGSQMYFIQEGIVDIITKDGEIATSLSDGSYFGEICLLADTRRVASVRAVTYCNVYSLDRESFLSVLEHYPIMRRTMESV 2050
            FVSEVV KL +EVFQPGD IIKEGT+G++MYFIQEGIVDIITKDGE+ATSLSDGSYFGEI LL +TRR ASV+AV Y N+YSLDRESFLSVLE+YP+MRRTMESV
Sbjct:  990 FVSEVVTKLKFEVFQPGDLIIKEGTIGNKMYFIQEGIVDIITKDGEVATSLSDGSYFGEITLLTNTRRTASVKAVVYSNLYSLDRESFLSVLENYPLMRRTMESV 1094          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Cavefish
Match: hcn4l (potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 3-like [Source:NCBI gene;Acc:103030119])

HSP 1 Score: 448.743 bits (1153), Expect = 5.453e-161
Identity = 227/396 (57.32%), Postives = 301/396 (76.01%), Query Frame = 3
Query:  555 RLSASMYLKEQICSLFQPGDNKLAMKLFGTQSALLKEKSRQKKHGHWIIHPCSSFRFYWDLLMLMVLVANLIVLPVAISFFNDDLSKRWLVFNGVSDTIFLLDIGVNFRTGIILNDFADEIILNPKQIAKHYARSWFIIDFLSSIPVDYIFLILNNTNHFSQFMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYISQWEEFF----NTASKFIGIFNLVLMMLLLGHWNACLQFLIPMMREFPNDCWIVKCNLKEANWFDQYTWSLFKAMSHMLSIGYGRFPPTSTSEAWVTIVSMMTGATCYALFVGHAAALIQSYDTSKRLYREKYKQVEEYMGYRKLPRLLRQKITDYYEHRYQGNMFNEIDILQELSECLREKVINYNCRGLVASVPFFKNAD 1730
            RL  + ++  Q+ ++ QPG NK ++++FG++ A+ +E+ R K  G WIIHP S FRFYWDL+ML+++V NLI++PV I+FF D+ +  W+VFN VSDT FL+D+ +NFRTGI+  D + EIIL+P+ I   Y RSWF +DF+SSIPVDYIFLI+  T   S F    RALRI+R  K+LSLLRLLRLSRL+RYI QWEE F    + AS  + I NL+ MMLLL HW+ CLQFL+PM+++FP+DCW+ K  +    W  QY+++LFKAMSHML IGYG +PP   ++ W+TI+SM+ GATCYA+FVGHA ALIQS D+S+R Y+EKYKQVE+YM + KLP  +RQ+I DYYEHRYQG MF+E  IL EL+E LRE++I++NCR LVA++P F NAD
Sbjct:  155 RLYQAGFMHRQLGAMLQPGVNKFSLRMFGSEKAVEREQERVKSAGFWIIHPYSDFRFYWDLIMLLLMVGNLIIIPVGITFFKDEHTPAWIVFNVVSDTFFLVDLVLNFRTGIVKED-STEIILDPQLIKVRYLRSWFAVDFISSIPVDYIFLIVE-TRIDSDFYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAMVRIVNLIGMMLLLCHWDGCLQFLVPMLQDFPSDCWVSKNKMVNDTWGQQYSYALFKAMSHMLCIGYGMYPPVGMTDVWLTILSMIVGATCYAMFVGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADMRQRIHDYYEHRYQGKMFDEESILGELNEPLREEIISFNCRKLVATMPLFANAD 548          

HSP 2 Score: 140.198 bits (352), Expect = 5.453e-161
Identity = 64/105 (60.95%), Postives = 80/105 (76.19%), Query Frame = 2
Query: 1736 FVSEVVVKLHYEVFQPGDFIIKEGTVGSQMYFIQEGIVDIITKDGEIATSLSDGSYFGEICLLADTRRVASVRAVTYCNVYSLDRESFLSVLEHYPIMRRTMESV 2050
            FV+ ++ KL +EVFQPGD+II+EGTVG +MYFIQ G++ ++TK G   T +SDGSYFGEICLL   RR ASVRA TYC +YSL  + F  VLE YP+MRR  E+V
Sbjct:  551 FVTSMLTKLRFEVFQPGDYIIREGTVGKKMYFIQHGVLTVLTK-GSKETKISDGSYFGEICLLTRGRRTASVRAETYCRLYSLSVDHFNEVLEEYPMMRRAFETV 654          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Cavefish
Match: hcn4l (potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 3-like [Source:NCBI gene;Acc:103030119])

HSP 1 Score: 448.358 bits (1152), Expect = 6.439e-161
Identity = 227/396 (57.32%), Postives = 301/396 (76.01%), Query Frame = 3
Query:  555 RLSASMYLKEQICSLFQPGDNKLAMKLFGTQSALLKEKSRQKKHGHWIIHPCSSFRFYWDLLMLMVLVANLIVLPVAISFFNDDLSKRWLVFNGVSDTIFLLDIGVNFRTGIILNDFADEIILNPKQIAKHYARSWFIIDFLSSIPVDYIFLILNNTNHFSQFMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYISQWEEFF----NTASKFIGIFNLVLMMLLLGHWNACLQFLIPMMREFPNDCWIVKCNLKEANWFDQYTWSLFKAMSHMLSIGYGRFPPTSTSEAWVTIVSMMTGATCYALFVGHAAALIQSYDTSKRLYREKYKQVEEYMGYRKLPRLLRQKITDYYEHRYQGNMFNEIDILQELSECLREKVINYNCRGLVASVPFFKNAD 1730
            RL  + ++  Q+ ++ QPG NK ++++FG++ A+ +E+ R K  G WIIHP S FRFYWDL+ML+++V NLI++PV I+FF D+ +  W+VFN VSDT FL+D+ +NFRTGI+  D + EIIL+P+ I   Y RSWF +DF+SSIPVDYIFLI+  T   S F    RALRI+R  K+LSLLRLLRLSRL+RYI QWEE F    + AS  + I NL+ MMLLL HW+ CLQFL+PM+++FP+DCW+ K  +    W  QY+++LFKAMSHML IGYG +PP   ++ W+TI+SM+ GATCYA+FVGHA ALIQS D+S+R Y+EKYKQVE+YM + KLP  +RQ+I DYYEHRYQG MF+E  IL EL+E LRE++I++NCR LVA++P F NAD
Sbjct:  176 RLYQAGFMHRQLGAMLQPGVNKFSLRMFGSEKAVEREQERVKSAGFWIIHPYSDFRFYWDLIMLLLMVGNLIIIPVGITFFKDEHTPAWIVFNVVSDTFFLVDLVLNFRTGIVKED-STEIILDPQLIKVRYLRSWFAVDFISSIPVDYIFLIVE-TRIDSDFYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAMVRIVNLIGMMLLLCHWDGCLQFLVPMLQDFPSDCWVSKNKMVNDTWGQQYSYALFKAMSHMLCIGYGMYPPVGMTDVWLTILSMIVGATCYAMFVGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADMRQRIHDYYEHRYQGKMFDEESILGELNEPLREEIISFNCRKLVATMPLFANAD 569          

HSP 2 Score: 140.198 bits (352), Expect = 6.439e-161
Identity = 64/105 (60.95%), Postives = 80/105 (76.19%), Query Frame = 2
Query: 1736 FVSEVVVKLHYEVFQPGDFIIKEGTVGSQMYFIQEGIVDIITKDGEIATSLSDGSYFGEICLLADTRRVASVRAVTYCNVYSLDRESFLSVLEHYPIMRRTMESV 2050
            FV+ ++ KL +EVFQPGD+II+EGTVG +MYFIQ G++ ++TK G   T +SDGSYFGEICLL   RR ASVRA TYC +YSL  + F  VLE YP+MRR  E+V
Sbjct:  572 FVTSMLTKLRFEVFQPGDYIIREGTVGKKMYFIQHGVLTVLTK-GSKETKISDGSYFGEICLLTRGRRTASVRAETYCRLYSLSVDHFNEVLEEYPMMRRAFETV 675          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Cavefish
Match: hcn2b (potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2 [Source:NCBI gene;Acc:103044493])

HSP 1 Score: 448.743 bits (1153), Expect = 5.704e-160
Identity = 236/448 (52.68%), Postives = 312/448 (69.64%), Query Frame = 3
Query:  474 KDNDDGTQSEQSLSEYIGGGAPGYRHPRLS-------------------------ASMYLKEQICSLFQPGDNKLAMKLFGTQSALLKEKSRQKKHGHWIIHPCSSFRFYWDLLMLMVLVANLIVLPVAISFFNDDLSKRWLVFNGVSDTIFLLDIGVNFRTGIILNDFADEIILNPKQIAKHYARSWFIIDFLSSIPVDYIFLILNNTNHFSQFMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYISQWEEFF----NTASKFIGIFNLVLMMLLLGHWNACLQFLIPMMREFPNDCWIVKCNLKEANWFDQYTWSLFKAMSHMLSIGYGRFPPTSTSEAWVTIVSMMTGATCYALFVGHAAALIQSYDTSKRLYREKYKQVEEYMGYRKLPRLLRQKITDYYEHRYQGNMFNEIDILQELSECLREKVINYNCRGLVASVPFFKNAD 1730
            +D D  ++   + +      AP  R PR+S                         A  +++ Q  S+ QPG NK ++++FG+Q A+ KE+ R K  G+WIIHP S FRFYWD  MLM +V NLI++PV I+FF D+ +  W++FN VSDT FL+D+ +NFRTGI+  D   EIIL+PKQI K Y R+WF++DF+SSIPVDYIFLI+      S+     RALRI+R  K+LSLLRLLRLSRL+RYI QWEE F    + AS  + I NL+ MMLLL HW+ CLQFL+PM+++FP+DCW+    +   +W + Y+++LFKAMSHML IGYGR  P S S+ W+T++SM+ GATCYA+F+GHA ALIQS D+S+R Y+EKYKQVE+YM + KLP   RQKI DYYEHRYQG MF+E  IL+EL+E LRE+++N+NCR LVAS+P F NAD
Sbjct:   59 QDMDGASELAPNTTPSTPASAPDRRDPRVSFSTAPGPTKTPEDAQLAGDDGEARDAQTFMQRQFSSMLQPGVNKFSLRMFGSQKAVEKEQERVKSAGNWIIHPYSDFRFYWDFTMLMFMVGNLIIIPVGITFFKDETTTPWIIFNVVSDTFFLMDLVLNFRTGIVYED-NTEIILDPKQIKKKYLRTWFVVDFISSIPVDYIFLIVEKGID-SEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAVMRIINLIGMMLLLCHWDGCLQFLVPMLQDFPSDCWVSLNKMVNDSWSELYSFALFKAMSHMLCIGYGRQAPESMSDIWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEESILEELNEPLREEIVNFNCRKLVASMPLFANAD 504          

HSP 2 Score: 137.117 bits (344), Expect = 5.704e-160
Identity = 64/105 (60.95%), Postives = 80/105 (76.19%), Query Frame = 2
Query: 1736 FVSEVVVKLHYEVFQPGDFIIKEGTVGSQMYFIQEGIVDIITKDGEIATSLSDGSYFGEICLLADTRRVASVRAVTYCNVYSLDRESFLSVLEHYPIMRRTMESV 2050
            FV+ ++ KL +EVFQP D+II+EGT+G +MYFIQ G+V ++TK G I   LSDGSYFGEICLL   RR ASVRA TYC +YSL  ++F  VLE YP+MRR  E+V
Sbjct:  507 FVTAMLTKLRFEVFQPLDYIIREGTIGKKMYFIQHGVVSVLTK-GSIGMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETV 610          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Cavefish
Match: ENSAMXT00000011919.2 (pep primary_assembly:Astyanax_mexicanus-2.0:10:25443689:25475024:1 gene:ENSAMXG00000011501.2 transcript:ENSAMXT00000011919.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 426.402 bits (1095), Expect = 7.184e-154
Identity = 219/393 (55.73%), Postives = 300/393 (76.34%), Query Frame = 3
Query:  567 SMYLKEQICSLFQPGDNKLAMKLFGTQSALLKEKSRQKKHGHWIIHPCSSFRFYWDLLMLMVLVANLIVLPVAISFFNDDLSKRWLVFNGVSDTIFLLDIGVNFRTGIILNDFADEIILNPKQIAKHYARSWFIIDFLSSIPVDYIFLILNNTNHF-SQFMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYISQWEEFF----NTASKFIGIFNLVLMMLLLGHWNACLQFLIPMMREFPNDCWIVKCNLKEANWFDQYTWSLFKAMSHMLSIGYGRFPPTSTSEAWVTIVSMMTGATCYALFVGHAAALIQSYDTSKRLYREKYKQVEEYMGYRKLPRLLRQKITDYYEHRYQGNMFNEIDILQELSECLREKVINYNCRGLVASVPFFKNAD 1730
            S +++ Q  ++ QPG NK ++++FG+  A+  E+ R K  G WIIHP S FRFYWDLLML++++ NLI+LPV I+FF D+ +  W++FN VSDT+FL+D+ +NFRTGI+  D + EI+L+PK I + Y +SWF++DF+SSIPVDYIFL+++      S+     RALRI+R  K+LSLLRLLRLSRL+RYI QWEE F    + AS  + I NL+ MMLLL HW+ CLQFL+PM+++FP DCW+ K N+   +W  QY+++LFKAMSHML IGYG   P   ++ W+T++SM+ GATCYA+F+GHA ALIQS D+S+R Y+EKYKQVE+YM + KLP  +RQKI +YYEHRYQG MF+E +IL ELSE L+E+++++NCR LVA++P F NAD
Sbjct:  137 STFIQRQFGAMLQPGVNKFSLRMFGSHKAVALEQERLKSAGVWIIHPYSDFRFYWDLLMLLLMMGNLIILPVGITFFKDENTPPWIIFNVVSDTLFLVDLVLNFRTGIVKED-STEILLDPKAIRQRYLKSWFLVDFVSSIPVDYIFLMVDLEARLDSEVYRTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAMVRIVNLIGMMLLLCHWDGCLQFLVPMLQDFPIDCWVYKNNMVNDSWGVQYSYALFKAMSHMLCIGYGAQAPEGMTDVWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADVRQKIHEYYEHRYQGKMFDEENILGELSEPLKEEIVSFNCRSLVANMPLFANAD 528          

HSP 2 Score: 138.658 bits (348), Expect = 7.184e-154
Identity = 66/105 (62.86%), Postives = 79/105 (75.24%), Query Frame = 2
Query: 1736 FVSEVVVKLHYEVFQPGDFIIKEGTVGSQMYFIQEGIVDIITKDGEIATSLSDGSYFGEICLLADTRRVASVRAVTYCNVYSLDRESFLSVLEHYPIMRRTMESV 2050
            FV+ V+ KL +EVFQP DFII+EGTVG +MYFIQ G V ++T+ G   T LSDGSYFGEICLL   RR ASVRA TYC +YSL  +SF  VLE +P+MRR  E+V
Sbjct:  531 FVTAVLTKLRFEVFQPNDFIIREGTVGRKMYFIQHGRVSVLTR-GNKETKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDSFNEVLEEHPMMRRAFETV 634          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Cavefish
Match: hcn2b (potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2 [Source:NCBI gene;Acc:103044493])

HSP 1 Score: 448.743 bits (1153), Expect = 1.939e-145
Identity = 242/479 (50.52%), Postives = 322/479 (67.22%), Query Frame = 3
Query:  474 KDNDDGTQSEQSLSEYIGGGAPGYRHPRLS-------------------------ASMYLKEQICSLFQPGDNKLAMKLFGTQSALLKEKSRQKKHGHWIIHPCSSFRFYWDLLMLMVLVANLIVLPVAISFFNDDLSKRWLVFNGVSDTIFLLDIGVNFRTGIILNDFADEIILNPKQIAKHYARSWFIIDFLSSIPVDYIFLILNNTNHFSQFMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYISQWEEFF----NTASKFIGIFNLVLMMLLLGHWNACLQFLIPMMREFPNDCWIVKCNLKEANWFDQYTWSLFKAMSHMLSIGYGRFPPTSTSEAWVTIVSMMTGATCYALFVGHAAALIQSYDTSKRLYREKYKQVEEYMGYRKLPRLLRQKITDYYEHRYQGNMFNEIDILQELSECLREKVINYNCRGLVASVPFFKNADDILYRK*LSNFIMKSFN------REISLSKK 1805
            +D D  ++   + +      AP  R PR+S                         A  +++ Q  S+ QPG NK ++++FG+Q A+ KE+ R K  G+WIIHP S FRFYWD  MLM +V NLI++PV I+FF D+ +  W++FN VSDT FL+D+ +NFRTGI+  D   EIIL+PKQI K Y R+WF++DF+SSIPVDYIFLI+      S+     RALRI+R  K+LSLLRLLRLSRL+RYI QWEE F    + AS  + I NL+ MMLLL HW+ CLQFL+PM+++FP+DCW+    +   +W + Y+++LFKAMSHML IGYGR  P S S+ W+T++SM+ GATCYA+F+GHA ALIQS D+S+R Y+EKYKQVE+YM + KLP   RQKI DYYEHRYQG MF+E  IL+EL+E LRE+++N+NCR LVAS+P F NAD       L+    + F       RE ++ KK
Sbjct:  107 QDMDGASELAPNTTPSTPASAPDRRDPRVSFSTAPGPTKTPEDAQLAGDDGEARDAQTFMQRQFSSMLQPGVNKFSLRMFGSQKAVEKEQERVKSAGNWIIHPYSDFRFYWDFTMLMFMVGNLIIIPVGITFFKDETTTPWIIFNVVSDTFFLMDLVLNFRTGIVYEDNT-EIILDPKQIKKKYLRTWFVVDFISSIPVDYIFLIVEKGID-SEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAVMRIINLIGMMLLLCHWDGCLQFLVPMLQDFPSDCWVSLNKMVNDSWSELYSFALFKAMSHMLCIGYGRQAPESMSDIWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEESILEELNEPLREEIVNFNCRKLVASMPLFANADPNFVTAMLTKLRFEVFQPLDYIIREGTIGKK 583          

HSP 2 Score: 139.428 bits (350), Expect = 8.048e-34
Identity = 64/105 (60.95%), Postives = 80/105 (76.19%), Query Frame = 2
Query: 1736 FVSEVVVKLHYEVFQPGDFIIKEGTVGSQMYFIQEGIVDIITKDGEIATSLSDGSYFGEICLLADTRRVASVRAVTYCNVYSLDRESFLSVLEHYPIMRRTMESV 2050
            FV+ ++ KL +EVFQP D+II+EGT+G +MYFIQ G+V ++TK G I   LSDGSYFGEICLL   RR ASVRA TYC +YSL  ++F  VLE YP+MRR  E+V
Sbjct:  555 FVTAMLTKLRFEVFQPLDYIIREGTIGKKMYFIQHGVVSVLTK-GSIGMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETV 658          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007865.1 (pep scaffold:Pmarinus_7.0:GL480431:10244:18565:-1 gene:ENSPMAG00000007113.1 transcript:ENSPMAT00000007865.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 262.307 bits (669), Expect = 1.552e-82
Identity = 151/287 (52.61%), Postives = 208/287 (72.47%), Query Frame = 3
Query:  729 WDLLMLMVLVANLIVLPVAISFFNDDLSKRWLVFNGVSDTIFLLDIGVNFRTGIILNDFADEIILNPKQIAKHYARSWFIIDFLSSIPVDYIFLILNNTNHFSQFMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYISQWEEF-FNTASKFIGIFNLVLMMLLLGHWNACLQFLIPMMREFPNDCWI--------------------VKCNLKEANWFDQYTWSLFKAMSHMLSIGYGRFPPTSTSEAWVTIVSMMTGATCYALFVGHAAALIQSYDTSKRLYREKYK 1526
            WD++ML+++V NLIV+PV I+FF+++ +  W+VFN +SDT FL+D+ +NFRTGI++ D  D IIL+P+ I   Y +SWF++DF+SSIPVDYIFLI+  T   S+     RALRI+R  K+LSLLRLLRLSRL+RYI QWEE  ++ AS  + I NL+ MMLLL HW+ CLQFL+PM++EFP+DCWI                    +    +  +W  QY+++LFKAMSHML IGYG+  P S ++ W+T++SM+ GATCYA+F+GHA ALIQS D+S+R Y+EK +
Sbjct:    1 WDIIMLLLMVGNLIVIPVGITFFHEEDTTAWIVFNVLSDTCFLVDLVLNFRTGIVVEDNTD-IILDPQVIKMRYLKSWFLVDFVSSIPVDYIFLIVE-TRIDSEMYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEMTYDLASAVVRIVNLIAMMLLLCHWDGCLQFLVPMLQEFPHDCWISLNGMVVGLAASRTHLRFFAITPVCQNDSWGKQYSYALFKAMSHMLCIGYGQRAPVSMADLWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKMQ 285          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005594.1 (pep scaffold:Pmarinus_7.0:GL476331:707593:738342:1 gene:ENSPMAG00000005049.1 transcript:ENSPMAT00000005594.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 111.694 bits (278), Expect = 1.455e-34
Identity = 105/396 (26.52%), Postives = 181/396 (45.71%), Query Frame = 3
Query:  654 LLKEKSRQKKHGH-WIIHPCSSFRFYWDLLMLMVLVANLIVLPVAISFFNDDLSKR------------WLVFNGVSDTIFLLDIGVNFRTGIILNDFADEIILNPKQIAKHYARSWFIIDFLSSIPVDYIFLILNNTNHFSQFMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYISQWEEFFNTASKFIGIFNLVLMML---LLGHWNACLQFLIPMMREFPNDC-------WIVKCNLKEANWF------------DQYTWSLFKAMSHMLSIGYGRFPPTSTSEAWVTIVSMMTGATCYALFVGHAAALIQSYDTSKRLYREKYKQVEEYMGYRKLPRLLRQKITDYYEHRYQGNMFNEID---ILQELSECLREKVINYNCRGLVASVPFFKNA 1727
            +L E   Q    H W I   S F+  WD L+L++++   I  P   +F   D                  + + + D +F++DI +NFRT  I  +  +E++ +P +IA HY + WF+ID +++IP D +            F     +     L  LL   RLLRL R+ R + ++ E+        G   LVL+M    L+ HW AC+ + I  M E P D        W+ +   +    +            D+Y  +L+   S + S+G+G   P +  E   +I  M+ G+  YA   G+ +A+IQ   +    Y  +  +V+E++ + ++P  LRQ++ +Y++H +  +  N ID   +L+   ECL+  +  +  R L+ S   F  A
Sbjct:   75 VLPEYKLQAPRIHKWTILHYSPFKAVWDWLILLLVIYTAIFTPYTAAFLLSDQQVENERQKCGYSCNPLNIVDLMVDIMFMVDIFINFRTTYINKN--EEVVSHPGKIAIHYFKGWFLIDMVAAIPFDLLI-----------FGSGSGSGETTTLIGLLKTARLLRLVRVARKLDRYSEY--------GAAVLVLLMCTFALIAHWLACIWYAIGNM-ERPVDSLAKDRIGWLDQLGGQIGKPYNDTDTSSGPSIKDKYVTALYFTFSSLTSVGFGNVSPNTNYEKIFSICVMLIGSLMYASIFGNVSAIIQRLYSGTARYHTQMLRVKEFIRFHQIPNPLRQRLEEYFQHAW--SYTNGIDMNMVLKGFPECLQADICLHLNRTLLESCKAFNGA 446          

HSP 2 Score: 52.7582 bits (125), Expect = 1.455e-34
Identity = 30/83 (36.14%), Postives = 46/83 (55.42%), Query Frame = 2
Query: 1781 PGDFIIKEGTVGSQMYFIQEGIVDIITKDGEIATSLSDGSYFGEIC--LLADTRRVASVRAVTYCNVYSLDRESFLSVLEHYP 2023
            PGD ++  G V + MYF+  G ++I+ +D  +A  L     FGE         +  A VRA+TYC+++ + RE  L VL+ YP
Sbjct:  465 PGDTLVHSGDVITAMYFLSRGSIEILREDIVVAI-LGKNDIFGEPVNQYSRPGKSSADVRALTYCDLHKIVREDMLEVLDMYP 546          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Sea Lamprey
Match: kcnh1b (potassium voltage-gated channel, subfamily H (eag-related), member 1b [Source:ZFIN;Acc:ZDB-GENE-121128-4])

HSP 1 Score: 105.145 bits (261), Expect = 8.709e-31
Identity = 110/452 (24.34%), Postives = 192/452 (42.48%), Query Frame = 3
Query:  504 QSLSEYIGGGAPGYRHPRLSASMYLKEQICSLFQPGDNKLAMKLFGTQSALLKEKSRQKKHGHWIIHPCSSFRFYWDLLMLMVLVANLIVLPVAISFFNDDLSKRWLVFNGVSDTIFLLDIGVNFRTGIILNDFADEIILNPKQIAKHYARSWFIIDFLSSIPVDYIFLILN--------------NTNHFSQFMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYISQWEEFFNTASKFIGIFNLVLMMLLLGHWNACLQFLI---PMMREFPN----DCWIVKCN--LKEANWFDQYTW------------SLFKAMSHMLSIGYGRFPPTSTSEAWVTIVSMMTGATCYALFVGHAAALIQSYDTSKRLYREKYKQVEEYMGYRKLPRLLRQKITDYYEHRYQGNMFNEIDILQELSEC---LREKVINYNCRGLVASVPFFKNADDILYR 1745
            Q L+  +  G   ++H RL+  + L   I   ++                    +   K   H I+H C+ F+  WD ++L++     I++P  +SF     +  WLV + V D IFL+DI +NF T  +    A E+I +PK I  +Y ++WF+ID LS +P D I    N               +   S+ + A   +    ++ L S L+++RL RL R   + + +    +  + +  LV +  L  HW AC+ + I    ++ E  N      W+ +    +     F+   W            SL+  M+ + SIG+G   PT+  E    +  MM G+  YA   G+   + Q    +   Y E    V +++   ++P+ L +++ DY    +  +M   ID  + L  C   +R  +  +  R +    P F+ A D   R
Sbjct:  146 QQLTPNVHKGENVHKHSRLAEVLQLGSDILPQYK--------------------QETPKTPPHIILHYCA-FKTTWDWIILILTFYTAIMVPYNVSFKTKQNNVAWLVVDSVVDVIFLVDIVLNFHTTFV--GPAGEVISDPKLIRMNYLKTWFVIDLLSCLPYDIINAFENVDEVVRAAQIRGPFGSRSPSRLLDAWPRVAPQGISSLFSSLKVVRLLRLGRVARKLDHYIEYGAAVLVL--LVCVFGLAAHWLACIWYSIGDYEVIDEATNLIRKHSWLYQLGETIGTPYHFNGTQWEGGPSKDAVYISSLYFTMTSLTSIGFGNIAPTTDGEKIFAVAMMMIGSLLYATIFGNVTTIFQQMYANTNRYHEMLNSVRDFLKLYQVPKGLSERVMDYIVSTW--SMSKGIDTEKVLHICPKDMRADICVHLNRKVFNEHPAFRLASDGCLR 570          

HSP 2 Score: 46.595 bits (109), Expect = 8.709e-31
Identity = 26/84 (30.95%), Postives = 48/84 (57.14%), Query Frame = 2
Query: 1781 PGDFIIKEGTVGSQMYFIQEGIVDIITKDGEIATSLSDGSYFGEIC----LLADTRRVASVRAVTYCNVYSLDRESFLSVLEHY 2020
            PGD I   G     + F+  G +++I +D E+   L  G  FG++     ++A +   A+VRA+TYC+++ + R++ + VL+ Y
Sbjct:  583 PGDLIYHAGESVDTLCFVVSGSLEVI-QDDEVVAILGKGDVFGDVFWKERVIAPS--CANVRALTYCDLHVIRRDALVKVLDFY 663          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005922.1 (pep scaffold:Pmarinus_7.0:GL476456:333240:381928:-1 gene:ENSPMAG00000005344.1 transcript:ENSPMAT00000005922.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 93.5893 bits (231), Expect = 6.624e-26
Identity = 91/380 (23.95%), Postives = 175/380 (46.05%), Query Frame = 3
Query:  615 NKLAMK--LFGTQSALLKEKSRQKKHGHWIIHPCSSFRFYWDLLMLMVLVANLIVLPVAISFF----NDDLSKRWLVFNGVSDTIFLLDIGVNFRTGIILNDFADEIILNPKQIAKHYARSWFIIDFLSSIPVDYIFLILNNTNHFSQFMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYISQWEEFFNTASKFIGIFNLVLMMLLLGHWNACLQFLIPMMREFPND------CWIVKCNLKEANWF------------DQYTWSLFKAMSHMLSIGYGRFPPTSTSEAWVTIVSMMTGATCYALFVGHAAALIQSYDTSKRLYREKYKQVEEYMGYRKLPRLLRQKITDYYEHRYQGNMFNEID---ILQELSECLREKV 1673
            NKL +   +FG + +L + K    +   +I+    +F+  WDLL+L+      + +P  + F     N    +   V +   + +F++DI +NFRT  +    + +++ + + I  HY  +WF ID ++++P D ++         +  +H           K + LLRLLRL + +   SQ+     T         L+ M  LL HW AC+ + I       ND       W+ +   K    F              Y  SL+ A+S + S+G+G     + +E   ++ +M+ GA  +A+  G+  A+IQ   + +  Y  + K +++++   +LP+ L+Q++ +Y++  +  N  N ID   +L++  + LR  +
Sbjct:   21 NKLKINNNVFGEKPSLPEYKVAAIQKSRFILLHYGTFKAGWDLLILLATFYVAVTVPYNVCFSETVENISDPRSTAVVDISVEILFIIDILLNFRTTYVSK--SGQVVYDGRSICVHYVTTWFFIDLIAALPFDLLYAF---NVSVTTLVHL---------LKTVRLLRLLRLLQNLDRYSQYSTVVLTL--------LMFMFGLLAHWMACIWYKIGRAEIEINDRHSWDIGWLHELGKKLETPFHTNNTGGGPSTRSAYIASLYFALSSLTSVGFGNVSANTDAEKIFSVCAMLIGALMHAVVFGNVTAIIQRMYSRRSQYHTRTKDLKDFIRVHRLPKQLKQRMLEYFQTTWSVN--NGIDTHELLKDFPDELRADI 376          

HSP 2 Score: 41.9726 bits (97), Expect = 6.624e-26
Identity = 24/83 (28.92%), Postives = 41/83 (49.40%), Query Frame = 2
Query: 1781 PGDFIIKEGTVGSQMYFIQEGIVDIITKDGEIATSLSDGSYFGEICLLADT--RRVASVRAVTYCNVYSLDRESFLSVLEHYP 2023
            PG+F+I++G      YF+  G ++++ KD  +   L  G   G      D   +  A V+A+TYC++  +       VL+ YP
Sbjct:  412 PGEFLIRQGDALQAFYFVCSGSMEVL-KDDMVLAILGKGDLIGSDLSSKDQVLKTNADVKALTYCDLQCIHLRGLYDVLDLYP 493          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Sea Lamprey
Match: kcnh8 (potassium voltage-gated channel, subfamily H (eag-related), member 8 [Source:ZFIN;Acc:ZDB-GENE-060503-204])

HSP 1 Score: 101.293 bits (251), Expect = 5.022e-24
Identity = 87/370 (23.51%), Postives = 172/370 (46.49%), Query Frame = 3
Query:  711 SSFRFYWDLLMLMVLVANLIVLPVAISFFNDD----LSKRWLVFNGVSDTIFLLDIGVNFRTGIILNDFADEIILNPKQIAKHYARSWFIIDFLSSIPVDYIFLILNNTNHFSQFMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYISQWEEFFNTASKFIGIFNLVLMMLLLGHWNACLQFLIPMMREFPNDCWIVKCNLKEANWFDQ-----------------------YTWSLFKAMSHMLSIGYGRFPPTSTSEAWVTIVSMMTGATCYALFVGHAAALIQSYDTSKRLYREKYKQVEEYMGYRKLPRLLRQKITDYYEHRYQGNMFNEID---ILQELSECLREKVINYNCRGLVASVPFFKNAD 1730
             +F+  WD L+L+      + +P  + F N D     S+  +V +  S+ +F++DI +NFRT  +    + +++ N + I  HY  +WF ID ++++P D + ++ +     + F+H  + +R+LRL +LL  L            SQ+          + +  L+ M  LL HW AC+ ++I        D         +  W  +                       Y  SL+  +S + S+G+G     +  E   +I +M+ GA  +A+  G+  A+IQ   + + LY  + + ++E++   +LP  L+Q++ +Y++  +  N  N ID   +L++  + LR  V  +  + ++  +P F++A 
Sbjct:   20 GTFKAGWDWLILLATFYVAVTVPYNVCFLNSDEQCTSSRSTMVSDITSEILFIIDIVLNFRTTYVSG--SGQVVYNGRSICLHYVTTWFPIDLIAALPFDLLVIVRSWGERGTSFVHLLKTVRLLRLLRLLQKLDRY---------SQYSA--------VVLAMLMCMFALLAHWMACIWYIIGFEEMKSTD-----LVTHQIGWLQELQRRLVAPHYPNITQGMPPIRSAYITSLYFTLSSITSVGFGNVSANTDGEKIFSICAMLIGALMHAVVFGNVTAIIQRMYSRRSLYLTRTRDLKEFIRIHRLPHQLKQRMLEYFQTTWSVN--NGIDTNELLKDFPDELRADVTMHLNKEML-QLPLFESAS 362          

HSP 2 Score: 27.7202 bits (60), Expect = 5.022e-24
Identity = 12/38 (31.58%), Postives = 22/38 (57.89%), Query Frame = 2
Query: 1781 PGDFIIKEGTVGSQMYFIQEGIVDIITKDGEIATSLSD 1894
            PG+++I++G      YFI  G ++ + KDG +   L +
Sbjct:  380 PGEYLIRQGDALQAFYFILSGSMEAL-KDGTVLAILGE 416          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Yeast
Match: BCY1 (Regulatory subunit of the cyclic AMP-dependent protein kinase (PKA); PKA is a component of a signaling pathway that controls a variety of cellular processes, including metabolism, cell cycle, stress response, stationary phase, and sporulation [Source:SGD;Acc:S000001295])

HSP 1 Score: 64.6994 bits (156), Expect = 1.712e-11
Identity = 33/93 (35.48%), Postives = 49/93 (52.69%), Query Frame = 2
Query: 1733 YFVSEVVVKLHYEVFQPGDFIIKEGTVGSQMYFIQEGIVDIITKDGEIATSLSDGSYFGEICLLADTRRVASVRAVTYCNVYSLDRESFLSVL 2011
            Y  +++   L  +++QPG+ II+EG  G   Y I+ G VD+  K   +   L D  YFGE+ LL D  R A+V A     V +L +  F  +L
Sbjct:  309 YDRAKLADALDTKIYQPGETIIREGDQGENFYLIEYGAVDVSKKGQGVINKLKDHDYFGEVALLNDLPRQATVTATKRTKVATLGKSGFQRLL 401          

HSP 2 Score: 57.7658 bits (138), Expect = 3.082e-9
Identity = 30/86 (34.88%), Postives = 49/86 (56.98%), Query Frame = 2
Query: 1784 GDFIIKEGTVGSQMYFIQEGIVDIITKDGEIATSLSDGSYFGEICLLADTRRVASVRAVTYCNVYSLDRESFLSVLEHYPIMRRTM 2041
            G  IIK+G  G   Y +++G VD    D ++ +S   GS FGE+ L+ ++ R A+V A + C +++LDR +F  +L      +R M
Sbjct:  208 GATIIKQGDQGDYFYVVEKGTVDFYVNDNKVNSS-GPGSSFGELALMYNSPRAATVVATSDCLLWALDRLTFRKILLGSSFKKRLM 292          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Nematostella
Match: EDO49064 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI02])

HSP 1 Score: 360.918 bits (925), Expect = 1.260e-130
Identity = 189/372 (50.81%), Postives = 272/372 (73.12%), Query Frame = 3
Query:  612 DNKLAMKLFGTQSALLKEKSRQKKHGHWIIHPCSSFRFYWDLLMLMVLVANLIVLPVAISFFNDDLSKRWLVFNGVSDTIFLLDIGVNFRTGIILNDFADEIILNPKQIAKHYARSWFIIDFLSSIPVDYIFLILNNTNHFSQFMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYISQWEEFFNTASKFIGIFNLVLMMLLLGHWNACLQFLIPMMREFPNDCWIVKCNLKEANWFDQYTWSLFKAMSHMLSIGYGRFPPTSTSEAWVTIVSMMTGATCYALFVGHAAALIQSYDTSKRLYREKYKQVEEYMGYRKLPRLLRQKITDYYEHRYQGNMFNEIDILQELSECLREKVINYNCRGLVASVPFFKNA 1727
            DNKLA+KLFG ++A++ E+ RQ + G  +IHP S+FR+YWD+L+++ +  ++++LPV+I+F +DDLS  WL+ NGVSD  F++DI +NFRTGI+  +  +E+IL+ K I+  Y R WFIID  SS+P DY + I ++T      + A RALRIL+LAKLLSLLRLLR+SRLVRY++++EE  N A   + I  L+  ML+L HWN C+QF +P ++EFP+D W+   NLK A+  +QY+WSLF+A+SHML IGYG +PP + ++ W+T+ SM  GAT YA+F+G  ++LI S D+S RL+ EK  QVEEYM YRKLP  +R ++ D+YEHR+   +F+E  IL ELS+ LRE ++ +N + L+ +VPFF  A
Sbjct:    1 DNKLALKLFGNKAAVMLEQRRQSQQGKGVIHPFSTFRWYWDILLIIFIFMHVLLLPVSIAFLSDDLSIHWLILNGVSDVFFVVDIFLNFRTGIVDPNNQEEVILDKKVISMMYLRGWFIIDLASSLPFDYAYFIASSTTEEQTLLRASRALRILKLAKLLSLLRLLRVSRLVRYMTRFEELLNIAKGQLRIMKLICCMLVLSHWNGCIQFFVPYLQEFPDDSWVSTSNLKTASPGEQYSWSLFRALSHMLCIGYGHYPPQNLTDLWLTVCSMTAGATFYAVFIGIMSSLIMSIDSSGRLFNEKLNQVEEYMRYRKLPLRIRLQVQDFYEHRFHHKLFDEDAILTELSKNLRETILVHNIKPLLTTVPFFSGA 372          

HSP 2 Score: 125.176 bits (313), Expect = 1.260e-130
Identity = 60/106 (56.60%), Postives = 79/106 (74.53%), Query Frame = 2
Query: 1736 FVSEVVVKLHYEVFQPGDFIIKEGTVGSQMYFIQEGIVDIITKDGEIATSLSDGSYFGEICLLA-DTRRVASVRAVTYCNVYSLDRESFLSVLEHYPIMRRTMESV 2050
            F++++V KL +EVF  GD+I + G  G +MYFIQ+GIVDI+T++G +ATSL DGS+FGEICLL  + RRVASVRA T C+VYSL    F  VL+ YP M+  +E V
Sbjct:  376 FITDIVTKLKFEVFLNGDYICRSGHRGDKMYFIQKGIVDILTREGALATSLGDGSHFGEICLLTKEARRVASVRAATTCDVYSLSATHFHEVLQDYPEMKSVLEEV 481          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Nematostella
Match: EDO34316 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPS0])

HSP 1 Score: 376.711 bits (966), Expect = 3.873e-130
Identity = 203/385 (52.73%), Postives = 277/385 (71.95%), Query Frame = 3
Query:  576 LKEQICSLFQPGDNKLAMKLFGTQSALLKEKSRQKKHGHWIIHPCSSFRFYWDLLMLMVLVANLIVLPVAISFFNDDLSKRWLVFNGVSDTIFLLDIGVNFRTGIILNDFADEIILNPKQIAKHYARSWFIIDFLSSIPVDYIFLILNNTNHFSQFMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYISQWEEFFNTASKFIGIFNLVLMMLLLGHWNACLQFLIPMMREFPNDCWIVKCNLKEANWFDQYTWSLFKAMSHMLSIGYGRFPPTSTSEAWVTIVSMMTGATCYALFVGHAAALIQSYDTSKRLYREKYKQVEEYMGYRKLPRLLRQKITDYYEHRYQGNMFNEIDILQELSECLREKVINYNCRGLVASVPFFKNAD 1730
            ++ ++ S  +P DNK+ MK+FG++ A+  E+ R  + G W+IHP S FR YWD+ +L++L+ NL  LPV ISFF D++S RW+ FN VSDT FLLDI +NFRTG++++   ++ IL+PK IAK Y ++WF ID +SS+P+DYI      ++  S  + A R L++LR AKLL LL+LLRLSRLVRY+ Q+EE  N     I   NLV ++LL+ HWN CLQFL+P +++FP   W+   NL + +W++QY WSLFKAMSHML IGYGR+PP + +E WVT  SM+TGAT YA+F+ +    IQ  D+  R YREK +Q+EEYM YR+LP  LR ++T YY+HRYQG MF+E  IL E+S+ LRE++INYNCR LV SVPFF  A+
Sbjct:    1 IEMRLKSWLKPMDNKMNMKVFGSKRAMKDEQLRYSRAG-WVIHPTSIFRLYWDMWVLLLLLINLFALPVLISFFADNVSARWIAFNAVSDTAFLLDILLNFRTGVLVHGSPNKFILDPKIIAKRYLKTWFFIDLISSLPIDYIVEAATQSSTKS-LIGATRTLKLLRFAKLLGLLKLLRLSRLVRYVQQYEEILNVTRSVIRFINLVSIILLIAHWNGCLQFLVPYLQDFPETSWVSIHNLMDNDWWEQYCWSLFKAMSHMLCIGYGRYPPQNIAEVWVTTFSMLTGATFYAMFIAYCINFIQQLDSPGRNYREKIQQIEEYMSYRRLPVELRDRMTKYYDHRYQGRMFDEEKILHEISKPLREQIINYNCRDLVQSVPFFTEAE 383          

HSP 2 Score: 107.842 bits (268), Expect = 3.873e-130
Identity = 51/105 (48.57%), Postives = 74/105 (70.48%), Query Frame = 2
Query: 1736 FVSEVVVKLHYEVFQPGDFIIKEGTVGSQMYFIQEGIVDIITKDGEIATSLSDGSYFGEICLLADTRRVASVRAVTYCNVYSLDRESFLSVLEHYPIMRRTMESV 2050
            FVS ++ +L +EV+  GD I++EG +G++MYF++EG+V + T  G+ A  L DG+YFGEICLL + RR ASV A T C+V+ L+ E F  V++ +P MR  ME V
Sbjct:  386 FVSAIITRLSFEVYLEGDIIVREGELGTEMYFLREGVVSV-TVGGKHANELCDGAYFGEICLLTNARRTASVTAKTVCDVFILNAEHFRDVVDEFPTMRILMEIV 489          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Nematostella
Match: EDO35393 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLM8])

HSP 1 Score: 84.7297 bits (208), Expect = 1.463e-35
Identity = 42/119 (35.29%), Postives = 73/119 (61.34%), Query Frame = 2
Query: 1709 SIL*KCR*YFVSEVVVKLHYEVFQPGDFIIKEGTVGSQMYFIQEGIVDIITKDG-EIATSLSDGSYFGEICLL----ADTRRVASVRAVTYCNVYSLDRESFLSVLEHYPIMRRTMESV 2050
            +I   C   F+ E+V++L  ++F PGD++ ++G VG +MY +  G ++++++ G +I   L  GSYFGEI +L    A  RR ASVR+V Y  ++ L +   + VL+ YP ++  +E +
Sbjct:  321 AIFQDCEAGFLCELVLRLRSQLFSPGDYVCRKGEVGREMYIVNRGKLEVVSEHGTKIYAVLEAGSYFGEISVLSMSSAGNRRTASVRSVGYTELFCLAKNDLMEVLDEYPNIKEKIEKI 439          

HSP 2 Score: 83.9593 bits (206), Expect = 1.463e-35
Identity = 78/337 (23.15%), Postives = 154/337 (45.70%), Query Frame = 3
Query:  723 FYWDLLMLMVLVANL--IVLPVAISFFNDDLSKRWLVFNGVSDTIFLLDIGVNFRTGIILNDFADEIILN--PKQIAKHYARSW-FIIDFLSSIPVD--YIFL------ILNNTNHFSQFMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYISQWEEFFNTASKFIGIFNLVLMMLLLGHWNACLQFLIPMMREFPNDCWIVK------CNLKEANWFDQYTWSLFKAMSHMLSIGYGRFPPTSTSEAWVTIVSMMTGATCYALFVGHAAALIQSYDTSKRLYREKYKQVEEYMGYRKLPRLLRQKITDYYEHRYQGNMF-NEIDILQELSECLREKV 1673
            ++W L++ + ++ N   I+L  A    ND ++  WL+ +   D I++ DI V+ RTG     F +E IL     ++ +HY  ++ F +D  + IP+D  YIF+       +N    F +F H                           ++ + E    T    + + +LV  +LL+ HWNAC+ F++     F +D W+         N  E      Y +S + +   + +IG    PP S  E  +  +  + G   +A  VG+   +I + + ++  ++ K   ++ YM + K+P+ L++++  ++++ +      +E +IL  L + LR ++
Sbjct:    6 YFWLLVVSLAVLYNCWAIILRTAFPQINDKITYIWLILDYSCDLIYIADILVSMRTG-----FLEEGILQTCSTKMRRHYLHTYEFYLDAGALIPLDIAYIFIEHEPAFRINRILKFHRFWH---------------------------FLDRTESR-TTFPNVVRLASLVQFILLIIHWNACIYFIVSREIGFGSDVWVYPGVRQEILNSSENTISRMYIYSFYWSTLTLTTIGEVP-PPYSEVEYIIVTLDYLIGVLLFATIVGNVGNIITNLNATRLDFQNKMDGIKAYMRFHKIPQHLQRRVIKWFDYLWTYKKHPDEEEILLSLPDKLRAEI 308          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Nematostella
Match: EDO30140 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1M9])

HSP 1 Score: 115.546 bits (288), Expect = 1.251e-34
Identity = 103/376 (27.39%), Postives = 182/376 (48.40%), Query Frame = 3
Query:  654 LLKEKSRQKKHGH-WIIHPCSSFRFYWDLLMLMVLVANLIVLPVAISFF------NDDLSKR------------------WLVFNGVSDTIFLLDIGVNFRTGIILNDFADEIILNPKQIAKHYARSWFIIDFLSSIPVDYIFLILNNTNHFSQFMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYISQWEEFFNTASKFIGIFNLVLMML---LLGHWNACLQFLIP-MMREFPNDC--WIVKCNLKEANWFDQ------------YTWSLFKAMSHMLSIGYGRFPPTSTSEAWVTIVSMMTGATCYALFVGHAAALIQSYDTSKRLYREKYKQVEEYMGYRKLPRLLRQKITDYYEHRYQGNMFNEIDILQELS 1652
            +L E   Q  + H W I   S F+ +WD L+L +++   IV P   SF        D+L+K                    ++ + + D +F++DI +NFRT  +  D  DE++ +P +IA HY ++WF+ID +++IP + + +++ NT+  +  +             LL   RLLRL R+ R +  + E+        G+  L L+M    LL HW AC+ + I  + R+  N    W+     +    FD+            Y  +L+  +S + S+G+G   P + +E   +I  M+ G+  YA   G+ AA+I    ++   Y  + ++V E++ + ++P  LRQ+I DY  H +  +  N ID+ Q+L+
Sbjct:  194 VLPEYKLQAPNIHPWTILHYSVFKAFWDWLILFLVIYTAIVTPYMASFILTRDKMRDELNKDPETRRDYGSGAREVYSDPLVILDYLVDVMFIVDIFINFRTTFV--DSNDEVVSHPCRIAVHYFKTWFVIDLMAAIPFE-LLIMVGNTDETTTLI------------GLLKTARLLRLVRVARKLDHYSEY--------GMAVLCLLMCSFALLAHWLACIWYAIGNLERQRTNSTHGWLDVLAEQIHRPFDEKEVDSGPDIESKYITALYFTLSSLTSVGFGNVSPNTNAEKIFSICVMLIGSLFYAAIFGNVAAIIARLYSNTARYHAQMQRVREFIRFHQIPNPLRQRIEDYSHHIW--SYTNGIDMDQDLN 544          

HSP 2 Score: 50.0618 bits (118), Expect = 1.251e-34
Identity = 34/122 (27.87%), Postives = 56/122 (45.90%), Query Frame = 2
Query: 1748 VVVKLHYEVFQPGDFIIKEGTVGSQMYFIQEGIVDIITKDGEIATSLSD-------------------GSYFGEICLLADTRRVA----SVRAVTYCNVYSLDRESFLSVLEHYPIMRRTME 2044
            + +KL      PGDFII +G   S +YF+  G V+++ KD  I   L +                   G  FGE   L+  R       S+RA+TYC++ ++ R+  ++ +  YP  ++T  
Sbjct:  565 LALKLRTTHLPPGDFIIYQGDEISHLYFLVRGTVEVL-KDDTIMAILGEQEDEIMMLCLQFSIYLQGKGDSFGENFGLSPNRPPGNSHVSIRALTYCDLRAISRDDLVNTMRMYPNFQQTFN 685          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Nematostella
Match: EDO35376 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLM9])

HSP 1 Score: 85.8853 bits (211), Expect = 1.292e-33
Identity = 80/358 (22.35%), Postives = 164/358 (45.81%), Query Frame = 3
Query:  696 IIHPCSSFRFYWDLLMLMVLVANLIVLPVAISF--FNDDLSKRWLVFNGVSDTIFLLDIGVNFRTGIILNDFADEIILNPKQIAKHYARSW-FIIDFLSSIPVDYIFLILNNTN--HFSQFMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYISQWEEFFNTASKFIGIFNLVLMMLLLGHWNACLQFLIPMMREFPNDCWI-VKCNLKEANWFDQYTWSLFKAMSHMLSIGYGRFPPTSTSEAWVT----IVSMMTGATCYALFVGHAAALIQSYDTSKRLYREKYKQVEEYMGYRKLPRLLRQKITDYYEH--RYQGNMFNEIDILQELSECLREKV-INYNCRGLVASVPFFKNAD 1730
            ++ P  +F F W L + + ++ N   L V ++F   ++   K  +  +   D+IF LD  V FR G + +     +++   ++ K Y  S+ F++D +S +P D ++L L       F++   A                                E ++   K   +  L+  + L+ HW AC+ F++     F  D W+  + + + +    QY +SL+++   M ++G G     +T    +T    IV+ +TG   +A  VG+A  +I     S+  Y  K   ++EY+   +LP  L++++  ++++  R++ +M NE ++  +L++  + ++ I+ N   L+  V  F + D
Sbjct:    2 VLDPSGTFYFLWLLTVSLGVIYNYWALIVYVAFPSVHEANLKTCIAVDYTFDSIFFLDTLVQFRVGFLEHGV---MVVGCWKLTKKYGCSFGFMLDLISILPFDVLYLYLGVLPILRFNRLFKA----------------------HRFLLFCDRGEIYSGRPKLFNLAKLIHYLFLIIHWVACVYFILSRYEGFGTDEWLHPRLDGQLSKLSMQYLYSLYRSSVSMTTVGAGVIGTIATPRTELTLCFVIVTYLTGVLIFATIVGNAGDMIVEMRRSRERYLRKLNGMKEYIEAYQLPAHLKKRVIHWFDYLWRHKRDM-NEQELFHKLNDNFKAEIAIHVNLDTLI-RVEMFHDCD 332          

HSP 2 Score: 76.2554 bits (186), Expect = 1.292e-33
Identity = 39/107 (36.45%), Postives = 63/107 (58.88%), Query Frame = 2
Query: 1736 FVSEVVVKLHYEVFQPGDFIIKEGTVGSQMYFIQEGIVDIITKDGEIATSLSDGSYFGEICLLA----DTRRVASVRAVTYCNVYSLDRESFLSVLEHYPIMRRTME 2044
            F+ E+V+KL   +  PGDFI ++G  G +MY + +G ++++ +   +  +LS GS+FGEI LL        R ASVR+V + +++ L +     VLE YP  +  ME
Sbjct:  335 FLHELVLKLRPVICSPGDFICRQGEKGREMYIVNKGSLEVLDEKETVLATLSAGSHFGEISLLNMKGIGNLRTASVRSVGFSDLFQLSKTDLEEVLEFYPQAKEQME 441          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Medaka
Match: ENSORLT00000019258.2 (potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2 [Source:NCBI gene;Acc:101172279])

HSP 1 Score: 445.277 bits (1144), Expect = 1.151e-159
Identity = 226/396 (57.07%), Postives = 300/396 (75.76%), Query Frame = 3
Query:  555 RLSASMYLKEQICSLFQPGDNKLAMKLFGTQSALLKEKSRQKKHGHWIIHPCSSFRFYWDLLMLMVLVANLIVLPVAISFFNDDLSKRWLVFNGVSDTIFLLDIGVNFRTGIILNDFADEIILNPKQIAKHYARSWFIIDFLSSIPVDYIFLILNNTNHFSQFMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYISQWEEFF----NTASKFIGIFNLVLMMLLLGHWNACLQFLIPMMREFPNDCWIVKCNLKEANWFDQYTWSLFKAMSHMLSIGYGRFPPTSTSEAWVTIVSMMTGATCYALFVGHAAALIQSYDTSKRLYREKYKQVEEYMGYRKLPRLLRQKITDYYEHRYQGNMFNEIDILQELSECLREKVINYNCRGLVASVPFFKNAD 1730
            R S + +++ Q  S+ QPG NK +++++G+Q A+ +E+ R K  G+WIIHP S FRFYWD  ML+ +V NLI++PV I+FF D+ +  W++FN VSDT FL+D+ +NFRTGII+ D +D IIL+PK I   Y ++WFI+DF+SSIPVDYIFLI+      S+     RALRI+R  K+LSLLRLLRLSRL+RYI QWEE F    + AS  + IFNL+ MMLLL HW+ CLQFL+PM++EFP+DCW+    ++   W + Y++++FKAMSHML IGYGR  P S S+ W+T++SM+ GATCYA+F+GHA ALIQS D+S+R Y+EKYKQVE+YM + KLP   RQKI DYYEHRYQG MF+E  IL ELSE LRE+++N+NCR LVAS+P F NA+
Sbjct:  328 RGSQASFMQRQFSSMLQPGVNKFSLRMYGSQKAVEREQERVKSAGNWIIHPYSDFRFYWDFTMLLFMVGNLIIIPVGITFFKDETTTPWIIFNVVSDTFFLMDLVLNFRTGIIIEDNSD-IILDPKTIKTKYLKTWFIVDFISSIPVDYIFLIVEKGID-SEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAVMRIFNLIGMMLLLCHWDGCLQFLVPMLQEFPSDCWVSLNKMENDTWSELYSFAVFKAMSHMLCIGYGRQAPESLSDIWLTMLSMIVGATCYAVFIGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEESILGELSEPLREEIVNFNCRKLVASMPLFANAE 721          

HSP 2 Score: 139.428 bits (350), Expect = 1.151e-159
Identity = 64/105 (60.95%), Postives = 79/105 (75.24%), Query Frame = 2
Query: 1736 FVSEVVVKLHYEVFQPGDFIIKEGTVGSQMYFIQEGIVDIITKDGEIATSLSDGSYFGEICLLADTRRVASVRAVTYCNVYSLDRESFLSVLEHYPIMRRTMESV 2050
            FV+ ++ KL +EVFQP D+II+EGT+G +MYFIQ G+  +ITK G +A  LSDGSYFGEICLL   RR ASVRA TYC +YSL  + F  VLE YP+MRR  E+V
Sbjct:  724 FVTAMLTKLRFEVFQPHDYIIREGTIGKKMYFIQHGVCSVITK-GTLAMKLSDGSYFGEICLLTRGRRTASVRAETYCRLYSLSVDHFNEVLEEYPMMRRAFETV 827          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Medaka
Match: ENSORLT00000045599.1 (potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 3 [Source:NCBI gene;Acc:101158796])

HSP 1 Score: 434.876 bits (1117), Expect = 2.199e-156
Identity = 216/392 (55.10%), Postives = 302/392 (77.04%), Query Frame = 3
Query:  567 SMYLKEQICSLFQPGDNKLAMKLFGTQSALLKEKSRQKKHGHWIIHPCSSFRFYWDLLMLMVLVANLIVLPVAISFFNDDLSKRWLVFNGVSDTIFLLDIGVNFRTGIILNDFADEIILNPKQIAKHYARSWFIIDFLSSIPVDYIFLILNNTNHFSQFMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYISQWEEFF----NTASKFIGIFNLVLMMLLLGHWNACLQFLIPMMREFPNDCWIVKCNLKEANWFDQYTWSLFKAMSHMLSIGYGRFPPTSTSEAWVTIVSMMTGATCYALFVGHAAALIQSYDTSKRLYREKYKQVEEYMGYRKLPRLLRQKITDYYEHRYQGNMFNEIDILQELSECLREKVINYNCRGLVASVPFFKNAD 1730
            S +++ Q  ++ QPG NK ++++FG+  A+  E+ R K  G WIIHP S FRFYWDLLML++++ NLIVLPV I+FF D+ +  W++FN VSDT+F++D+ +NFRTGI+  D   EI+L+P++I ++Y +SWF++DF+SSIPVDYIFL++++ +  S+     RALRI+R  K+LSLLRLLRLSRL+RYI QWEE F    + AS  + I NL+ MMLLL HW+ CLQFL+PM+++FP+DCW+ K  +    W  QY+++LFKAMSHML IGYG   P   ++ W+T++SM+ GATCYA+F+GHA ALIQS D+S+R Y+EKYKQVE+YM + KLP  +RQKI +YYEHR+QG MF+E +IL ELSE L+E+++++NCR LVA++P F NAD
Sbjct:  182 STFIQRQFGAMLQPGVNKFSLRMFGSHKAVAMEQERLKSAGAWIIHPYSDFRFYWDLLMLILMMGNLIVLPVGITFFRDENTASWIIFNVVSDTLFMVDLVLNFRTGIVKED-NTEILLDPREIRQNYLKSWFLVDFVSSIPVDYIFLMMDSLD--SEVYRTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAMVRIVNLIGMMLLLCHWDGCLQFLVPMLQDFPHDCWVSKNLMVNDTWGVQYSYALFKAMSHMLCIGYGAQAPEGMTDVWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADMRQKIHEYYEHRFQGKMFDEENILGELSEPLKEEIVSFNCRSLVANMPLFANAD 570          

HSP 2 Score: 139.043 bits (349), Expect = 2.199e-156
Identity = 66/105 (62.86%), Postives = 79/105 (75.24%), Query Frame = 2
Query: 1736 FVSEVVVKLHYEVFQPGDFIIKEGTVGSQMYFIQEGIVDIITKDGEIATSLSDGSYFGEICLLADTRRVASVRAVTYCNVYSLDRESFLSVLEHYPIMRRTMESV 2050
            FV+ V+ KL +EVFQP DFII+EGTVG +MYFIQ G V ++T+ G   T LSDGSYFGEICLL   RR ASVRA TYC +YSL  +SF  VLE +P+MRR  E+V
Sbjct:  573 FVTAVLTKLRFEVFQPADFIIREGTVGRKMYFIQHGRVSVLTR-GNKETKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDSFNEVLEEHPMMRRAFETV 676          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Medaka
Match: ENSORLT00000013376.2 (potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 3 [Source:NCBI gene;Acc:101158796])

HSP 1 Score: 434.106 bits (1115), Expect = 3.280e-156
Identity = 216/392 (55.10%), Postives = 302/392 (77.04%), Query Frame = 3
Query:  567 SMYLKEQICSLFQPGDNKLAMKLFGTQSALLKEKSRQKKHGHWIIHPCSSFRFYWDLLMLMVLVANLIVLPVAISFFNDDLSKRWLVFNGVSDTIFLLDIGVNFRTGIILNDFADEIILNPKQIAKHYARSWFIIDFLSSIPVDYIFLILNNTNHFSQFMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYISQWEEFF----NTASKFIGIFNLVLMMLLLGHWNACLQFLIPMMREFPNDCWIVKCNLKEANWFDQYTWSLFKAMSHMLSIGYGRFPPTSTSEAWVTIVSMMTGATCYALFVGHAAALIQSYDTSKRLYREKYKQVEEYMGYRKLPRLLRQKITDYYEHRYQGNMFNEIDILQELSECLREKVINYNCRGLVASVPFFKNAD 1730
            S +++ Q  ++ QPG NK ++++FG+  A+  E+ R K  G WIIHP S FRFYWDLLML++++ NLIVLPV I+FF D+ +  W++FN VSDT+F++D+ +NFRTGI+  D   EI+L+P++I ++Y +SWF++DF+SSIPVDYIFL++++ +  S+     RALRI+R  K+LSLLRLLRLSRL+RYI QWEE F    + AS  + I NL+ MMLLL HW+ CLQFL+PM+++FP+DCW+ K  +    W  QY+++LFKAMSHML IGYG   P   ++ W+T++SM+ GATCYA+F+GHA ALIQS D+S+R Y+EKYKQVE+YM + KLP  +RQKI +YYEHR+QG MF+E +IL ELSE L+E+++++NCR LVA++P F NAD
Sbjct:   49 STFIQRQFGAMLQPGVNKFSLRMFGSHKAVAMEQERLKSAGAWIIHPYSDFRFYWDLLMLILMMGNLIVLPVGITFFRDENTASWIIFNVVSDTLFMVDLVLNFRTGIVKED-NTEILLDPREIRQNYLKSWFLVDFVSSIPVDYIFLMMDSLD--SEVYRTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAMVRIVNLIGMMLLLCHWDGCLQFLVPMLQDFPHDCWVSKNLMVNDTWGVQYSYALFKAMSHMLCIGYGAQAPEGMTDVWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADMRQKIHEYYEHRFQGKMFDEENILGELSEPLKEEIVSFNCRSLVANMPLFANAD 437          

HSP 2 Score: 139.043 bits (349), Expect = 3.280e-156
Identity = 66/105 (62.86%), Postives = 79/105 (75.24%), Query Frame = 2
Query: 1736 FVSEVVVKLHYEVFQPGDFIIKEGTVGSQMYFIQEGIVDIITKDGEIATSLSDGSYFGEICLLADTRRVASVRAVTYCNVYSLDRESFLSVLEHYPIMRRTMESV 2050
            FV+ V+ KL +EVFQP DFII+EGTVG +MYFIQ G V ++T+ G   T LSDGSYFGEICLL   RR ASVRA TYC +YSL  +SF  VLE +P+MRR  E+V
Sbjct:  440 FVTAVLTKLRFEVFQPADFIIREGTVGRKMYFIQHGRVSVLTR-GNKETKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDSFNEVLEEHPMMRRAFETV 543          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Medaka
Match: ENSORLT00000019259.2 (potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 3 [Source:NCBI gene;Acc:101159259])

HSP 1 Score: 428.713 bits (1101), Expect = 1.269e-153
Identity = 224/396 (56.57%), Postives = 299/396 (75.51%), Query Frame = 3
Query:  555 RLSASMYLKEQICSLFQPGDNKLAMKLFGTQSALLKEKSRQKKHGHWIIHPCSSFRFYWDLLMLMVLVANLIVLPVAISFFNDDLSKRWLVFNGVSDTIFLLDIGVNFRTGIILNDFADEIILNPKQIAKHYARSWFIIDFLSSIPVDYIFLILNNTNHFSQFMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYISQWEEFF----NTASKFIGIFNLVLMMLLLGHWNACLQFLIPMMREFPNDCWIVKCNLKEANWFDQYTWSLFKAMSHMLSIGYGRFPPTSTSEAWVTIVSMMTGATCYALFVGHAAALIQSYDTSKRLYREKYKQVEEYMGYRKLPRLLRQKITDYYEHRYQGNMFNEIDILQELSECLREKVINYNCRGLVASVPFFKNAD 1730
            RL  + ++  Q  ++ QPG NK ++++ G++ A+  E+ R K  G WIIHP S FRFYWDL ML+++V NL+++PV I+FF D+ +  W+VFN VSDT FL+D+ +NFRTGI+  D   EIIL+P++I   Y +SWF++DF+SSIPVDYIFLI+  T   S F    RALRI+R  K+LSLLRLLRLSRL+RYI QWEE F    + AS  + I NL+ MMLLL HW+ CLQFL+PM+++FP DCW+ +  +    W  QY+++LFKAMSHML IGYG +PP   ++ W+TI+SM+ GATC+A+FVGHA ALIQS D+S+R Y+EKYKQVE+YM + KLP  +RQ+I DYYEHRYQG MF+E +IL+EL+E LRE++IN+NCR LVAS+P F NAD
Sbjct:  165 RLYQAGFMHRQFGAMLQPGVNKFSLRMLGSERAVEHERERVKSAGFWIIHPYSDFRFYWDLTMLLLMVGNLVIIPVGITFFKDEHTPPWIVFNVVSDTFFLMDLVLNFRTGIVKED-NTEIILDPQKIKIKYLKSWFMVDFISSIPVDYIFLIVE-TRIDSDFYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEVFHMTYDLASAMVRIMNLIAMMLLLCHWDGCLQFLVPMLQDFPADCWVTRNKMVNDTWGQQYSYALFKAMSHMLCIGYGLYPPIGMADVWLTILSMIVGATCFAMFVGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADMRQRIHDYYEHRYQGKMFDEENILEELNEPLREEIINFNCRKLVASMPLFANAD 558          

HSP 2 Score: 135.961 bits (341), Expect = 1.269e-153
Identity = 63/105 (60.00%), Postives = 78/105 (74.29%), Query Frame = 2
Query: 1736 FVSEVVVKLHYEVFQPGDFIIKEGTVGSQMYFIQEGIVDIITKDGEIATSLSDGSYFGEICLLADTRRVASVRAVTYCNVYSLDRESFLSVLEHYPIMRRTMESV 2050
            FV+ ++ KL +EVFQPGDFII+EGT G +MYFIQ G+V +IT   +  T L+DGSYFGEICLL   RR ASVRA  YC +YSL  ++F  VLE YP+MRR  E+V
Sbjct:  561 FVTSMLTKLRFEVFQPGDFIIREGTNGKKMYFIQHGVVSVITNHSK-DTKLTDGSYFGEICLLTRGRRTASVRADNYCRLYSLSVDNFDEVLEEYPMMRRAFETV 664          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Medaka
Match: hcn3 (potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2-like [Source:NCBI gene;Acc:101157708])

HSP 1 Score: 421.394 bits (1082), Expect = 6.708e-150
Identity = 214/392 (54.59%), Postives = 292/392 (74.49%), Query Frame = 3
Query:  573 YLKEQICSLFQPGDNKLAMKLFGTQSALLKEKSRQKKHGHWIIHPCSSFRFYWDLLMLMVLVANLIVLPVAISFFNDDLSKRWLVFNGVSDTIFLLDIGVNFRTGIILNDFADEIILNPKQIAKHYARSWFIIDFLSSIPVDYIFLI--LNNTNHFSQFMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYISQWEEFF----NTASKFIGIFNLVLMMLLLGHWNACLQFLIPMMREFPNDCWIVKCNLKEANWFDQYTWSLFKAMSHMLSIGYGRFPPTSTSEAWVTIVSMMTGATCYALFVGHAAALIQSYDTSKRLYREKYKQVEEYMGYRKLPRLLRQKITDYYEHRYQGNMFNEIDILQELSECLREKVINYNCRGLVASVPFFKNAD 1730
            Y ++Q+ SL QPG NK ++++FG+   +  E+ R K  G WIIHP S FRFYWD++ML+++++NL++LP  I+FF D  +  W+VFN +SDT+FL+D+  NFRTGI++ D    +IL+PK+I  HY ++WF++DF+SSIPVDYIFL+  L   +  S      RALRI+R  K+LSLLRLLRLSRL+RYI QWEE F    + AS  + I NL+ MMLLL HW+ CL F++PM+++FP DCW+ + N+  A W  QY+++LF AMSHML IGYG  PP   S+ W+T+VSM+ GATCYA+F+GHAA L+QS D S R Y+EKYKQVE+YM + KLP  +RQ+I DYYEHR+QG MF+E  IL ELS+ L+E++++YNCRGLVA++P F N D
Sbjct:  106 YFQKQLGSLLQPGINKFSLRMFGSHKGVAAEQERVKSFGVWIIHPYSDFRFYWDIVMLLLMMSNLVILPWGITFFEDQNTLPWIVFNVLSDTLFLMDLIFNFRTGILVED--SHVILDPKEIRMHYIQTWFLVDFVSSIPVDYIFLVVDLEGRHESSDVYRTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAVVRIVNLIGMMLLLCHWDGCLTFMVPMLQDFPPDCWVYRNNMVNATWHIQYSYALFMAMSHMLCIGYGANPPEGMSDVWLTMVSMVVGATCYAMFLGHAANLVQSLDASHRQYQEKYKQVEQYMSFHKLPADVRQRIHDYYEHRFQGKMFDEDSILGELSDPLKEEIVSYNCRGLVANMPLFANTD 495          

HSP 2 Score: 130.568 bits (327), Expect = 6.708e-150
Identity = 62/106 (58.49%), Postives = 78/106 (73.58%), Query Frame = 2
Query: 1733 YFVSEVVVKLHYEVFQPGDFIIKEGTVGSQMYFIQEGIVDIITKDGEIATSLSDGSYFGEICLLADTRRVASVRAVTYCNVYSLDRESFLSVLEHYPIMRRTMESV 2050
            +FV+ ++ KL +EVFQPGDFII+EGT+G +MYFIQ G V +I + G     LSDG+YFGEICLL   RR ASV+A TYC +YSL  + F  VLE +P+MRR  ESV
Sbjct:  497 HFVTVILTKLRFEVFQPGDFIIREGTLGRKMYFIQHGTVMVIPR-GSKEIRLSDGAYFGEICLLTQGRRTASVKAETYCRLYSLSADDFNEVLEEHPLMRRAFESV 601          
BLAST of Cyclic nucleotide gated channel 1 vs. Planmine SMEST
Match: SMESG000020049.1 (SMESG000020049.1)

HSP 1 Score: 606.29 bits (1562), Expect = 0.000e+0
Identity = 309/392 (78.83%), Postives = 352/392 (89.80%), Query Frame = 3
Query:  555 RLSASMYLKEQICSLFQPGDNKLAMKLFGTQSALLKEKSRQKKHGHWIIHPCSSFRFYWDLLMLMVLVANLIVLPVAISFFNDDLSKRWLVFNGVSDTIFLLDIGVNFRTGIILNDFADEIILNPKQIAKHYARSWFIIDFLSSIPVDYIFLILNNTNHFSQFMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYISQWEEFFNTASKFIGIFNLVLMMLLLGHWNACLQFLIPMMREFPNDCWIVKCNLKEANWFDQYTWSLFKAMSHMLSIGYGRFPPTSTSEAWVTIVSMMTGATCYALFVGHAAALIQSYDTSKRLYREKYKQVEEYMGYRKLPRLLRQKITDYYEHRYQGNMFNEIDILQELSECLREKVINYNCRGLVASVPFFKNAD 1730
            R + S YLKEQ  S FQP DNKLAMKLFG ++AL KEK RQ++ G W+IHPCS+FRFYWDLLML +L+ANLI+LPVAISFFNDDLS +W++FN +SDTIFLLDI VNFRTG+I ND+ADEIIL PKQIA++Y +SWF +DF+SSIP+DYIFLILN   +F+Q MHAGRALRILRLAKLLSLLRLLRLSRLVRY+SQWEE  N ASKFIGIFNLVL+MLLLGHWNACLQFLIPM+R++P+D W++KC LKEA WFDQYTW+LFKAMSHMLSIGYGR+PPTS  EAW+TIVSMMTGATCYALFVGHAAALIQS+DTSKRLYREK+KQVEEYM YRKLPR LRQ+I +YYEHRYQG MFNE+DIL ELSECLRE++INYNCR LVA+VPFF  AD
Sbjct:  248 RQTTSSYLKEQFLSFFQPSDNKLAMKLFGNKNALNKEKRRQQQQGKWVIHPCSNFRFYWDLLMLSLLIANLIILPVAISFFNDDLSLKWIIFNCISDTIFLLDIFVNFRTGVITNDYADEIILVPKQIAQNYLKSWFALDFISSIPLDYIFLILNKKEYFNQIMHAGRALRILRLAKLLSLLRLLRLSRLVRYVSQWEELLNVASKFIGIFNLVLLMLLLGHWNACLQFLIPMLRDYPSDSWVIKCKLKEAYWFDQYTWALFKAMSHMLSIGYGRYPPTSICEAWITIVSMMTGATCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPRGLRQRIANYYEHRYQGKMFNELDILNELSECLREQIINYNCRALVAAVPFFTYAD 639          

HSP 2 Score: 192.2 bits (487), Expect = 0.000e+0
Identity = 90/105 (85.71%), Postives = 99/105 (94.29%), Query Frame = 2
Query: 1736 FVSEVVVKLHYEVFQPGDFIIKEGTVGSQMYFIQEGIVDIITKDGEIATSLSDGSYFGEICLLADTRRVASVRAVTYCNVYSLDRESFLSVLEHYPIMRRTMESV 2050
            FVSEVVVKL YEVFQPGD IIKEG +G++MYFIQEGIVDIITK+GE+ATSLSDGSYFGEICLL + RRVASVRA TYCNVYSLDR+SFLSVLE+YP+MRRTMESV
Sbjct:  642 FVSEVVVKLQYEVFQPGDLIIKEGNLGTRMYFIQEGIVDIITKEGEVATSLSDGSYFGEICLLTNARRVASVRAETYCNVYSLDRDSFLSVLENYPLMRRTMESV 746          
BLAST of Cyclic nucleotide gated channel 1 vs. Planmine SMEST
Match: SMESG000038954.1 (SMESG000038954.1)

HSP 1 Score: 583.178 bits (1502), Expect = 0.000e+0
Identity = 312/464 (67.24%), Postives = 370/464 (79.74%), Query Frame = 3
Query:  351 KKPKASANDLNQSFNLLNVKNFDSAFHMFNPLDSFRVNKTPKDNDDGTQSEQSLSEYIGGGAPGYRHPRLSASMYLKEQICSLFQPGDNKLAMKLFGTQSALLKEKSRQKKHGHWIIHPCSSFRFYWDLLMLMVLVANLIVLPVAISFFNDDLSKRWLVFNGVSDTIFLLDIGVNFRTGIILNDFADEIILNPKQIAKHYARSWFIIDFLSSIPVDYIFLILNN----TNHFSQFMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYISQWEEFFNTASKFIGIFNLVLMMLLLGHWNACLQFLIPMMREFPNDCWIVKCNLKEANWFDQYTWSLFKAMSHMLSIGYGRFPPTSTSEAWVTIVSMMTGATCYALFVGHAAALIQSYDTSKRLYREKYKQVEEYMGYRKLPRLLRQKITDYYEHRYQGNMFNEIDILQELSECLREKVINYNCRGLVASVPFFKNAD 1730
            +K   S ++++ SF    +K    A   F  +D  R +++  +NDD T               G  + +  AS YLKEQ  S FQP DNKLA+KLFG ++A+ KE+ RQ++ G  +IHPCS+FRFYWDL+ML++L+ NLIVLPVAISFFNDDLS  W+VFN VSDTIF+LDI VNFRTGII NDFADEIIL+PK IA+ Y +SWFI+D LSSIP+DY+FL+LN+      ++SQF HAGR LRI RLAKLLS+LRLLRLSRLVRY+SQWEEF N ASKFIGI  LVL+MLLLGHWNACLQFLIPM+ E+P + W++KCNLK+A WF QYTW+LFKAMSHMLSIGYGRFPPTS SEAW+TIVSMMTGATCYALFVGHAAA+IQS+DTSKRLYREK+KQVEEYM YRKLPR LRQ+I +YYEHRYQG MF+E  IL ELSECLRE++INYNCR LVA+VPFF  AD
Sbjct:  217 EKTAHSLSNIDSSFEKDIIKRSHEADGQFEDVDE-RSDESNDENDDQTN--------------GDLNNKSRASSYLKEQFFSFFQPSDNKLALKLFGNKNAVNKERRRQQQQGKLVIHPCSNFRFYWDLMMLVLLITNLIVLPVAISFFNDDLSLHWIVFNCVSDTIFILDIAVNFRTGIITNDFADEIILDPKIIARRYVKSWFILDLLSSIPMDYLFLVLNHGPDKNENYSQFFHAGRTLRIFRLAKLLSMLRLLRLSRLVRYVSQWEEFLNMASKFIGICKLVLLMLLLGHWNACLQFLIPMLMEYPAESWVIKCNLKDAYWFKQYTWALFKAMSHMLSIGYGRFPPTSISEAWITIVSMMTGATCYALFVGHAAAIIQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIANYYEHRYQGKMFDEEVILIELSECLREQIINYNCRALVAAVPFFTYAD 665          

HSP 2 Score: 181.03 bits (458), Expect = 0.000e+0
Identity = 83/105 (79.05%), Postives = 96/105 (91.43%), Query Frame = 2
Query: 1736 FVSEVVVKLHYEVFQPGDFIIKEGTVGSQMYFIQEGIVDIITKDGEIATSLSDGSYFGEICLLADTRRVASVRAVTYCNVYSLDRESFLSVLEHYPIMRRTMESV 2050
            FVSEVV KL +EV+QPGD IIKEGT+G++M+FIQEGIVDIITKDGE+ATSLSDGSYFGEICLL + +RVASVRA TYCN+YSLD E F +VLE+YP+MRRTMESV
Sbjct:  668 FVSEVVTKLKFEVYQPGDLIIKEGTIGTKMFFIQEGIVDIITKDGEVATSLSDGSYFGEICLLTNAKRVASVRAETYCNLYSLDAEHFQAVLENYPLMRRTMESV 772          
BLAST of Cyclic nucleotide gated channel 1 vs. Planmine SMEST
Match: SMESG000038954.1 (SMESG000038954.1)

HSP 1 Score: 572.392 bits (1474), Expect = 0.000e+0
Identity = 312/481 (64.86%), Postives = 370/481 (76.92%), Query Frame = 3
Query:  351 KKPKASANDLNQSFNLLNVKNFDSAFHMFNPLDSFRVNKTPKDNDDGTQSEQSLSEYIGGGAPGYRHPRLSASMYLKEQICSLFQPGDNKLAMKLFGTQSALLKEKSRQKKHGHWIIHPCSSFRFYWDLLMLMVLVANLIVLPVAISFFNDDLSKRWLVFNGVSDTIFLLDIGVNFRTGIILNDFADEIILNPKQIAKHYARSWFIIDFLSSIPVDYIFLILNN----TNHFSQFMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYISQWEE-----------------FFNTASKFIGIFNLVLMMLLLGHWNACLQFLIPMMREFPNDCWIVKCNLKEANWFDQYTWSLFKAMSHMLSIGYGRFPPTSTSEAWVTIVSMMTGATCYALFVGHAAALIQSYDTSKRLYREKYKQVEEYMGYRKLPRLLRQKITDYYEHRYQGNMFNEIDILQELSECLREKVINYNCRGLVASVPFFKNAD 1730
            +K   S ++++ SF    +K    A   F  +D  R +++  +NDD T               G  + +  AS YLKEQ  S FQP DNKLA+KLFG ++A+ KE+ RQ++ G  +IHPCS+FRFYWDL+ML++L+ NLIVLPVAISFFNDDLS  W+VFN VSDTIF+LDI VNFRTGII NDFADEIIL+PK IA+ Y +SWFI+D LSSIP+DY+FL+LN+      ++SQF HAGR LRI RLAKLLS+LRLLRLSRLVRY+SQWEE                 F N ASKFIGI  LVL+MLLLGHWNACLQFLIPM+ E+P + W++KCNLK+A WF QYTW+LFKAMSHMLSIGYGRFPPTS SEAW+TIVSMMTGATCYALFVGHAAA+IQS+DTSKRLYREK+KQVEEYM YRKLPR LRQ+I +YYEHRYQG MF+E  IL ELSECLRE++INYNCR LVA+VPFF  AD
Sbjct:  280 EKTAHSLSNIDSSFEKDIIKRSHEADGQFEDVDE-RSDESNDENDDQTN--------------GDLNNKSRASSYLKEQFFSFFQPSDNKLALKLFGNKNAVNKERRRQQQQGKLVIHPCSNFRFYWDLMMLVLLITNLIVLPVAISFFNDDLSLHWIVFNCVSDTIFILDIAVNFRTGIITNDFADEIILDPKIIARRYVKSWFILDLLSSIPMDYLFLVLNHGPDKNENYSQFFHAGRTLRIFRLAKLLSMLRLLRLSRLVRYVSQWEEKYLISTCDQGYLTFPQKFLNMASKFIGICKLVLLMLLLGHWNACLQFLIPMLMEYPAESWVIKCNLKDAYWFKQYTWALFKAMSHMLSIGYGRFPPTSISEAWITIVSMMTGATCYALFVGHAAAIIQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIANYYEHRYQGKMFDEEVILIELSECLREQIINYNCRALVAAVPFFTYAD 745          

HSP 2 Score: 181.03 bits (458), Expect = 0.000e+0
Identity = 83/105 (79.05%), Postives = 96/105 (91.43%), Query Frame = 2
Query: 1736 FVSEVVVKLHYEVFQPGDFIIKEGTVGSQMYFIQEGIVDIITKDGEIATSLSDGSYFGEICLLADTRRVASVRAVTYCNVYSLDRESFLSVLEHYPIMRRTMESV 2050
            FVSEVV KL +EV+QPGD IIKEGT+G++M+FIQEGIVDIITKDGE+ATSLSDGSYFGEICLL + +RVASVRA TYCN+YSLD E F +VLE+YP+MRRTMESV
Sbjct:  748 FVSEVVTKLKFEVYQPGDLIIKEGTIGTKMFFIQEGIVDIITKDGEVATSLSDGSYFGEICLLTNAKRVASVRAETYCNLYSLDAEHFQAVLENYPLMRRTMESV 852          
BLAST of Cyclic nucleotide gated channel 1 vs. Planmine SMEST
Match: SMESG000038402.1 (SMESG000038402.1)

HSP 1 Score: 565.459 bits (1456), Expect = 0.000e+0
Identity = 287/408 (70.34%), Postives = 343/408 (84.07%), Query Frame = 3
Query:  555 RLSASMYLKEQICSLFQPGDNKLAMKLFGTQSALLKEKSRQKKHGHWIIHPCSSFRFYWDLLMLMVLVANLIVLPVAISFFNDDLSKRWLVFNGVSDTIFLLDIGVNFRTGIILNDFADEIILNPKQIAKHYARSWFIIDFLSSIPVDYIFLILNNTNHFSQFMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYISQWEEFFNTASKFIGIFNLVLMMLLLGHWNACLQFLIPMMREFPNDCWIVKCNLKEANWFDQYTWSLFKAMSHMLSIGYGRFPPTSTSEAWVTIVSMMTGATCYALFVGHAAALIQSYDTSKRLYREKYKQVEEYMGYRKLPRLLRQKITDYYEHRYQGNMFNEIDILQELSECLREKVINYNCRGLVASVPFFKNADDILYRK*LSNFIMKSF 1778
            + S S YLKEQ  S FQP DNKLA+KLFG+++A+++EK RQ+K   WIIHPCSSFRFYWDL ML++L+ANLI+LPV +SFF D +  +W++FN  SDT+FL DI VNFRTGI+L D +DEIILNPK IA++Y RSWF +D +SSIP+DYIFL +N   ++  F++AG+ LRILRLAKLLS+LRLLRLSRLVRY+SQWEEF N ASKFIGI  LVL+MLLLGHWNAC+QFLIP++ EFP + W+VKC L+ + WF+QYTWSLFKAMSHMLSIGYGRFPPTS SEAW+TI+SMMTGATCYALFVGHAAALIQS+DTSKRLYREK+KQVEEYM YRKLPR LRQ+I +YYEHRYQG MFNE  IL EL+ECLRE+VINYNCR LVA+VPFF  AD     + +S  + + F
Sbjct:  170 KQSTSSYLKEQFLSFFQPSDNKLALKLFGSKNAVIQEKKRQQKEAKWIIHPCSSFRFYWDLFMLVMLIANLIILPVIVSFFTDSMRIQWVIFNCFSDTVFLADIAVNFRTGILLTDKSDEIILNPKIIARNYLRSWFFLDLISSIPLDYIFLAVNRGENYHHFVYAGKTLRILRLAKLLSMLRLLRLSRLVRYVSQWEEFLNIASKFIGICKLVLLMLLLGHWNACIQFLIPVLMEFPTESWVVKCKLQHSYWFEQYTWSLFKAMSHMLSIGYGRFPPTSISEAWITIISMMTGATCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMTYRKLPRALRQRIANYYEHRYQGKMFNEDQILTELNECLREQVINYNCRALVAAVPFFTYADQSFVSEVVSKLMYEVF 577          

HSP 2 Score: 176.407 bits (446), Expect = 3.619e-46
Identity = 81/105 (77.14%), Postives = 93/105 (88.57%), Query Frame = 2
Query: 1736 FVSEVVVKLHYEVFQPGDFIIKEGTVGSQMYFIQEGIVDIITKDGEIATSLSDGSYFGEICLLADTRRVASVRAVTYCNVYSLDRESFLSVLEHYPIMRRTMESV 2050
            FVSEVV KL YEVFQPGD IIKEGT+G++MYFIQEGIVDIITKDGE+ TSLSDGSYFGEICLL + +R A+VRA  YC++YSLD E F +VLE+YP+MRRTMESV
Sbjct:  564 FVSEVVSKLMYEVFQPGDLIIKEGTIGTKMYFIQEGIVDIITKDGEVVTSLSDGSYFGEICLLTNAKRCATVRAEVYCSLYSLDSEQFKAVLENYPLMRRTMESV 668          
BLAST of Cyclic nucleotide gated channel 1 vs. Planmine SMEST
Match: SMESG000001696.1 (SMESG000001696.1)

HSP 1 Score: 561.992 bits (1447), Expect = 0.000e+0
Identity = 290/392 (73.98%), Postives = 337/392 (85.97%), Query Frame = 3
Query:  555 RLSASMYLKEQICSLFQPGDNKLAMKLFGTQSALLKEKSRQKKHGHWIIHPCSSFRFYWDLLMLMVLVANLIVLPVAISFFNDDLSKRWLVFNGVSDTIFLLDIGVNFRTGIILNDFADEIILNPKQIAKHYARSWFIIDFLSSIPVDYIFLILNNTNHFSQFMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYISQWEEFFNTASKFIGIFNLVLMMLLLGHWNACLQFLIPMMREFPNDCWIVKCNLKEANWFDQYTWSLFKAMSHMLSIGYGRFPPTSTSEAWVTIVSMMTGATCYALFVGHAAALIQSYDTSKRLYREKYKQVEEYMGYRKLPRLLRQKITDYYEHRYQGNMFNEIDILQELSECLREKVINYNCRGLVASVPFFKNAD 1730
            +LS + YLKEQ  S FQP DNKLAMKLFG ++AL KEK RQ++ G WIIHPCS+FRFYWDL+ML++L+ANLI+LPVAISFFNDDLS  W+VFN  SDTIFLLDI VNFR+GII ++FADEIIL+P QI K+Y  SWF +D +SSIP+DYIFLI+N  + +SQF+HAGR LRIL+LAKLLS+LRLLRLSRLVRY+SQWEEF N A+KF+GI  LVLMMLLL HWNACLQ+LIP++ +FP D W+ KC L+ A WF QYTW+LFKA+SHMLSIGYGRFPPTS SEAW+T+ S++ G TCYALFVGHAAALIQS+DTSKRLYREK+KQVEEYM YRKLPR LRQ+I  YYEHRYQG MFNE  IL ELSECLRE++INYNCR LVASVPFF  AD
Sbjct:  196 KLSTTGYLKEQFFSFFQPADNKLAMKLFGNKNALNKEKRRQQQAGKWIIHPCSNFRFYWDLMMLILLIANLIILPVAISFFNDDLSLHWIVFNCASDTIFLLDIMVNFRSGIIADNFADEIILDPNQICKNYIHSWFFLDLISSIPMDYIFLIINRKDVYSQFVHAGRGLRILKLAKLLSILRLLRLSRLVRYVSQWEEFLNMANKFMGICKLVLMMLLLAHWNACLQYLIPVLNDFPADSWVTKCKLQHAYWFHQYTWALFKALSHMLSIGYGRFPPTSISEAWITVTSVLIGVTCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIDSYYEHRYQGKMFNEDLILSELSECLREQIINYNCRALVASVPFFTYAD 587          

HSP 2 Score: 183.726 bits (465), Expect = 0.000e+0
Identity = 86/105 (81.90%), Postives = 95/105 (90.48%), Query Frame = 2
Query: 1736 FVSEVVVKLHYEVFQPGDFIIKEGTVGSQMYFIQEGIVDIITKDGEIATSLSDGSYFGEICLLADTRRVASVRAVTYCNVYSLDRESFLSVLEHYPIMRRTMESV 2050
            FVSEVV KL +EVFQPGD IIKEGTVG++MYFIQEGIVDIITKDGE+ATSLSDGSYFGEICLL + +RVASVRA TYCN+YSLD   FL VLE+YP+MRRTMESV
Sbjct:  590 FVSEVVTKLKFEVFQPGDLIIKEGTVGTKMYFIQEGIVDIITKDGEVATSLSDGSYFGEICLLTNAKRVASVRAETYCNLYSLDSFHFLEVLENYPLMRRTMESV 694          
The following BLAST results are available for this feature:
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HCN12.905e-14452.73hyperpolarization activated cyclic nucleotide gate... [more]
HCN41.546e-14254.80hyperpolarization activated cyclic nucleotide gate... [more]
HCN14.079e-14252.73hyperpolarization activated cyclic nucleotide gate... [more]
HCN27.377e-14252.47hyperpolarization activated cyclic nucleotide gate... [more]
HCN33.927e-13652.86hyperpolarization activated cyclic nucleotide gate... [more]
back to top
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-1038.993e-3525.06Potassium voltage-gated channel unc-103 [Source:U... [more]
unc-1036.791e-3425.19Potassium voltage-gated channel unc-103 [Source:U... [more]
unc-1031.153e-3324.94Potassium voltage-gated channel unc-103 [Source:U... [more]
unc-1031.254e-3324.82Potassium voltage-gated channel unc-103 [Source:U... [more]
unc-1031.284e-3324.82Potassium voltage-gated channel unc-103 [Source:U... [more]
back to top
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ih0.000e+068.97gene:FBgn0263397 transcript:FBtr0100369[more]
Ih0.000e+068.53gene:FBgn0263397 transcript:FBtr0290109[more]
Ih0.000e+068.97gene:FBgn0263397 transcript:FBtr0308835[more]
Ih0.000e+068.97gene:FBgn0263397 transcript:FBtr0290292[more]
Ih0.000e+068.97gene:FBgn0263397 transcript:FBtr0308836[more]
back to top
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hcn2b5.298e-15957.18hyperpolarization activated cyclic nucleotide-gate... [more]
hcn2b1.222e-15757.18hyperpolarization activated cyclic nucleotide-gate... [more]
hcn43.425e-14555.82hyperpolarization activated cyclic nucleotide-gate... [more]
hcn4l1.511e-14355.48hyperpolarization activated cyclic nucleotide-gate... [more]
hcn11.990e-14254.16hyperpolarization activated cyclic nucleotide-gate... [more]
back to top
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000054880.11.796e-15858.21potassium/sodium hyperpolarization-activated cycli... [more]
ENSXETT00000054882.11.935e-15858.21potassium/sodium hyperpolarization-activated cycli... [more]
ENSXETT00000054879.11.439e-15758.21potassium/sodium hyperpolarization-activated cycli... [more]
ENSXETT00000054883.11.616e-15758.21potassium/sodium hyperpolarization-activated cycli... [more]
ENSXETT00000054881.13.447e-15758.21potassium/sodium hyperpolarization-activated cycli... [more]
back to top
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hcn21.463e-14354.31hyperpolarization-activated, cyclic nucleotide-gat... [more]
Hcn21.463e-14354.31hyperpolarization-activated, cyclic nucleotide-gat... [more]
Hcn44.119e-14254.80hyperpolarization-activated, cyclic nucleotide-gat... [more]
Hcn11.690e-14153.92hyperpolarization activated cyclic nucleotide gate... [more]
Hcn37.254e-13852.82hyperpolarization-activated, cyclic nucleotide-gat... [more]
back to top
BLAST of Cyclic nucleotide gated channel 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O88703|HCN2_MOUSE1.023e-14254.31Potassium/sodium hyperpolarization-activated cycli... [more]
sp|Q9JKA9|HCN2_RAT1.602e-14254.31Potassium/sodium hyperpolarization-activated cycli... [more]
sp|Q9TV66|HCN4_RABIT5.298e-14253.85Potassium/sodium hyperpolarization-activated cycli... [more]
sp|Q9MZS1|HCN1_RABIT7.065e-14253.92Potassium/sodium hyperpolarization-activated cycli... [more]
sp|Q9Y3Q4|HCN4_HUMAN7.422e-14254.80Potassium/sodium hyperpolarization-activated cycli... [more]
back to top
BLAST of Cyclic nucleotide gated channel 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267GGH40.000e+075.83Cyclic nucleotide-binding domain-containing protei... [more]
A0A267GPW90.000e+075.83Cyclic nucleotide-binding domain-containing protei... [more]
A0A4Z2DGN80.000e+074.49Potassium/sodium hyperpolarization-activated cycli... [more]
A0A158QHD62.934e-2068.68Cyclic nucleotide-binding domain-containing protei... [more]
A0A3Q0KVG70.000e+074.74Cyclic nucleotide-binding domain-containing protei... [more]
back to top
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hcn4l5.453e-16157.32potassium/sodium hyperpolarization-activated cycli... [more]
hcn4l6.439e-16157.32potassium/sodium hyperpolarization-activated cycli... [more]
hcn2b5.704e-16052.68potassium/sodium hyperpolarization-activated cycli... [more]
ENSAMXT00000011919.27.184e-15455.73pep primary_assembly:Astyanax_mexicanus-2.0:10:254... [more]
hcn2b1.939e-14550.52potassium/sodium hyperpolarization-activated cycli... [more]
back to top
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000007865.11.552e-8252.61pep scaffold:Pmarinus_7.0:GL480431:10244:18565:-1 ... [more]
ENSPMAT00000005594.11.455e-3426.52pep scaffold:Pmarinus_7.0:GL476331:707593:738342:1... [more]
kcnh1b8.709e-3124.34potassium voltage-gated channel, subfamily H (eag-... [more]
ENSPMAT00000005922.16.624e-2623.95pep scaffold:Pmarinus_7.0:GL476456:333240:381928:-... [more]
kcnh85.022e-2423.51potassium voltage-gated channel, subfamily H (eag-... [more]
back to top
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
BCY11.712e-1135.48Regulatory subunit of the cyclic AMP-dependent pro... [more]
back to top
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO490641.260e-13050.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO343163.873e-13052.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO353931.463e-3535.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO301401.251e-3427.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO353761.292e-3322.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000019258.21.151e-15957.07potassium/sodium hyperpolarization-activated cycli... [more]
ENSORLT00000045599.12.199e-15655.10potassium/sodium hyperpolarization-activated cycli... [more]
ENSORLT00000013376.23.280e-15655.10potassium/sodium hyperpolarization-activated cycli... [more]
ENSORLT00000019259.21.269e-15356.57potassium/sodium hyperpolarization-activated cycli... [more]
hcn36.708e-15054.59potassium/sodium hyperpolarization-activated cycli... [more]
back to top
BLAST of Cyclic nucleotide gated channel 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000020049.10.000e+078.83SMESG000020049.1[more]
SMESG000038954.10.000e+067.24SMESG000038954.1[more]
SMESG000038954.10.000e+064.86SMESG000038954.1[more]
SMESG000038402.13.619e-4670.34SMESG000038402.1[more]
SMESG000001696.10.000e+073.98SMESG000001696.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024524 ID=SMED30024524|Name=Cyclic nucleotide gated channel 1|organism=Schmidtea mediterranea sexual|type=transcript|length=2050bp
AGCGATGAAGTAAAGTGTATTCTCTATGATTAAAGCGAATTCAAAGTCAC
TCGAAAAACCAGCAAATTCATTTGTTTGCATTGAAGAACCGATAGGGAAC
ACAAAGCTTCTAAAACGACAAAATCATTTGGATTCCCTTGATTATCCGGA
TAGCGAAGATTCCAGTAGGATTTTTCTCAAAGTTCCTACTCTAACTGTCG
GTGAGTACAGTTCCGATACGTTGTACAAATGATCCTCTTGTTCAAAAGTC
AGACGAAATTTATTTAAAGCGACAAAAGTCCTTAAATTTGAATACGAATT
CTTTAAAAAGAAACAAAACTATATCTGGAATTCATTCTACGAAAACTGTC
AAAAAGCCGAAAGCCTCTGCCAATGATTTGAATCAATCTTTCAATTTGCT
TAATGTTAAAAACTTCGATTCAGCCTTTCACATGTTTAATCCATTGGATT
CATTTCGAGTGAACAAAACCCCTAAAGACAATGATGATGGGACGCAGAGT
GAACAAAGTCTCTCAGAATATATTGGAGGAGGTGCCCCAGGATATAGGCA
TCCTCGACTCAGTGCCTCGATGTATCTGAAAGAACAAATCTGTTCTTTAT
TTCAACCAGGTGATAATAAGTTAGCGATGAAGTTGTTTGGTACTCAAAGT
GCTTTATTGAAAGAGAAATCGAGACAGAAGAAACATGGTCATTGGATAAT
CCACCCATGCAGCAGTTTCAGGTTTTATTGGGATTTATTAATGTTGATGG
TATTGGTTGCCAATCTCATAGTATTGCCAGTAGCAATATCATTCTTTAAC
GATGACCTCAGCAAACGGTGGCTTGTCTTTAATGGAGTTTCAGATACTAT
TTTTTTATTAGATATAGGTGTCAATTTTAGAACAGGAATCATACTCAATG
ATTTCGCCGACGAGATCATTCTCAATCCAAAACAAATTGCCAAACATTAT
GCCCGATCTTGGTTCATAATAGATTTCCTTAGTTCAATTCCTGTAGACTA
TATTTTTCTCATTCTTAATAACACAAATCATTTCAGCCAATTTATGCATG
CAGGTAGAGCCTTACGTATACTGAGATTAGCAAAATTATTAAGTTTGCTA
AGATTATTAAGACTTTCTAGATTAGTTCGGTATATCAGCCAATGGGAAGA
ATTTTTCAACACAGCCAGCAAATTCATTGGAATATTCAATTTGGTTTTAA
TGATGCTTCTTCTTGGTCACTGGAATGCGTGCCTACAGTTTCTGATTCCG
ATGATGAGAGAATTTCCTAATGACTGTTGGATTGTCAAATGCAATTTAAA
AGAAGCGAATTGGTTTGATCAATATACTTGGTCTCTATTTAAAGCCATGT
CGCATATGCTCAGTATTGGATATGGAAGATTTCCGCCGACAAGTACGAGT
GAAGCGTGGGTTACAATCGTTAGTATGATGACCGGAGCGACTTGCTATGC
ACTTTTTGTGGGACATGCTGCTGCTCTGATCCAATCCTACGACACGTCGA
AACGACTGTACAGAGAAAAGTATAAACAAGTTGAAGAATATATGGGATAT
AGGAAATTGCCTCGTTTACTCAGGCAGAAAATCACAGATTACTATGAACA
TAGGTATCAAGGAAATATGTTCAATGAGATTGATATTTTACAAGAGCTTT
CAGAATGCCTCAGGGAGAAAGTAATCAATTACAATTGTCGTGGACTAGTA
GCGTCGGTTCCATTCTTTAAAAATGCCGATGATATTTTGTATCGGAAGTA
GTTGTCAAACTTCATTATGAAGTCTTTCAACCGGGAGATTTCATTATCAA
AGAAGGAACAGTCGGCTCACAAATGTATTTTATCCAAGAAGGAATTGTTG
ACATAATTACTAAAGACGGAGAGATAGCCACAAGTCTTTCTGACGGATCG
TACTTTGGAGAAATTTGTTTATTGGCTGACACGAGAAGAGTTGCAAGCGT
TCGAGCCGTTACATATTGTAATGTTTATTCTCTCGACAGAGAAAGCTTTC
TTTCAGTTTTGGAACATTATCCAATTATGCGTCGAACTATGGAAAGTGTT
back to top

protein sequence of SMED30024524-orf-1

>SMED30024524-orf-1 ID=SMED30024524-orf-1|Name=SMED30024524-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=440bp
MFNPLDSFRVNKTPKDNDDGTQSEQSLSEYIGGGAPGYRHPRLSASMYLK
EQICSLFQPGDNKLAMKLFGTQSALLKEKSRQKKHGHWIIHPCSSFRFYW
DLLMLMVLVANLIVLPVAISFFNDDLSKRWLVFNGVSDTIFLLDIGVNFR
TGIILNDFADEIILNPKQIAKHYARSWFIIDFLSSIPVDYIFLILNNTNH
FSQFMHAGRALRILRLAKLLSLLRLLRLSRLVRYISQWEEFFNTASKFIG
IFNLVLMMLLLGHWNACLQFLIPMMREFPNDCWIVKCNLKEANWFDQYTW
SLFKAMSHMLSIGYGRFPPTSTSEAWVTIVSMMTGATCYALFVGHAAALI
QSYDTSKRLYREKYKQVEEYMGYRKLPRLLRQKITDYYEHRYQGNMFNEI
DILQELSECLREKVINYNCRGLVASVPFFKNADDILYRK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR000595cNMP-bd_dom
IPR014710RmlC-like_jellyroll
IPR018488cNMP-bd_CS
IPR018490cNMP-bd-like
IPR005821Ion_trans_dom
IPR013621Ion_trans_N
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0006811ion transport
GO:0055085transmembrane transport
GO:0006810transport
GO:0006813potassium ion transport
GO:0034220ion transmembrane transport
GO:0071805potassium ion transmembrane transport
Vocabulary: molecular function
TermDefinition
GO:0005216ion channel activity
GO:0005249voltage-gated potassium channel activity