Ras-related protein

Overview
NameRas-related protein
Smed IDSMED30024514
Length (bp)781
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ras-related protein (SMED30024514) t-SNE clustered cells

Violin plots show distribution of expression levels for Ras-related protein (SMED30024514) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ras-related protein (SMED30024514) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ras-related protein (SMED30024514) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024514

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30024514SMESG000075044.1 dd_Smed_v4_8100_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30024514SMESG000075044.1 dd_Smed_v4_8100_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30024514SMESG000075044.1 dd_Smed_v6_8100_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30024514SMESG000075044.1 dd_Smed_v4_8100_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ras-related protein vs. Ensembl Human
Match: MRAS (muscle RAS oncogene homolog [Source:HGNC Symbol;Acc:HGNC:7227])

HSP 1 Score: 129.413 bits (324), Expect = 8.235e-37
Identity = 67/114 (58.77%), Postives = 92/114 (80.70%), Query Frame = 3
Query:  138 VSVLDTAGQDSFSAMRQQYMRKGDGFLVMFSITDRNSFQMVRHLYKDILRTKDKENFPVIIVGNKVDLXXXXXXXXXXXXXXXXXXNVQYMETSAKPPPVNVDNAFLEVVRLIR 479
            + VLDTAGQ+ FSAMR+QYMR GDGFL+++S+TD+ SF+ V   ++ ILR KD+E+FP+I+V NKVDL   RK+T E+ KE+A + N+ Y+ETSAK PP+NVD AF ++VR+IR
Sbjct:   63 LDVLDTAGQEEFSAMREQYMRTGDGFLIVYSVTDKASFEHVDRFHQLILRVKDRESFPMILVANKVDLMHLRKITREQGKEMATKHNIPYIETSAKDPPLNVDKAFHDLVRVIR 176          

HSP 2 Score: 43.8986 bits (102), Expect = 8.235e-37
Identity = 17/31 (54.84%), Postives = 23/31 (74.19%), Query Frame = 1
Query:    1 YFQRTFVEDYDPTIEDTYIQSKEFDGEWCDL 93
            +FQ+ FV DYDPTIED+Y++  E D +W  L
Sbjct:   33 FFQKIFVPDYDPTIEDSYLKHTEIDNQWAIL 63          
BLAST of Ras-related protein vs. Ensembl Human
Match: MRAS (muscle RAS oncogene homolog [Source:HGNC Symbol;Acc:HGNC:7227])

HSP 1 Score: 129.413 bits (324), Expect = 8.235e-37
Identity = 67/114 (58.77%), Postives = 92/114 (80.70%), Query Frame = 3
Query:  138 VSVLDTAGQDSFSAMRQQYMRKGDGFLVMFSITDRNSFQMVRHLYKDILRTKDKENFPVIIVGNKVDLXXXXXXXXXXXXXXXXXXNVQYMETSAKPPPVNVDNAFLEVVRLIR 479
            + VLDTAGQ+ FSAMR+QYMR GDGFL+++S+TD+ SF+ V   ++ ILR KD+E+FP+I+V NKVDL   RK+T E+ KE+A + N+ Y+ETSAK PP+NVD AF ++VR+IR
Sbjct:   63 LDVLDTAGQEEFSAMREQYMRTGDGFLIVYSVTDKASFEHVDRFHQLILRVKDRESFPMILVANKVDLMHLRKITREQGKEMATKHNIPYIETSAKDPPLNVDKAFHDLVRVIR 176          

HSP 2 Score: 43.8986 bits (102), Expect = 8.235e-37
Identity = 17/31 (54.84%), Postives = 23/31 (74.19%), Query Frame = 1
Query:    1 YFQRTFVEDYDPTIEDTYIQSKEFDGEWCDL 93
            +FQ+ FV DYDPTIED+Y++  E D +W  L
Sbjct:   33 FFQKIFVPDYDPTIEDSYLKHTEIDNQWAIL 63          
BLAST of Ras-related protein vs. Ensembl Human
Match: MRAS (muscle RAS oncogene homolog [Source:HGNC Symbol;Acc:HGNC:7227])

HSP 1 Score: 129.413 bits (324), Expect = 8.235e-37
Identity = 67/114 (58.77%), Postives = 92/114 (80.70%), Query Frame = 3
Query:  138 VSVLDTAGQDSFSAMRQQYMRKGDGFLVMFSITDRNSFQMVRHLYKDILRTKDKENFPVIIVGNKVDLXXXXXXXXXXXXXXXXXXNVQYMETSAKPPPVNVDNAFLEVVRLIR 479
            + VLDTAGQ+ FSAMR+QYMR GDGFL+++S+TD+ SF+ V   ++ ILR KD+E+FP+I+V NKVDL   RK+T E+ KE+A + N+ Y+ETSAK PP+NVD AF ++VR+IR
Sbjct:   63 LDVLDTAGQEEFSAMREQYMRTGDGFLIVYSVTDKASFEHVDRFHQLILRVKDRESFPMILVANKVDLMHLRKITREQGKEMATKHNIPYIETSAKDPPLNVDKAFHDLVRVIR 176          

HSP 2 Score: 43.8986 bits (102), Expect = 8.235e-37
Identity = 17/31 (54.84%), Postives = 23/31 (74.19%), Query Frame = 1
Query:    1 YFQRTFVEDYDPTIEDTYIQSKEFDGEWCDL 93
            +FQ+ FV DYDPTIED+Y++  E D +W  L
Sbjct:   33 FFQKIFVPDYDPTIEDSYLKHTEIDNQWAIL 63          
BLAST of Ras-related protein vs. Ensembl Human
Match: RRAS2 (RAS related 2 [Source:HGNC Symbol;Acc:HGNC:17271])

HSP 1 Score: 114.005 bits (284), Expect = 7.647e-31
Identity = 63/115 (54.78%), Postives = 89/115 (77.39%), Query Frame = 3
Query:  135 NVSVLDTAGQDSFSAMRQQYMRKGDGFLVMFSITDRNSFQMVRHLYKDILRTKDKENFPVIIVGNKVDLXXXXXXXXXXXXXXXXXXNVQYMETSAKPPPVNVDNAFLEVVRLIR 479
             + +LDTAGQ+ F AMR+QYMR G+GFL++FS+TDR SF+ +    + ILR KD++ FP+I++GNK DL  +R+VT+EE ++LA++L V YME SAK   +NVD AF E+VR+IR
Sbjct:   44 RLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILIGNKADLDHQRQVTQEEGQQLARQLKVTYMEASAK-IRMNVDQAFHELVRVIR 157          
BLAST of Ras-related protein vs. Ensembl Human
Match: RRAS2 (RAS related 2 [Source:HGNC Symbol;Acc:HGNC:17271])

HSP 1 Score: 113.235 bits (282), Expect = 1.372e-30
Identity = 63/114 (55.26%), Postives = 89/114 (78.07%), Query Frame = 3
Query:  138 VSVLDTAGQDSFSAMRQQYMRKGDGFLVMFSITDRNSFQMVRHLYKDILRTKDKENFPVIIVGNKVDLXXXXXXXXXXXXXXXXXXNVQYMETSAKPPPVNVDNAFLEVVRLIR 479
            + +LDTAGQ+ F AMR+QYMR G+GFL++FS+TDR SF+ +    + ILR KD++ FP+I++GNK DL  +R+VT+EE ++LA++L V YME SAK   +NVD AF E+VR+IR
Sbjct:   29 LDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILIGNKADLDHQRQVTQEEGQQLARQLKVTYMEASAK-IRMNVDQAFHELVRVIR 141          
BLAST of Ras-related protein vs. Ensembl Celegans
Match: ras-2 (GTP binding protein; R-RAS related [Source:UniProtKB/TrEMBL;Acc:G5EGA7])

HSP 1 Score: 122.479 bits (306), Expect = 2.040e-34
Identity = 65/112 (58.04%), Postives = 88/112 (78.57%), Query Frame = 3
Query:  144 VLDTAGQDSFSAMRQQYMRKGDGFLVMFSITDRNSFQMVRHLYKDILRTKDKENFPVIIVGNKVDLXXXXXXXXXXXXXXXXXXNVQYMETSAKPPPVNVDNAFLEVVRLIR 479
            VLDTAGQ+ FSAMR+QY+R G GFL++FS+T+R SF+    LY  +LR KD+  +PV++V NKVDL  +R V+E+E +ELA +L + Y+ETSAK PPVNVD AF E+VR++R
Sbjct:   69 VLDTAGQEEFSAMREQYIRGGRGFLLVFSVTERKSFEEAHKLYNQVLRVKDRSEYPVLLVANKVDLINQRVVSEQEGRELAAQLKLMYIETSAKEPPVNVDAAFHELVRIVR 180          

HSP 2 Score: 41.9726 bits (97), Expect = 2.040e-34
Identity = 18/29 (62.07%), Postives = 21/29 (72.41%), Query Frame = 1
Query:    1 YFQRTFVEDYDPTIEDTYIQSKEFDGEWC 87
            +FQ+ FV+ YDPTIED YIQ  E DG W 
Sbjct:   37 FFQKQFVDYYDPTIEDQYIQHCEIDGNWV 65          
BLAST of Ras-related protein vs. Ensembl Celegans
Match: ras-2 (GTP binding protein; R-RAS related [Source:UniProtKB/TrEMBL;Acc:G5EGA7])

HSP 1 Score: 122.479 bits (306), Expect = 2.040e-34
Identity = 65/112 (58.04%), Postives = 88/112 (78.57%), Query Frame = 3
Query:  144 VLDTAGQDSFSAMRQQYMRKGDGFLVMFSITDRNSFQMVRHLYKDILRTKDKENFPVIIVGNKVDLXXXXXXXXXXXXXXXXXXNVQYMETSAKPPPVNVDNAFLEVVRLIR 479
            VLDTAGQ+ FSAMR+QY+R G GFL++FS+T+R SF+    LY  +LR KD+  +PV++V NKVDL  +R V+E+E +ELA +L + Y+ETSAK PPVNVD AF E+VR++R
Sbjct:   69 VLDTAGQEEFSAMREQYIRGGRGFLLVFSVTERKSFEEAHKLYNQVLRVKDRSEYPVLLVANKVDLINQRVVSEQEGRELAAQLKLMYIETSAKEPPVNVDAAFHELVRIVR 180          

HSP 2 Score: 41.9726 bits (97), Expect = 2.040e-34
Identity = 18/29 (62.07%), Postives = 21/29 (72.41%), Query Frame = 1
Query:    1 YFQRTFVEDYDPTIEDTYIQSKEFDGEWC 87
            +FQ+ FV+ YDPTIED YIQ  E DG W 
Sbjct:   37 FFQKQFVDYYDPTIEDQYIQHCEIDGNWV 65          
BLAST of Ras-related protein vs. Ensembl Celegans
Match: ras-1 (GTP binding protein; R-RAS related; R-ras1 homolog [Source:UniProtKB/TrEMBL;Acc:G5EBK8])

HSP 1 Score: 117.472 bits (293), Expect = 4.327e-32
Identity = 63/117 (53.85%), Postives = 88/117 (75.21%), Query Frame = 3
Query:  129 LLNVSVLDTAGQDSFSAMRQQYMRKGDGFLVMFSITDRNSFQMVRHLYKDILRTKDKENFPVIIVGNKVDLXXXXXXXXXXXXXXXXXXNVQYMETSAKPPPVNVDNAFLEVVRLIR 479
            L  + +LDTAGQ+ FS MR+QY+R G GFL++F++TDRNSF+ V+ L++ I R KD+++FP+I+VGNK DL  ER V   EA+ELA  L++ Y+E SAK    NVD AF ++VRL+R
Sbjct:   64 LCKLEILDTAGQEEFSTMREQYLRTGSGFLIVFAVTDRNSFEEVKKLHELICRIKDRDDFPIILVGNKADLENERHVARHEAEELAHRLSIPYLECSAKIRK-NVDEAFFDIVRLVR 179          
BLAST of Ras-related protein vs. Ensembl Celegans
Match: let-60 (Ras protein let-60 [Source:UniProtKB/Swiss-Prot;Acc:P22981])

HSP 1 Score: 83.5741 bits (205), Expect = 1.033e-21
Identity = 50/114 (43.86%), Postives = 73/114 (64.04%), Query Frame = 3
Query:  138 VSVLDTAGQDSFSAMRQQYMRKGDGFLVMFSITDRNSFQMVRHLYKDILRTKDKENFPVIIVGNKVDLXXXXXXXXXXXXXXXXXXNVQYMETSAKPPPVNVDNAFLEVVRLIR 479
            + +LDTAGQ+ +SAMR QYMR G+GFL++F++ +  SF+ V +  + I R KD ++ P+++VGNK DL   R V      E AK   +  ++TSAK   + VD AF  +VR IR
Sbjct:   53 LDILDTAGQEEYSAMRDQYMRTGEGFLLVFAVNEAKSFENVANYREQIRRVKDSDDVPMVLVGNKCDL-SSRSVDFRTVSETAKGYGIPNVDTSAK-TRMGVDEAFYTLVREIR 164          

HSP 2 Score: 37.7354 bits (86), Expect = 1.033e-21
Identity = 19/37 (51.35%), Postives = 24/37 (64.86%), Query Frame = 1
Query:    4 FQRTFVEDYDPTIEDTYIQSKEFDGEWCDLTGLVDML 114
             Q  FVE+YDPTIED+Y +    DGE C    L+D+L
Sbjct:   24 IQNHFVEEYDPTIEDSYRKQVVIDGETC----LLDIL 56          
BLAST of Ras-related protein vs. Ensembl Celegans
Match: rap-1 (Ras-related protein Rap-1 [Source:UniProtKB/Swiss-Prot;Acc:Q18246])

HSP 1 Score: 80.4925 bits (197), Expect = 3.939e-21
Identity = 48/113 (42.48%), Postives = 76/113 (67.26%), Query Frame = 3
Query:  138 VSVLDTAGQDSFSAMRQQYMRKGDGFLVMFSITDRNSFQMVRHLYKDILRTKDKENFPVIIVGNKVDLXXXXXXXXXXXXXXXXXXNVQYMETSAKPPPVNVDNAFLEVVRLI 476
            + +LDTAG + F+AMR  YM+ G GF++++SIT +++F  +  L   ILR KD +  P+I+VGNK DL +ER V +++ + LA++    ++ETSAK   +NV   F ++VR I
Sbjct:   53 LEILDTAGTEQFTAMRDLYMKNGQGFVLVYSITAQSTFNDLMDLRDQILRVKDTDEVPMILVGNKCDLEDERVVGKDQGQNLARQFGSAFLETSAK-AKINVSEVFYDLVRQI 164          

HSP 2 Score: 39.2762 bits (90), Expect = 3.939e-21
Identity = 17/31 (54.84%), Postives = 21/31 (67.74%), Query Frame = 1
Query:    1 YFQRTFVEDYDPTIEDTYIQSKEFDGEWCDL 93
            + Q  FVE YDPTIED+Y +  E DG+ C L
Sbjct:   23 FVQGIFVEKYDPTIEDSYRKQVEVDGQQCML 53          
BLAST of Ras-related protein vs. Ensembl Fly
Match: Ras64B (gene:FBgn0003206 transcript:FBtr0073212)

HSP 1 Score: 105.916 bits (263), Expect = 7.681e-28
Identity = 58/125 (46.40%), Postives = 89/125 (71.20%), Query Frame = 3
Query:  138 VSVLDTAGQDSFSAMRQQYMRKGDGFLVMFSITDRNSFQMVRHLYKDILRTKDKENFPVIIVGNKVDLXXXXXXXXXXXXXXXXXXNVQYMETSAKPPPVNVDNAFLEVVRLIRFILISIKILAE 512
            + +LDTAGQ+ FSAMR+QYMR G+GFL++F++ D +SF  +    + ILR KD++ FP+++VGNK DL  +++V+ EEA+  ++ L + Y+E SAK   VNVD AF E+VR++R   I+ +   E
Sbjct:   55 LDILDTAGQEEFSAMREQYMRSGEGFLLVFALNDHSSFDEIPKFQRQILRVKDRDEFPMLMVGNKCDLKHQQQVSLEEAQNTSRNLMIPYIECSAK-LRVNVDQAFHELVRIVRKFQIAERPFIE 178          
BLAST of Ras-related protein vs. Ensembl Fly
Match: Rap1 (gene:FBgn0004636 transcript:FBtr0303154)

HSP 1 Score: 89.3521 bits (220), Expect = 2.026e-23
Identity = 53/113 (46.90%), Postives = 80/113 (70.80%), Query Frame = 3
Query:  138 VSVLDTAGQDSFSAMRQQYMRKGDGFLVMFSITDRNSFQMVRHLYKDILRTKDKENFPVIIVGNKVDLXXXXXXXXXXXXXXXXXXNVQYMETSAKPPPVNVDNAFLEVVRLI 476
            + +LDTAG + F+AMR  YM+ G GF++++SIT +++F  ++ L + ILR KD ++ P+++VGNK DL EER V +E  K LA + N  +METSAK   VNV++ F ++VR I
Sbjct:   53 LEILDTAGTEQFTAMRDLYMKNGQGFVLVYSITAQSTFNDLQDLREQILRVKDTDDVPMVLVGNKCDLEEERVVGKELGKNLATQFNCAFMETSAK-AKVNVNDIFYDLVRQI 164          

HSP 2 Score: 38.5058 bits (88), Expect = 2.026e-23
Identity = 17/31 (54.84%), Postives = 21/31 (67.74%), Query Frame = 1
Query:    1 YFQRTFVEDYDPTIEDTYIQSKEFDGEWCDL 93
            + Q  FVE YDPTIED+Y +  E DG+ C L
Sbjct:   23 FVQCIFVEKYDPTIEDSYRKQVEVDGQQCML 53          
BLAST of Ras-related protein vs. Ensembl Fly
Match: Rap1 (gene:FBgn0004636 transcript:FBtr0072867)

HSP 1 Score: 89.3521 bits (220), Expect = 2.026e-23
Identity = 53/113 (46.90%), Postives = 80/113 (70.80%), Query Frame = 3
Query:  138 VSVLDTAGQDSFSAMRQQYMRKGDGFLVMFSITDRNSFQMVRHLYKDILRTKDKENFPVIIVGNKVDLXXXXXXXXXXXXXXXXXXNVQYMETSAKPPPVNVDNAFLEVVRLI 476
            + +LDTAG + F+AMR  YM+ G GF++++SIT +++F  ++ L + ILR KD ++ P+++VGNK DL EER V +E  K LA + N  +METSAK   VNV++ F ++VR I
Sbjct:   53 LEILDTAGTEQFTAMRDLYMKNGQGFVLVYSITAQSTFNDLQDLREQILRVKDTDDVPMVLVGNKCDLEEERVVGKELGKNLATQFNCAFMETSAK-AKVNVNDIFYDLVRQI 164          

HSP 2 Score: 38.5058 bits (88), Expect = 2.026e-23
Identity = 17/31 (54.84%), Postives = 21/31 (67.74%), Query Frame = 1
Query:    1 YFQRTFVEDYDPTIEDTYIQSKEFDGEWCDL 93
            + Q  FVE YDPTIED+Y +  E DG+ C L
Sbjct:   23 FVQCIFVEKYDPTIEDSYRKQVEVDGQQCML 53          
BLAST of Ras-related protein vs. Ensembl Fly
Match: Rap1 (gene:FBgn0004636 transcript:FBtr0332671)

HSP 1 Score: 89.3521 bits (220), Expect = 2.026e-23
Identity = 53/113 (46.90%), Postives = 80/113 (70.80%), Query Frame = 3
Query:  138 VSVLDTAGQDSFSAMRQQYMRKGDGFLVMFSITDRNSFQMVRHLYKDILRTKDKENFPVIIVGNKVDLXXXXXXXXXXXXXXXXXXNVQYMETSAKPPPVNVDNAFLEVVRLI 476
            + +LDTAG + F+AMR  YM+ G GF++++SIT +++F  ++ L + ILR KD ++ P+++VGNK DL EER V +E  K LA + N  +METSAK   VNV++ F ++VR I
Sbjct:   53 LEILDTAGTEQFTAMRDLYMKNGQGFVLVYSITAQSTFNDLQDLREQILRVKDTDDVPMVLVGNKCDLEEERVVGKELGKNLATQFNCAFMETSAK-AKVNVNDIFYDLVRQI 164          

HSP 2 Score: 38.5058 bits (88), Expect = 2.026e-23
Identity = 17/31 (54.84%), Postives = 21/31 (67.74%), Query Frame = 1
Query:    1 YFQRTFVEDYDPTIEDTYIQSKEFDGEWCDL 93
            + Q  FVE YDPTIED+Y +  E DG+ C L
Sbjct:   23 FVQCIFVEKYDPTIEDSYRKQVEVDGQQCML 53          
BLAST of Ras-related protein vs. Ensembl Fly
Match: Rala (gene:FBgn0015286 transcript:FBtr0070583)

HSP 1 Score: 94.3597 bits (233), Expect = 3.031e-23
Identity = 53/116 (45.69%), Postives = 77/116 (66.38%), Query Frame = 3
Query:  132 LNVSVLDTAGQDSFSAMRQQYMRKGDGFLVMFSITDRNSFQMVRHLYKDILRTKDKENFPVIIVGNKVDLXXXXXXXXXXXXXXXXXXNVQYMETSAKPPPVNVDNAFLEVVRLIR 479
            + + +LDTAGQ+ ++A+R  Y R G+GFL +FSITD  SFQ  +   + ILR K+ E+ P ++VGNK DL ++RKV   E +  A++  V Y+ETSAK    NVD  F +++R IR
Sbjct:   59 VQIDILDTAGQEDYAAIRDNYFRSGEGFLCVFSITDDESFQATQEFREQILRVKNDESIPFLLVGNKCDLNDKRKVPLSECQLRAQQWAVPYVETSAKTRE-NVDKVFFDLMREIR 173          
BLAST of Ras-related protein vs. Ensembl Zebrafish
Match: si:ch73-116o1.2 (si:ch73-116o1.2 [Source:ZFIN;Acc:ZDB-GENE-110411-67])

HSP 1 Score: 129.798 bits (325), Expect = 6.960e-38
Identity = 67/114 (58.77%), Postives = 91/114 (79.82%), Query Frame = 3
Query:  138 VSVLDTAGQDSFSAMRQQYMRKGDGFLVMFSITDRNSFQMVRHLYKDILRTKDKENFPVIIVGNKVDLXXXXXXXXXXXXXXXXXXNVQYMETSAKPPPVNVDNAFLEVVRLIR 479
            + VLDTAGQ+ FSAMR+QYMR GDGFL++FS+TD+ SF+ V   ++ ILR KD+E+FP+++V NKVDL   RKVT E+  E+A + N+ Y+ETSAK PP+NV+ AF E+VR+IR
Sbjct:   63 LDVLDTAGQEEFSAMREQYMRTGDGFLIVFSVTDKASFEHVDRFHQLILRVKDRESFPMVLVANKVDLVHLRKVTNEQGCEMAAKHNITYIETSAKDPPMNVERAFHELVRVIR 176          

HSP 2 Score: 46.595 bits (109), Expect = 6.960e-38
Identity = 18/31 (58.06%), Postives = 24/31 (77.42%), Query Frame = 1
Query:    1 YFQRTFVEDYDPTIEDTYIQSKEFDGEWCDL 93
            +FQ+ FV DYDPTIED+Y++  E DG+W  L
Sbjct:   33 FFQKIFVPDYDPTIEDSYLKHTEIDGQWAIL 63          
BLAST of Ras-related protein vs. Ensembl Zebrafish
Match: MRAS (si:ch73-116o1.2 [Source:ZFIN;Acc:ZDB-GENE-110411-67])

HSP 1 Score: 129.798 bits (325), Expect = 6.960e-38
Identity = 67/114 (58.77%), Postives = 91/114 (79.82%), Query Frame = 3
Query:  138 VSVLDTAGQDSFSAMRQQYMRKGDGFLVMFSITDRNSFQMVRHLYKDILRTKDKENFPVIIVGNKVDLXXXXXXXXXXXXXXXXXXNVQYMETSAKPPPVNVDNAFLEVVRLIR 479
            + VLDTAGQ+ FSAMR+QYMR GDGFL++FS+TD+ SF+ V   ++ ILR KD+E+FP+++V NKVDL   RKVT E+  E+A + N+ Y+ETSAK PP+NV+ AF E+VR+IR
Sbjct:   63 LDVLDTAGQEEFSAMREQYMRTGDGFLIVFSVTDKASFEHVDRFHQLILRVKDRESFPMVLVANKVDLVHLRKVTNEQGCEMAAKHNITYIETSAKDPPMNVERAFHELVRVIR 176          

HSP 2 Score: 46.595 bits (109), Expect = 6.960e-38
Identity = 18/31 (58.06%), Postives = 24/31 (77.42%), Query Frame = 1
Query:    1 YFQRTFVEDYDPTIEDTYIQSKEFDGEWCDL 93
            +FQ+ FV DYDPTIED+Y++  E DG+W  L
Sbjct:   33 FFQKIFVPDYDPTIEDSYLKHTEIDGQWAIL 63          
BLAST of Ras-related protein vs. Ensembl Zebrafish
Match: mras (muscle RAS oncogene homolog [Source:ZFIN;Acc:ZDB-GENE-050208-495])

HSP 1 Score: 129.798 bits (325), Expect = 7.435e-38
Identity = 66/114 (57.89%), Postives = 92/114 (80.70%), Query Frame = 3
Query:  138 VSVLDTAGQDSFSAMRQQYMRKGDGFLVMFSITDRNSFQMVRHLYKDILRTKDKENFPVIIVGNKVDLXXXXXXXXXXXXXXXXXXNVQYMETSAKPPPVNVDNAFLEVVRLIR 479
            + VLDTAGQ+ FSAMR+QYMR GDGFL++FS+TD+ SF+ V   ++ ILR KD+E+FP+++V NKVDL   RK+T E+ +E+A + ++ Y+ETSAK PP+NVD AF E+VR+IR
Sbjct:   64 LDVLDTAGQEEFSAMREQYMRTGDGFLIVFSVTDKASFEHVDRFHQLILRVKDRESFPMVLVANKVDLVHLRKITSEQGREMASKHSITYIETSAKDPPMNVDKAFHELVRVIR 177          

HSP 2 Score: 46.9802 bits (110), Expect = 7.435e-38
Identity = 18/31 (58.06%), Postives = 24/31 (77.42%), Query Frame = 1
Query:    1 YFQRTFVEDYDPTIEDTYIQSKEFDGEWCDL 93
            +FQ+ FV DYDPTIED+Y++  E DG+W  L
Sbjct:   34 FFQKIFVPDYDPTIEDSYLKHTEIDGQWAIL 64          
BLAST of Ras-related protein vs. Ensembl Zebrafish
Match: mras (muscle RAS oncogene homolog [Source:ZFIN;Acc:ZDB-GENE-050208-495])

HSP 1 Score: 129.798 bits (325), Expect = 7.454e-38
Identity = 66/114 (57.89%), Postives = 92/114 (80.70%), Query Frame = 3
Query:  138 VSVLDTAGQDSFSAMRQQYMRKGDGFLVMFSITDRNSFQMVRHLYKDILRTKDKENFPVIIVGNKVDLXXXXXXXXXXXXXXXXXXNVQYMETSAKPPPVNVDNAFLEVVRLIR 479
            + VLDTAGQ+ FSAMR+QYMR GDGFL++FS+TD+ SF+ V   ++ ILR KD+E+FP+++V NKVDL   RK+T E+ +E+A + ++ Y+ETSAK PP+NVD AF E+VR+IR
Sbjct:   39 LDVLDTAGQEEFSAMREQYMRTGDGFLIVFSVTDKASFEHVDRFHQLILRVKDRESFPMVLVANKVDLVHLRKITSEQGREMASKHSITYIETSAKDPPMNVDKAFHELVRVIR 152          

HSP 2 Score: 46.595 bits (109), Expect = 7.454e-38
Identity = 18/31 (58.06%), Postives = 24/31 (77.42%), Query Frame = 1
Query:    1 YFQRTFVEDYDPTIEDTYIQSKEFDGEWCDL 93
            +FQ+ FV DYDPTIED+Y++  E DG+W  L
Sbjct:    9 FFQKIFVPDYDPTIEDSYLKHTEIDGQWAIL 39          
BLAST of Ras-related protein vs. Ensembl Zebrafish
Match: rras2 (RAS related 2 [Source:ZFIN;Acc:ZDB-GENE-050417-352])

HSP 1 Score: 114.775 bits (286), Expect = 5.265e-31
Identity = 64/115 (55.65%), Postives = 90/115 (78.26%), Query Frame = 3
Query:  135 NVSVLDTAGQDSFSAMRQQYMRKGDGFLVMFSITDRNSFQMVRHLYKDILRTKDKENFPVIIVGNKVDLXXXXXXXXXXXXXXXXXXNVQYMETSAKPPPVNVDNAFLEVVRLIR 479
             + +LDTAGQ+ F AMR+QYMR G+GFL++FS+TDR SF+ +    + ILR KD++ FP+I+VGNK DL ++R+VT+EE ++LA++L V YME SAK   +NVD AF E+VR+IR
Sbjct:   61 RLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILVGNKADLEQQRQVTQEEGQQLARQLKVTYMEASAK-IRMNVDQAFHELVRVIR 174          
BLAST of Ras-related protein vs. Ensembl Xenopus
Match: thbs3 (thrombospondin 3 [Source:Xenbase;Acc:XB-GENE-5761978])

HSP 1 Score: 129.798 bits (325), Expect = 1.084e-37
Identity = 68/114 (59.65%), Postives = 91/114 (79.82%), Query Frame = 3
Query:  138 VSVLDTAGQDSFSAMRQQYMRKGDGFLVMFSITDRNSFQMVRHLYKDILRTKDKENFPVIIVGNKVDLXXXXXXXXXXXXXXXXXXNVQYMETSAKPPPVNVDNAFLEVVRLIR 479
            + VLDTAGQ+ FSAMR+QYMR GDGFL+++S+TD+ SF+ V   ++ ILR KD+E+FP+I+V NKVDL   RKV+ E+ KE+A + N+ Y+ETSAK PP NVD AF E+VR+IR
Sbjct:   63 LDVLDTAGQEEFSAMREQYMRTGDGFLIVYSVTDKASFEHVDRFHQLILRVKDRESFPMILVANKVDLIHLRKVSSEQGKEMATKHNIPYIETSAKDPPQNVDKAFHELVRVIR 176          

HSP 2 Score: 46.595 bits (109), Expect = 1.084e-37
Identity = 18/31 (58.06%), Postives = 24/31 (77.42%), Query Frame = 1
Query:    1 YFQRTFVEDYDPTIEDTYIQSKEFDGEWCDL 93
            +FQ+ FV DYDPTIED+Y++  E DG+W  L
Sbjct:   33 FFQKIFVPDYDPTIEDSYLKHTEIDGQWAIL 63          
BLAST of Ras-related protein vs. Ensembl Xenopus
Match: tle1 (transducin like enhancer of split 1 [Source:Xenbase;Acc:XB-GENE-868100])

HSP 1 Score: 108.612 bits (270), Expect = 2.007e-28
Identity = 61/114 (53.51%), Postives = 84/114 (73.68%), Query Frame = 3
Query:  138 VSVLDTAGQDSFSAMRQQYMRKGDGFLVMFSITDRNSFQMVRHLYKDILRTKDKENFPVIIVGNKVDLXXXXXXXXXXXXXXXXXXNVQYMETSAKPPPVNVDNAFLEVVRLIR 479
            + +LDTAGQ+ F AMR+QYMR G+GFL++F+I DR SF  +   +  ILR KD++ FP+I+VGNK DL  +R+VT+EEA   A+E ++ YME SAK   +NVD +F E+VR IR
Sbjct:   63 LDILDTAGQEEFGAMREQYMRTGEGFLLIFAINDRGSFNEMSKFHTQILRVKDRDEFPMILVGNKADLDLQRQVTKEEALSFARENHIPYMEASAK-IRLNVDESFHELVRAIR 175          
BLAST of Ras-related protein vs. Ensembl Xenopus
Match: rpp38 (ribonuclease P/MRP 38kDa subunit [Source:Xenbase;Acc:XB-GENE-943258])

HSP 1 Score: 95.9005 bits (237), Expect = 1.350e-23
Identity = 55/116 (47.41%), Postives = 79/116 (68.10%), Query Frame = 3
Query:  132 LNVSVLDTAGQDSFSAMRQQYMRKGDGFLVMFSITDRNSFQMVRHLYKDILRTKDKENFPVIIVGNKVDLXXXXXXXXXXXXXXXXXXNVQYMETSAKPPPVNVDNAFLEVVRLIR 479
            + + +LDTAGQ+ ++A+R  Y R G+GFL +FSIT++ SF       + ILR K+ EN P ++VGNK DL ++R+V+ EEAK  A + NV Y+ETSAK    NVD  F +++R IR
Sbjct:   62 VQIDILDTAGQEDYAAIRDNYFRSGEGFLCVFSITEQESFAATADFREQILRVKEDENVPFLLVGNKSDLEDKRQVSVEEAKSRADQWNVNYVETSAK-TRANVDKVFFDLMREIR 176          
BLAST of Ras-related protein vs. Ensembl Xenopus
Match: krasl (Kirsten rat sarcoma viral oncogene homolog like [Source:NCBI gene;Acc:100485959])

HSP 1 Score: 92.8189 bits (229), Expect = 2.040e-23
Identity = 53/114 (46.49%), Postives = 78/114 (68.42%), Query Frame = 3
Query:  138 VSVLDTAGQDSFSAMRQQYMRKGDGFLVMFSITDRNSFQMVRHLYKDILRTKDKENFPVIIVGNKVDLXXXXXXXXXXXXXXXXXXNVQYMETSAKPPPVNVDNAFLEVVRLIR 479
            + +LDTAGQ+ +SAMR QYMR G+GFL +F+I +  SF+ + H  + I R KD E+ P+++VGNK DL   R V  ++A++LA+   + ++ETSAK     VD+AF  +VR IR
Sbjct:   53 LDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL-PSRTVDTKQAQDLARSYGIPFIETSAKTRQ-GVDDAFYTLVREIR 164          

HSP 2 Score: 35.8094 bits (81), Expect = 2.040e-23
Identity = 18/37 (48.65%), Postives = 24/37 (64.86%), Query Frame = 1
Query:    4 FQRTFVEDYDPTIEDTYIQSKEFDGEWCDLTGLVDML 114
             Q  FV++YDPTIED+Y +    DGE C    L+D+L
Sbjct:   24 IQNHFVDEYDPTIEDSYRKQVVIDGETC----LLDIL 56          
BLAST of Ras-related protein vs. Ensembl Xenopus
Match: krasl (Kirsten rat sarcoma viral oncogene homolog like [Source:NCBI gene;Acc:100485959])

HSP 1 Score: 90.5077 bits (223), Expect = 9.036e-23
Identity = 52/114 (45.61%), Postives = 78/114 (68.42%), Query Frame = 3
Query:  138 VSVLDTAGQDSFSAMRQQYMRKGDGFLVMFSITDRNSFQMVRHLYKDILRTKDKENFPVIIVGNKVDLXXXXXXXXXXXXXXXXXXNVQYMETSAKPPPVNVDNAFLEVVRLIR 479
            + +LDTAGQ+ +SAMR QYMR G+GFL +F+I +  SF+ + H  + I R KD E+ P+++VGNK DL   R V  ++A++LA+   + ++ETSAK     V++AF  +VR IR
Sbjct:   53 LDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL-PSRTVDTKQAQDLARSYGIPFIETSAKTRQ-RVEDAFYTLVREIR 164          

HSP 2 Score: 35.8094 bits (81), Expect = 9.036e-23
Identity = 18/37 (48.65%), Postives = 24/37 (64.86%), Query Frame = 1
Query:    4 FQRTFVEDYDPTIEDTYIQSKEFDGEWCDLTGLVDML 114
             Q  FV++YDPTIED+Y +    DGE C    L+D+L
Sbjct:   24 IQNHFVDEYDPTIEDSYRKQVVIDGETC----LLDIL 56          
BLAST of Ras-related protein vs. Ensembl Mouse
Match: Mras (muscle and microspikes RAS [Source:MGI Symbol;Acc:MGI:1100856])

HSP 1 Score: 127.102 bits (318), Expect = 3.452e-36
Identity = 66/114 (57.89%), Postives = 91/114 (79.82%), Query Frame = 3
Query:  138 VSVLDTAGQDSFSAMRQQYMRKGDGFLVMFSITDRNSFQMVRHLYKDILRTKDKENFPVIIVGNKVDLXXXXXXXXXXXXXXXXXXNVQYMETSAKPPPVNVDNAFLEVVRLIR 479
            + VLDTAGQ+ FSAMR+QYMR GDGFL+++S+TD+ SF+ V   ++ ILR KD+E+FP+I+V NKVDL   RKVT ++ KE+A + N+ Y+ETSAK PP+NVD  F ++VR+IR
Sbjct:   63 LDVLDTAGQEEFSAMREQYMRTGDGFLIVYSVTDKASFEHVDRFHQLILRVKDRESFPMILVANKVDLMHLRKVTRDQGKEMATKYNIPYIETSAKDPPLNVDKTFHDLVRVIR 176          

HSP 2 Score: 43.8986 bits (102), Expect = 3.452e-36
Identity = 17/31 (54.84%), Postives = 23/31 (74.19%), Query Frame = 1
Query:    1 YFQRTFVEDYDPTIEDTYIQSKEFDGEWCDL 93
            +FQ+ FV DYDPTIED+Y++  E D +W  L
Sbjct:   33 FFQKIFVPDYDPTIEDSYLKHTEIDNQWAIL 63          
BLAST of Ras-related protein vs. Ensembl Mouse
Match: Mras (muscle and microspikes RAS [Source:MGI Symbol;Acc:MGI:1100856])

HSP 1 Score: 127.102 bits (318), Expect = 3.452e-36
Identity = 66/114 (57.89%), Postives = 91/114 (79.82%), Query Frame = 3
Query:  138 VSVLDTAGQDSFSAMRQQYMRKGDGFLVMFSITDRNSFQMVRHLYKDILRTKDKENFPVIIVGNKVDLXXXXXXXXXXXXXXXXXXNVQYMETSAKPPPVNVDNAFLEVVRLIR 479
            + VLDTAGQ+ FSAMR+QYMR GDGFL+++S+TD+ SF+ V   ++ ILR KD+E+FP+I+V NKVDL   RKVT ++ KE+A + N+ Y+ETSAK PP+NVD  F ++VR+IR
Sbjct:   63 LDVLDTAGQEEFSAMREQYMRTGDGFLIVYSVTDKASFEHVDRFHQLILRVKDRESFPMILVANKVDLMHLRKVTRDQGKEMATKYNIPYIETSAKDPPLNVDKTFHDLVRVIR 176          

HSP 2 Score: 43.8986 bits (102), Expect = 3.452e-36
Identity = 17/31 (54.84%), Postives = 23/31 (74.19%), Query Frame = 1
Query:    1 YFQRTFVEDYDPTIEDTYIQSKEFDGEWCDL 93
            +FQ+ FV DYDPTIED+Y++  E D +W  L
Sbjct:   33 FFQKIFVPDYDPTIEDSYLKHTEIDNQWAIL 63          
BLAST of Ras-related protein vs. Ensembl Mouse
Match: Mras (muscle and microspikes RAS [Source:MGI Symbol;Acc:MGI:1100856])

HSP 1 Score: 127.102 bits (318), Expect = 3.452e-36
Identity = 66/114 (57.89%), Postives = 91/114 (79.82%), Query Frame = 3
Query:  138 VSVLDTAGQDSFSAMRQQYMRKGDGFLVMFSITDRNSFQMVRHLYKDILRTKDKENFPVIIVGNKVDLXXXXXXXXXXXXXXXXXXNVQYMETSAKPPPVNVDNAFLEVVRLIR 479
            + VLDTAGQ+ FSAMR+QYMR GDGFL+++S+TD+ SF+ V   ++ ILR KD+E+FP+I+V NKVDL   RKVT ++ KE+A + N+ Y+ETSAK PP+NVD  F ++VR+IR
Sbjct:   63 LDVLDTAGQEEFSAMREQYMRTGDGFLIVYSVTDKASFEHVDRFHQLILRVKDRESFPMILVANKVDLMHLRKVTRDQGKEMATKYNIPYIETSAKDPPLNVDKTFHDLVRVIR 176          

HSP 2 Score: 43.8986 bits (102), Expect = 3.452e-36
Identity = 17/31 (54.84%), Postives = 23/31 (74.19%), Query Frame = 1
Query:    1 YFQRTFVEDYDPTIEDTYIQSKEFDGEWCDL 93
            +FQ+ FV DYDPTIED+Y++  E D +W  L
Sbjct:   33 FFQKIFVPDYDPTIEDSYLKHTEIDNQWAIL 63          
BLAST of Ras-related protein vs. Ensembl Mouse
Match: Rras2 (related RAS viral (r-ras) oncogene 2 [Source:MGI Symbol;Acc:MGI:1914172])

HSP 1 Score: 113.62 bits (283), Expect = 1.696e-30
Identity = 63/115 (54.78%), Postives = 89/115 (77.39%), Query Frame = 3
Query:  135 NVSVLDTAGQDSFSAMRQQYMRKGDGFLVMFSITDRNSFQMVRHLYKDILRTKDKENFPVIIVGNKVDLXXXXXXXXXXXXXXXXXXNVQYMETSAKPPPVNVDNAFLEVVRLIR 479
             + +LDTAGQ+ F AMR+QYMR G+GFL++FS+TDR SF+ +    + ILR KD++ FP+I++GNK DL  +R+VT+EE ++LA++L V YME SAK   +NVD AF E+VR+IR
Sbjct:   63 RLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILIGNKADLDHQRQVTQEEGQQLARQLKVTYMEASAK-IRMNVDQAFHELVRVIR 176          
BLAST of Ras-related protein vs. Ensembl Mouse
Match: Rras (related RAS viral (r-ras) oncogene [Source:MGI Symbol;Acc:MGI:98179])

HSP 1 Score: 107.842 bits (268), Expect = 4.226e-28
Identity = 56/114 (49.12%), Postives = 80/114 (70.18%), Query Frame = 3
Query:  138 VSVLDTAGQDSFSAMRQQYMRKGDGFLVMFSITDRNSFQMVRHLYKDILRTKDKENFPVIIVGNKVDLXXXXXXXXXXXXXXXXXXNVQYMETSAKPPPVNVDNAFLEVVRLIR 479
            + +LDTAGQ+ F AMR+QYMR G+GFL++F+I DR SF  V  L+  ILR KD+++FP+++VGNK DL  +R+V   EA   +   ++ Y E SAK   +NVD AF ++VR +R
Sbjct:   79 LDILDTAGQEEFGAMREQYMRAGNGFLLVFAINDRQSFNEVGKLFTQILRVKDRDDFPIVLVGNKADLENQRQVLRSEASSFSASHHMTYFEASAK-LRLNVDEAFEQLVRAVR 191          
BLAST of Ras-related protein vs. UniProt/SwissProt
Match: sp|O14807|RASM_HUMAN (Ras-related protein M-Ras OS=Homo sapiens OX=9606 GN=MRAS PE=1 SV=2)

HSP 1 Score: 129.413 bits (324), Expect = 3.485e-36
Identity = 67/114 (58.77%), Postives = 92/114 (80.70%), Query Frame = 3
Query:  138 VSVLDTAGQDSFSAMRQQYMRKGDGFLVMFSITDRNSFQMVRHLYKDILRTKDKENFPVIIVGNKVDLXXXXXXXXXXXXXXXXXXNVQYMETSAKPPPVNVDNAFLEVVRLIR 479
            + VLDTAGQ+ FSAMR+QYMR GDGFL+++S+TD+ SF+ V   ++ ILR KD+E+FP+I+V NKVDL   RK+T E+ KE+A + N+ Y+ETSAK PP+NVD AF ++VR+IR
Sbjct:   63 LDVLDTAGQEEFSAMREQYMRTGDGFLIVYSVTDKASFEHVDRFHQLILRVKDRESFPMILVANKVDLMHLRKITREQGKEMATKHNIPYIETSAKDPPLNVDKAFHDLVRVIR 176          

HSP 2 Score: 43.8986 bits (102), Expect = 3.485e-36
Identity = 17/31 (54.84%), Postives = 23/31 (74.19%), Query Frame = 1
Query:    1 YFQRTFVEDYDPTIEDTYIQSKEFDGEWCDL 93
            +FQ+ FV DYDPTIED+Y++  E D +W  L
Sbjct:   33 FFQKIFVPDYDPTIEDSYLKHTEIDNQWAIL 63          
BLAST of Ras-related protein vs. UniProt/SwissProt
Match: sp|O08989|RASM_MOUSE (Ras-related protein M-Ras OS=Mus musculus OX=10090 GN=Mras PE=1 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 2.008e-35
Identity = 66/114 (57.89%), Postives = 91/114 (79.82%), Query Frame = 3
Query:  138 VSVLDTAGQDSFSAMRQQYMRKGDGFLVMFSITDRNSFQMVRHLYKDILRTKDKENFPVIIVGNKVDLXXXXXXXXXXXXXXXXXXNVQYMETSAKPPPVNVDNAFLEVVRLIR 479
            + VLDTAGQ+ FSAMR+QYMR GDGFL+++S+TD+ SF+ V   ++ ILR KD+E+FP+I+V NKVDL   RKVT ++ KE+A + N+ Y+ETSAK PP+NVD  F ++VR+IR
Sbjct:   63 LDVLDTAGQEEFSAMREQYMRTGDGFLIVYSVTDKASFEHVDRFHQLILRVKDRESFPMILVANKVDLMHLRKVTRDQGKEMATKYNIPYIETSAKDPPLNVDKTFHDLVRVIR 176          

HSP 2 Score: 43.8986 bits (102), Expect = 2.008e-35
Identity = 17/31 (54.84%), Postives = 23/31 (74.19%), Query Frame = 1
Query:    1 YFQRTFVEDYDPTIEDTYIQSKEFDGEWCDL 93
            +FQ+ FV DYDPTIED+Y++  E D +W  L
Sbjct:   33 FFQKIFVPDYDPTIEDSYLKHTEIDNQWAIL 63          
BLAST of Ras-related protein vs. UniProt/SwissProt
Match: sp|P97538|RASM_RAT (Ras-related protein M-Ras OS=Rattus norvegicus OX=10116 GN=Mras PE=1 SV=2)

HSP 1 Score: 126.716 bits (317), Expect = 2.145e-35
Identity = 66/114 (57.89%), Postives = 91/114 (79.82%), Query Frame = 3
Query:  138 VSVLDTAGQDSFSAMRQQYMRKGDGFLVMFSITDRNSFQMVRHLYKDILRTKDKENFPVIIVGNKVDLXXXXXXXXXXXXXXXXXXNVQYMETSAKPPPVNVDNAFLEVVRLIR 479
            + VLDTAGQ+ FSAMR+QYMR GDGFL+++S+TD+ SF+ V   ++ ILR KD+E+FP+I+V NKVDL   RKVT ++ KE+A + N+ Y+ETSAK PP+NVD  F ++VR+IR
Sbjct:   63 LDVLDTAGQEEFSAMREQYMRTGDGFLIVYSVTDKASFEHVDRFHQLILRVKDRESFPMILVANKVDLMHLRKVTRDQGKEMATKYNIPYIETSAKDPPLNVDKTFHDLVRVIR 176          

HSP 2 Score: 43.8986 bits (102), Expect = 2.145e-35
Identity = 17/31 (54.84%), Postives = 23/31 (74.19%), Query Frame = 1
Query:    1 YFQRTFVEDYDPTIEDTYIQSKEFDGEWCDL 93
            +FQ+ FV DYDPTIED+Y++  E D +W  L
Sbjct:   33 FFQKIFVPDYDPTIEDSYLKHTEIDNQWAIL 63          
BLAST of Ras-related protein vs. UniProt/SwissProt
Match: sp|P62071|RRAS2_MOUSE (Ras-related protein R-Ras2 OS=Mus musculus OX=10090 GN=Rras2 PE=1 SV=1)

HSP 1 Score: 113.62 bits (283), Expect = 1.186e-29
Identity = 63/115 (54.78%), Postives = 89/115 (77.39%), Query Frame = 3
Query:  135 NVSVLDTAGQDSFSAMRQQYMRKGDGFLVMFSITDRNSFQMVRHLYKDILRTKDKENFPVIIVGNKVDLXXXXXXXXXXXXXXXXXXNVQYMETSAKPPPVNVDNAFLEVVRLIR 479
             + +LDTAGQ+ F AMR+QYMR G+GFL++FS+TDR SF+ +    + ILR KD++ FP+I++GNK DL  +R+VT+EE ++LA++L V YME SAK   +NVD AF E+VR+IR
Sbjct:   63 RLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILIGNKADLDHQRQVTQEEGQQLARQLKVTYMEASAK-IRMNVDQAFHELVRVIR 176          
BLAST of Ras-related protein vs. UniProt/SwissProt
Match: sp|P62070|RRAS2_HUMAN (Ras-related protein R-Ras2 OS=Homo sapiens OX=9606 GN=RRAS2 PE=1 SV=1)

HSP 1 Score: 113.62 bits (283), Expect = 1.186e-29
Identity = 63/115 (54.78%), Postives = 89/115 (77.39%), Query Frame = 3
Query:  135 NVSVLDTAGQDSFSAMRQQYMRKGDGFLVMFSITDRNSFQMVRHLYKDILRTKDKENFPVIIVGNKVDLXXXXXXXXXXXXXXXXXXNVQYMETSAKPPPVNVDNAFLEVVRLIR 479
             + +LDTAGQ+ F AMR+QYMR G+GFL++FS+TDR SF+ +    + ILR KD++ FP+I++GNK DL  +R+VT+EE ++LA++L V YME SAK   +NVD AF E+VR+IR
Sbjct:   63 RLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILIGNKADLDHQRQVTQEEGQQLARQLKVTYMEASAK-IRMNVDQAFHELVRVIR 176          
BLAST of Ras-related protein vs. TrEMBL
Match: R7U636 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_154233 PE=4 SV=1)

HSP 1 Score: 135.961 bits (341), Expect = 1.576e-38
Identity = 72/114 (63.16%), Postives = 92/114 (80.70%), Query Frame = 3
Query:  138 VSVLDTAGQDSFSAMRQQYMRKGDGFLVMFSITDRNSFQMVRHLYKDILRTKDKENFPVIIVGNKVDLXXXXXXXXXXXXXXXXXXNVQYMETSAKPPPVNVDNAFLEVVRLIR 479
            + VLDTAGQ+ FSAMR+QYMRKGDGFL++FS+TDR S++ V H Y  ILR KD++ +P+I+VGNKVDL   RKVT ++ KELA  L + Y+ETSAK PP+NVD AF EVV++IR
Sbjct:   61 LDVLDTAGQEEFSAMREQYMRKGDGFLLVFSVTDRQSYENVHHFYTQILRVKDRDTYPMILVGNKVDLVHLRKVTTDQGKELATNLRIPYIETSAKDPPLNVDAAFHEVVKVIR 174          

HSP 2 Score: 53.1434 bits (126), Expect = 1.576e-38
Identity = 21/31 (67.74%), Postives = 26/31 (83.87%), Query Frame = 1
Query:    1 YFQRTFVEDYDPTIEDTYIQSKEFDGEWCDL 93
            +FQ+ FV+DYDPTIED+YIQ  E DG+WC L
Sbjct:   31 FFQKMFVQDYDPTIEDSYIQHTEIDGQWCIL 61          
BLAST of Ras-related protein vs. TrEMBL
Match: A0A210Q323 (Ras-related protein M-Ras OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT19738 PE=4 SV=1)

HSP 1 Score: 132.494 bits (332), Expect = 4.147e-38
Identity = 67/114 (58.77%), Postives = 92/114 (80.70%), Query Frame = 3
Query:  138 VSVLDTAGQDSFSAMRQQYMRKGDGFLVMFSITDRNSFQMVRHLYKDILRTKDKENFPVIIVGNKVDLXXXXXXXXXXXXXXXXXXNVQYMETSAKPPPVNVDNAFLEVVRLIR 479
            + VLDTAGQ+ FSAMR+QYMRKGDGFL+++S+TDR S++ + + Y  ILR KD++N+P+++V NKVDL   RKV++E    LA+ L +QY+ETSAK PP+NVD AF E+VR+IR
Sbjct:   62 LDVLDTAGQEEFSAMREQYMRKGDGFLLVYSVTDRQSYENIENFYSQILRVKDRDNYPMVLVANKVDLVALRKVSDELGNNLARHLRLQYIETSAKGPPLNVDKAFHELVRVIR 175          

HSP 2 Score: 55.0694 bits (131), Expect = 4.147e-38
Identity = 22/31 (70.97%), Postives = 27/31 (87.10%), Query Frame = 1
Query:    1 YFQRTFVEDYDPTIEDTYIQSKEFDGEWCDL 93
            +FQ+ FVEDYDPTIED+YIQ+ E DG+WC L
Sbjct:   32 FFQKMFVEDYDPTIEDSYIQNAEIDGKWCIL 62          
BLAST of Ras-related protein vs. TrEMBL
Match: A0A1S3JDF1 (ras-related protein M-Ras-like OS=Lingula unguis OX=7574 GN=LOC106171929 PE=4 SV=1)

HSP 1 Score: 131.724 bits (330), Expect = 1.013e-37
Identity = 69/114 (60.53%), Postives = 95/114 (83.33%), Query Frame = 3
Query:  138 VSVLDTAGQDSFSAMRQQYMRKGDGFLVMFSITDRNSFQMVRHLYKDILRTKDKENFPVIIVGNKVDLXXXXXXXXXXXXXXXXXXNVQYMETSAKPPPVNVDNAFLEVVRLIR 479
            + VLDTAGQ+ FSAMR+QYMRKGDGFL+++S+TDR S++ +R+ +  ILR KD++++P+++V NKVDL   RKV EE+ ++LA +L VQY+ETSAK PP+NVD AF EVVR+IR
Sbjct:   61 LDVLDTAGQEEFSAMREQYMRKGDGFLLVYSVTDRQSYENIRNFHTQILRVKDRDSYPMLLVANKVDLVHLRKVPEEQGRDLAIQLGVQYIETSAKDPPLNVDAAFHEVVRVIR 174          

HSP 2 Score: 54.299 bits (129), Expect = 1.013e-37
Identity = 23/34 (67.65%), Postives = 27/34 (79.41%), Query Frame = 1
Query:    1 YFQRTFVEDYDPTIEDTYIQSKEFDGEWCDLTGL 102
            +FQ+ FV+DYDPTIED+YIQ  E DGEWC L  L
Sbjct:   31 FFQKMFVQDYDPTIEDSYIQHTEIDGEWCILDVL 64          
BLAST of Ras-related protein vs. TrEMBL
Match: A0A1S3JBY1 (ras-related protein M-Ras-like isoform X1 OS=Lingula unguis OX=7574 GN=LOC106159879 PE=4 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 1.128e-37
Identity = 69/114 (60.53%), Postives = 95/114 (83.33%), Query Frame = 3
Query:  138 VSVLDTAGQDSFSAMRQQYMRKGDGFLVMFSITDRNSFQMVRHLYKDILRTKDKENFPVIIVGNKVDLXXXXXXXXXXXXXXXXXXNVQYMETSAKPPPVNVDNAFLEVVRLIR 479
            + VLDTAGQ+ FSAMR+QYMRKGDGFL+++S+TDR S++ +R+ +  ILR KD++++P+++V NKVDL   RKV EE+ ++LA +L VQY+ETSAK PP+NVD AF EVVR+IR
Sbjct:   61 LDVLDTAGQEEFSAMREQYMRKGDGFLLVYSVTDRQSYENIRNFHTQILRVKDRDSYPMLLVANKVDLVHLRKVPEEQGRDLAIQLGVQYIETSAKDPPLNVDAAFHEVVRVIR 174          

HSP 2 Score: 53.9138 bits (128), Expect = 1.128e-37
Identity = 23/34 (67.65%), Postives = 27/34 (79.41%), Query Frame = 1
Query:    1 YFQRTFVEDYDPTIEDTYIQSKEFDGEWCDLTGL 102
            +FQ+ FV+DYDPTIED+YIQ  E DGEWC L  L
Sbjct:   31 FFQKMFVQDYDPTIEDSYIQHTEIDGEWCILDVL 64          
BLAST of Ras-related protein vs. TrEMBL
Match: A0A212FEK5 (Ras-related protein M-Ras OS=Danaus plexippus plexippus OX=278856 GN=KGM_205714 PE=4 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 1.342e-37
Identity = 68/114 (59.65%), Postives = 90/114 (78.95%), Query Frame = 3
Query:  138 VSVLDTAGQDSFSAMRQQYMRKGDGFLVMFSITDRNSFQMVRHLYKDILRTKDKENFPVIIVGNKVDLXXXXXXXXXXXXXXXXXXNVQYMETSAKPPPVNVDNAFLEVVRLIR 479
            + VLDTAGQ+ FSAMR+QYMRKGDGFL+++S+TD+ SFQ +RH +  ILR KD+E +P+++  NKVDL   R V+EE  +ELA+ L   Y+ETSAK PP+NVD AF E+VR+IR
Sbjct:   63 LDVLDTAGQEEFSAMREQYMRKGDGFLLVYSVTDQQSFQNIRHFHTQILRVKDRETYPMLVAANKVDLVHARAVSEEAGRELARALGAPYIETSAKEPPLNVDRAFHELVRIIR 176          

HSP 2 Score: 51.6026 bits (122), Expect = 1.342e-37
Identity = 21/31 (67.74%), Postives = 25/31 (80.65%), Query Frame = 1
Query:    1 YFQRTFVEDYDPTIEDTYIQSKEFDGEWCDL 93
            +FQ+ FV DYDPTIED+YIQ  E DG+WC L
Sbjct:   33 FFQKLFVTDYDPTIEDSYIQHTEVDGQWCIL 63          
BLAST of Ras-related protein vs. Ensembl Cavefish
Match: si:ch73-116o1.2 (muscle RAS oncogene homolog [Source:HGNC Symbol;Acc:HGNC:7227])

HSP 1 Score: 129.798 bits (325), Expect = 6.979e-38
Identity = 66/114 (57.89%), Postives = 91/114 (79.82%), Query Frame = 3
Query:  138 VSVLDTAGQDSFSAMRQQYMRKGDGFLVMFSITDRNSFQMVRHLYKDILRTKDKENFPVIIVGNKVDLXXXXXXXXXXXXXXXXXXNVQYMETSAKPPPVNVDNAFLEVVRLIR 479
            + VLDTAGQ+ FSAMR+QYMR GDGFL++FS+TD+ SF+ V   ++ ILR KD+E+FP+++V NKVDL   RKVT ++  E+A + ++ Y+ETSAK PP+NVD AF E+VR+IR
Sbjct:   63 LDVLDTAGQEEFSAMREQYMRTGDGFLIVFSVTDKASFEHVDRFHQLILRVKDRESFPMVLVANKVDLVHLRKVTSDQGCEMAAKHSITYIETSAKDPPMNVDKAFHELVRVIR 176          

HSP 2 Score: 46.595 bits (109), Expect = 6.979e-38
Identity = 18/31 (58.06%), Postives = 24/31 (77.42%), Query Frame = 1
Query:    1 YFQRTFVEDYDPTIEDTYIQSKEFDGEWCDL 93
            +FQ+ FV DYDPTIED+Y++  E DG+W  L
Sbjct:   33 FFQKIFVPDYDPTIEDSYLKHTEIDGQWAIL 63          
BLAST of Ras-related protein vs. Ensembl Cavefish
Match: mras (ras-related protein M-Ras [Source:NCBI gene;Acc:103031239])

HSP 1 Score: 129.413 bits (324), Expect = 7.900e-38
Identity = 66/114 (57.89%), Postives = 92/114 (80.70%), Query Frame = 3
Query:  138 VSVLDTAGQDSFSAMRQQYMRKGDGFLVMFSITDRNSFQMVRHLYKDILRTKDKENFPVIIVGNKVDLXXXXXXXXXXXXXXXXXXNVQYMETSAKPPPVNVDNAFLEVVRLIR 479
            + VLDTAGQ+ FSAMR+QYMR GDGFL++FS+TD+ SF+ V   ++ ILR KD+E+FP+++V NKVDL   RK+T E+ +E+A + ++ Y+ETSAK PP+NVD AF E+VR+IR
Sbjct:   63 LDVLDTAGQEEFSAMREQYMRTGDGFLIVFSVTDKASFEHVDRFHQLILRVKDRESFPMVLVANKVDLVHLRKITSEQGREMAMKHSITYIETSAKDPPMNVDKAFHELVRVIR 176          

HSP 2 Score: 46.9802 bits (110), Expect = 7.900e-38
Identity = 18/31 (58.06%), Postives = 24/31 (77.42%), Query Frame = 1
Query:    1 YFQRTFVEDYDPTIEDTYIQSKEFDGEWCDL 93
            +FQ+ FV DYDPTIED+Y++  E DG+W  L
Sbjct:   33 FFQKIFVPDYDPTIEDSYLKHTEIDGQWAIL 63          
BLAST of Ras-related protein vs. Ensembl Cavefish
Match: rras2 (RAS related 2 [Source:NCBI gene;Acc:103027563])

HSP 1 Score: 114.39 bits (285), Expect = 7.007e-31
Identity = 62/115 (53.91%), Postives = 90/115 (78.26%), Query Frame = 3
Query:  135 NVSVLDTAGQDSFSAMRQQYMRKGDGFLVMFSITDRNSFQMVRHLYKDILRTKDKENFPVIIVGNKVDLXXXXXXXXXXXXXXXXXXNVQYMETSAKPPPVNVDNAFLEVVRLIR 479
             + +LDTAGQ+ F AMR+QYMR G+GFL++FS+TDR SF+ +    + ILR KD++ FP+I+VGNK DL ++R+V+++E ++LA++L V YME SAK   +NVD AF E+VR+IR
Sbjct:   62 RLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILVGNKADLEQQRQVSQDEGQQLARQLKVTYMEASAK-IRMNVDQAFHELVRVIR 175          
BLAST of Ras-related protein vs. Ensembl Cavefish
Match: rras (RAS related [Source:ZFIN;Acc:ZDB-GENE-041010-217])

HSP 1 Score: 109.383 bits (272), Expect = 5.333e-29
Identity = 59/114 (51.75%), Postives = 83/114 (72.81%), Query Frame = 3
Query:  138 VSVLDTAGQDSFSAMRQQYMRKGDGFLVMFSITDRNSFQMVRHLYKDILRTKDKENFPVIIVGNKVDLXXXXXXXXXXXXXXXXXXNVQYMETSAKPPPVNVDNAFLEVVRLIR 479
            + +LDTAGQ+ F AMR+QYMR G+GFL++F++ D  S+  ++  +  ILR KD+++FP+++VGNK DL + R V+ EEA   A+E  + YME+SAK    NVD AFLEVVR IR
Sbjct:   64 LDILDTAGQEEFGAMREQYMRSGEGFLLVFALNDSGSYNEIQKFHTQILRVKDRDDFPMVLVGNKSDLDQHRVVSREEAMGFARENRIHYMESSAKNRH-NVDEAFLEVVRAIR 176          
BLAST of Ras-related protein vs. Ensembl Cavefish
Match: kras (GTPase KRas [Source:NCBI gene;Acc:103038241])

HSP 1 Score: 92.4337 bits (228), Expect = 1.334e-23
Identity = 53/114 (46.49%), Postives = 78/114 (68.42%), Query Frame = 3
Query:  138 VSVLDTAGQDSFSAMRQQYMRKGDGFLVMFSITDRNSFQMVRHLYKDILRTKDKENFPVIIVGNKVDLXXXXXXXXXXXXXXXXXXNVQYMETSAKPPPVNVDNAFLEVVRLIR 479
            + +LDTAGQ+ +SAMR QYMR G+GFL +F+I +  SF+ + H  + I R KD E+ P+++VGNK DL   R V  ++A++LA+   + ++ETSAK     VD+AF  +VR IR
Sbjct:   53 LDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL-PSRTVDTKQAQDLARSYGIPFIETSAKTRQ-GVDDAFYTLVREIR 164          

HSP 2 Score: 35.8094 bits (81), Expect = 1.334e-23
Identity = 18/37 (48.65%), Postives = 24/37 (64.86%), Query Frame = 1
Query:    4 FQRTFVEDYDPTIEDTYIQSKEFDGEWCDLTGLVDML 114
             Q  FV++YDPTIED+Y +    DGE C    L+D+L
Sbjct:   24 IQNHFVDEYDPTIEDSYRKQVVIDGETC----LLDIL 56          
BLAST of Ras-related protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005561.1 (pep scaffold:Pmarinus_7.0:GL481089:12431:17765:1 gene:ENSPMAG00000005048.1 transcript:ENSPMAT00000005561.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 127.872 bits (320), Expect = 2.619e-38
Identity = 63/114 (55.26%), Postives = 92/114 (80.70%), Query Frame = 3
Query:  138 VSVLDTAGQDSFSAMRQQYMRKGDGFLVMFSITDRNSFQMVRHLYKDILRTKDKENFPVIIVGNKVDLXXXXXXXXXXXXXXXXXXNVQYMETSAKPPPVNVDNAFLEVVRLIR 479
            + VLDTAGQ+ FSAMR+QYMR GDGFL+++S+TD+ SF+ V   ++ ILR KD+E+FP+++V NKVDL   RK++ E+ +E+A + ++ Y+ETSAK PP+NVD AF ++VR+IR
Sbjct:   62 LDVLDTAGQEEFSAMREQYMRTGDGFLIVYSVTDKASFEHVERFHQLILRVKDRESFPMVLVANKVDLLHLRKISTEQGQEMASKYDIPYIETSAKEPPLNVDKAFHQLVRVIR 175          

HSP 2 Score: 47.7506 bits (112), Expect = 2.619e-38
Identity = 19/31 (61.29%), Postives = 24/31 (77.42%), Query Frame = 1
Query:    1 YFQRTFVEDYDPTIEDTYIQSKEFDGEWCDL 93
            +FQ+ FV DYDPTIED+YI+  E DG+W  L
Sbjct:   32 FFQKIFVPDYDPTIEDSYIKHAEIDGQWAIL 62          
BLAST of Ras-related protein vs. Ensembl Sea Lamprey
Match: mras (muscle RAS oncogene homolog [Source:ZFIN;Acc:ZDB-GENE-050208-495])

HSP 1 Score: 129.028 bits (323), Expect = 2.965e-38
Identity = 63/112 (56.25%), Postives = 90/112 (80.36%), Query Frame = 3
Query:  144 VLDTAGQDSFSAMRQQYMRKGDGFLVMFSITDRNSFQMVRHLYKDILRTKDKENFPVIIVGNKVDLXXXXXXXXXXXXXXXXXXNVQYMETSAKPPPVNVDNAFLEVVRLIR 479
             LDTAGQ+ FSAMR+QYMR GDGFL+++S+TDR SF+ +   ++ ILR KDK++FP+++V NKVDL   RK++ E+ +++A + N+ Y+ETSAK PP+NVD AF E+VR+IR
Sbjct:   66 CLDTAGQEEFSAMREQYMRTGDGFLIVYSVTDRTSFEHIDKFHQLILRVKDKDSFPMVLVANKVDLLHLRKISSEQGRDMAAKYNIPYIETSAKDPPLNVDQAFHELVRVIR 177          

HSP 2 Score: 46.2098 bits (108), Expect = 2.965e-38
Identity = 18/31 (58.06%), Postives = 24/31 (77.42%), Query Frame = 1
Query:    1 YFQRTFVEDYDPTIEDTYIQSKEFDGEWCDL 93
            +FQ+ FV DYDPTIED+Y++  E DG+W  L
Sbjct:   33 FFQKIFVADYDPTIEDSYLKHTEIDGQWAIL 63          
BLAST of Ras-related protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000518.1 (pep scaffold:Pmarinus_7.0:GL479781:11597:21619:-1 gene:ENSPMAG00000000465.1 transcript:ENSPMAT00000000518.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 127.872 bits (320), Expect = 3.497e-38
Identity = 64/114 (56.14%), Postives = 92/114 (80.70%), Query Frame = 3
Query:  138 VSVLDTAGQDSFSAMRQQYMRKGDGFLVMFSITDRNSFQMVRHLYKDILRTKDKENFPVIIVGNKVDLXXXXXXXXXXXXXXXXXXNVQYMETSAKPPPVNVDNAFLEVVRLIR 479
            + VLDTAGQ+ FSAMR+QYMR GDGFL+++S+TD+ SF+ V   ++ ILR KD+++FP+I+V NKVDL   RK++ E+ +E+A + ++ Y+ETSAK PP+NVD AF E+VR+IR
Sbjct:   63 LDVLDTAGQEEFSAMREQYMRTGDGFLIVYSVTDKASFEHVERFHQLILRVKDRDSFPMILVANKVDLMHLRKISSEQGQEMAAKYSIPYIETSAKDPPLNVDKAFQELVRVIR 176          

HSP 2 Score: 46.9802 bits (110), Expect = 3.497e-38
Identity = 19/31 (61.29%), Postives = 24/31 (77.42%), Query Frame = 1
Query:    1 YFQRTFVEDYDPTIEDTYIQSKEFDGEWCDL 93
            +FQ+ FV DYDPTIED+YI+  E DG+W  L
Sbjct:   33 FFQKIFVVDYDPTIEDSYIKHTEIDGQWAIL 63          
BLAST of Ras-related protein vs. Ensembl Sea Lamprey
Match: hrasb (HRas proto-oncogene, GTPase b [Source:ZFIN;Acc:ZDB-GENE-050522-466])

HSP 1 Score: 87.8113 bits (216), Expect = 2.621e-22
Identity = 51/114 (44.74%), Postives = 77/114 (67.54%), Query Frame = 3
Query:  138 VSVLDTAGQDSFSAMRQQYMRKGDGFLVMFSITDRNSFQMVRHLYKDILRTKDKENFPVIIVGNKVDLXXXXXXXXXXXXXXXXXXNVQYMETSAKPPPVNVDNAFLEVVRLIR 479
            + +LDTAGQ+ +SAMR QYMR G+GFL +F+I +  SF+ +    + I R KD ++ P+++VGNK DL   R V  ++A++LA+   + Y+ETSAK     V++AF  +VR IR
Sbjct:   57 LDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL-PARTVDTKQAQDLARSYGIPYVETSAKTRQ-GVEDAFYTLVREIR 168          

HSP 2 Score: 33.4982 bits (75), Expect = 2.621e-22
Identity = 17/37 (45.95%), Postives = 23/37 (62.16%), Query Frame = 1
Query:    4 FQRTFVEDYDPTIEDTYIQSKEFDGEWCDLTGLVDML 114
             Q  FV++YDPTIED+Y +    D E C    L+D+L
Sbjct:   28 IQNHFVDEYDPTIEDSYRKQVVIDSETC----LLDIL 60          
BLAST of Ras-related protein vs. Ensembl Sea Lamprey
Match: ralba (v-ral simian leukemia viral oncogene homolog Ba (ras related) [Source:ZFIN;Acc:ZDB-GENE-040801-267])

HSP 1 Score: 87.4261 bits (215), Expect = 3.092e-21
Identity = 50/116 (43.10%), Postives = 76/116 (65.52%), Query Frame = 3
Query:  132 LNVSVLDTAGQDSFSAMRQQYMRKGDGFLVMFSITDRNSFQMVRHLYKDILRTKDKENFPVIIVGNKVDLXXXXXXXXXXXXXXXXXXNVQYMETSAKPPPVNVDNAFLEVVRLIR 479
            + + +LDTAGQ+ ++A+R  Y R G+GFL +FSI +  SF       + ILR K+ ++ P ++VGNK DL E R+V+ EEA+  A++  V Y+ETSAK    NVD  F +++R +R
Sbjct:   61 VQIDILDTAGQEDYAAIRDNYFRSGEGFLCVFSICEHESFAATLEFREQILRVKEDDSVPFLLVGNKSDLEERRQVSSEEARARAEQWRVSYVETSAK-TRANVDKVFFDLMRDVR 175          
BLAST of Ras-related protein vs. Ensembl Yeast
Match: RAS1 (GTPase involved in G-protein signaling in adenylate cyclase activation; plays a role in cell proliferation; localized to the plasma membrane; homolog of mammalian RAS proto-oncogenes; relative distribution to the nucleus increases upon DNA replication stress; RAS1 has a paralog, RAS2, that arose from the whole genome duplication [Source:SGD;Acc:S000005627])

HSP 1 Score: 106.686 bits (265), Expect = 9.143e-28
Identity = 59/112 (52.68%), Postives = 84/112 (75.00%), Query Frame = 3
Query:  144 VLDTAGQDSFSAMRQQYMRKGDGFLVMFSITDRNSFQMVRHLYKDILRTKDKENFPVIIVGNKVDLXXXXXXXXXXXXXXXXXXNVQYMETSAKPPPVNVDNAFLEVVRLIR 479
            +LDTAGQ+ +SAMR+QYMR G+GFL+++S+T RNSF  +   Y+ I R KD +  PV++VGNK+DL  ER+V+ E+   LAK+LN  ++ETSAK   +NVD AF  ++RL+R
Sbjct:   62 ILDTAGQEEYSAMREQYMRTGEGFLLVYSVTSRNSFDELLSYYQQIQRVKDSDYIPVVVVGNKLDLENERQVSYEDGLRLAKQLNAPFLETSAK-QAINVDEAFYSLIRLVR 172          
BLAST of Ras-related protein vs. Ensembl Yeast
Match: RAS2 (GTP-binding protein; regulates nitrogen starvation response, sporulation, and filamentous growth; farnesylation and palmitoylation required for activity and localization to plasma membrane; homolog of mammalian Ras proto-oncogenes; RAS2 has a paralog, RAS1, that arose from the whole genome duplication [Source:SGD;Acc:S000005042])

HSP 1 Score: 99.7525 bits (247), Expect = 4.180e-25
Identity = 52/112 (46.43%), Postives = 82/112 (73.21%), Query Frame = 3
Query:  144 VLDTAGQDSFSAMRQQYMRKGDGFLVMFSITDRNSFQMVRHLYKDILRTKDKENFPVIIVGNKVDLXXXXXXXXXXXXXXXXXXNVQYMETSAKPPPVNVDNAFLEVVRLIR 479
            +LDTAGQ+ +SAMR+QYMR G+GFL+++SIT ++S   +   Y+ ILR KD +  P+++VGNK DL  E++V+ ++   +AK++N  ++ETSAK   +NV+ AF  + RL+R
Sbjct:   62 ILDTAGQEEYSAMREQYMRNGEGFLLVYSITSKSSLDELMTYYQQILRVKDTDYVPIVVVGNKSDLENEKQVSYQDGLNMAKQMNAPFLETSAK-QAINVEEAFYTLARLVR 172          
BLAST of Ras-related protein vs. Ensembl Yeast
Match: RSR1 (GTP-binding protein of the Ras superfamily; required for bud site selection, morphological changes in response to mating pheromone, and efficient cell fusion; localized to the plasma membrane; significantly similar to mammalian Rap GTPases [Source:SGD;Acc:S000003384])

HSP 1 Score: 74.3294 bits (181), Expect = 3.167e-16
Identity = 47/117 (40.17%), Postives = 77/117 (65.81%), Query Frame = 3
Query:  129 LLNVSVLDTAGQDSFSAMRQQYMRKGDGFLVMFSITDRNSFQMVRHLYKDILRTKDKENFPVIIVGNKVDLXXXXXXXXXXXXXXXXXXN-VQYMETSAKPPPVNVDNAFLEVVRLI 476
            + ++ +LDTAG   F+AMR+ Y++ G GFL+++S+TDR S + +  L + +LR KD +  P++++GNK DL  ER ++ EE  E++ +   V + ETSA     NVD  F+++VR I
Sbjct:   50 VFDLEILDTAGIAQFTAMRELYIKSGMGFLLVYSVTDRQSLEELMELREQVLRIKDSDRVPMVLIGNKADLINERVISVEEGIEVSSKWGRVPFYETSALLRS-NVDEVFVDLVRQI 165          
BLAST of Ras-related protein vs. Ensembl Yeast
Match: GSP1 (Ran GTPase; GTP binding protein (mammalian Ranp homolog) involved in the maintenance of nuclear organization, RNA processing and transport; regulated by Srm1p, Rna1p, Yrb1p, Yrb2p, Yrp4p, Yrb30p, Cse1p and Kap95p; GSP1 has a paralog, GSP2, that arose from the whole genome duplication [Source:SGD;Acc:S000004284])

HSP 1 Score: 58.5362 bits (140), Expect = 7.210e-11
Identity = 34/109 (31.19%), Postives = 61/109 (55.96%), Query Frame = 3
Query:  144 VLDTAGQDSFSAMRQQYMRKGDGFLVMFSITDRNSFQMVRHLYKDILRTKDKENFPVIIVGNKVDLXXXXXXXXXXXXXXXXXXNVQYMETSAKPPPVNVDNAFLEVVR 470
            V DTAGQ+ F  +R  Y       ++MF +T R +++ V + ++D++R    EN P+++ GNKVD+  + +  + +     ++ N+QY + SAK    N +  FL + R
Sbjct:   65 VWDTAGQEKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDLVRV--CENIPIVLCGNKVDV--KERKVKAKTITFHRKKNLQYYDISAK-SNYNFEKPFLWLAR 168          
BLAST of Ras-related protein vs. Ensembl Yeast
Match: GSP2 (GTP binding protein (mammalian Ranp homolog); involved in the maintenance of nuclear organization, RNA processing and transport; interacts with Kap121p, Kap123p and Pdr6p (karyophilin betas); not required for viability; protein abundance increases in response to DNA replication stress; GSP2 has a paralog, GSP1, that arose from the whole genome duplication [Source:SGD;Acc:S000005711])

HSP 1 Score: 58.151 bits (139), Expect = 8.437e-11
Identity = 34/109 (31.19%), Postives = 61/109 (55.96%), Query Frame = 3
Query:  144 VLDTAGQDSFSAMRQQYMRKGDGFLVMFSITDRNSFQMVRHLYKDILRTKDKENFPVIIVGNKVDLXXXXXXXXXXXXXXXXXXNVQYMETSAKPPPVNVDNAFLEVVR 470
            V DTAGQ+ F  +R  Y       ++MF +T R +++ V + ++D++R    EN P+++ GNKVD+  + +  + +     ++ N+QY + SAK    N +  FL + R
Sbjct:   66 VWDTAGQEKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDLVRV--CENIPIVLCGNKVDV--KERKVKAKTITFHRKKNLQYYDISAK-SNYNFEKPFLWLAR 169          
BLAST of Ras-related protein vs. Ensembl Nematostella
Match: EDO39171 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAS1])

HSP 1 Score: 119.398 bits (298), Expect = 2.386e-33
Identity = 65/122 (53.28%), Postives = 90/122 (73.77%), Query Frame = 3
Query:  135 NVSVLDTAGQDSFSAMRQQYMRKGDGFLVMFSITDRNSFQMVRHLYKDILRTKDKENFPVIIVGNKVDLXXXXXXXXXXXXXXXXXXNVQYMETSAKPPPVNVDNAFLEVVRLIRFILISIK 500
            ++ +LDTAGQ+ FSAMR+QYMR G+GFL++FS+TDR+SF+ +   Y  ILR KD+  FP+II GNK DL  ER V+  E +ELA++L +QY+ETSAK    NVD AF ++VR IR   ++ +
Sbjct:   60 HLDILDTAGQEEFSAMREQYMRSGEGFLLVFSVTDRSSFEEINKFYNQILRVKDRTEFPMIICGNKSDLEYERTVSTAEGQELARQLRIQYLETSAK-QRTNVDQAFHDLVRAIRRFTVATE 180          
BLAST of Ras-related protein vs. Ensembl Nematostella
Match: EDO32914 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STP5])

HSP 1 Score: 90.5077 bits (223), Expect = 2.094e-23
Identity = 54/114 (47.37%), Postives = 77/114 (67.54%), Query Frame = 3
Query:  138 VSVLDTAGQDSFSAMRQQYMRKGDGFLVMFSITDRNSFQMVRHLYKDILRTKDKENFPVIIVGNKVDLXXXXXXXXXXXXXXXXXXNVQYMETSAKPPPVNVDNAFLEVVRLIR 479
            + +LDTAGQ+ +SAMR QYMR G+GFL +F++ +  SF+ +    + I R KD E  P+++VGNK DL  +R V+  +A+ELAK  N+ + ETSAK     VD+AF  +VR IR
Sbjct:   53 LDILDTAGQEEYSAMRDQYMRTGEGFLCVFAVNNSKSFEDINQYREQIKRVKDAEEVPMVLVGNKCDL-PQRTVSTSDAQELAKSYNIPFQETSAKTRQ-GVDDAFYTLVREIR 164          

HSP 2 Score: 35.8094 bits (81), Expect = 2.094e-23
Identity = 18/37 (48.65%), Postives = 24/37 (64.86%), Query Frame = 1
Query:    4 FQRTFVEDYDPTIEDTYIQSKEFDGEWCDLTGLVDML 114
             Q  FV++YDPTIED+Y +    DGE C    L+D+L
Sbjct:   24 IQNHFVDEYDPTIEDSYRKQVVIDGETC----LLDIL 56          
BLAST of Ras-related protein vs. Ensembl Nematostella
Match: EDO39047 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SB93])

HSP 1 Score: 82.0333 bits (201), Expect = 6.558e-22
Identity = 49/114 (42.98%), Postives = 81/114 (71.05%), Query Frame = 3
Query:  138 VSVLDTAGQDSFSAMRQQYMRKGDGFLVMFSITDRNSFQMVRHLYKDILRTKDKENFPVIIVGNKVDLXXXXXXXXXXXXXXXXX-XNVQYMETSAKPPPVNVDNAFLEVVRLI 476
            + +LDTAG + F+AMR  YM+ G GF++++SIT +++F  ++ L + ILR KD ++ P+++VGNK DL +ER V +++ + LAK+  N  ++ETSAK   +NV+  F ++VR I
Sbjct:   53 LEILDTAGTEQFTAMRDLYMKNGQGFVLVYSITAQSTFNDLQDLREQILRVKDTDDVPMVLVGNKCDLEDERVVGKDQGQNLAKQFANCTFLETSAK-AKINVNEIFYDLVRQI 165          

HSP 2 Score: 39.2762 bits (90), Expect = 6.558e-22
Identity = 17/31 (54.84%), Postives = 21/31 (67.74%), Query Frame = 1
Query:    1 YFQRTFVEDYDPTIEDTYIQSKEFDGEWCDL 93
            + Q  FVE YDPTIED+Y +  E DG+ C L
Sbjct:   23 FVQGIFVEKYDPTIEDSYRKQVEVDGQQCML 53          
BLAST of Ras-related protein vs. Ensembl Nematostella
Match: EDO36396 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIQ7])

HSP 1 Score: 88.1965 bits (217), Expect = 1.915e-21
Identity = 52/114 (45.61%), Postives = 77/114 (67.54%), Query Frame = 3
Query:  138 VSVLDTAGQDSFSAMRQQYMRKGDGFLVMFSITDRNSFQMVRHLYKDILRTKDKENFPVIIVGNKVDLXXXXXXXXXXXXXXXXXXNVQYMETSAKPPPVNVDNAFLEVVRLIR 479
            + +LDTAGQ  F+AMR+QYMR G+GF++++SITDR+SF +       I R +  ++ P+++VGNK DL  +R+VT +E +ELA   +  + ETSA      VD+AF  +VR IR
Sbjct:   50 LDILDTAGQQEFTAMREQYMRNGEGFIIIYSITDRSSFNLAAQYKDQIERVRRTDDIPIVLVGNKDDLEGKREVTTQEGQELAHRFDCPFFETSACQRHF-VDDAFHGLVREIR 162          
BLAST of Ras-related protein vs. Ensembl Nematostella
Match: EDO45827 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRV2])

HSP 1 Score: 87.8113 bits (216), Expect = 2.644e-21
Identity = 52/116 (44.83%), Postives = 73/116 (62.93%), Query Frame = 3
Query:  132 LNVSVLDTAGQDSFSAMRQQYMRKGDGFLVMFSITDRNSFQMVRHLYKDILRTKDKENFPVIIVGNKVDLXXXXXXXXXXXXXXXXXXNVQYMETSAKPPPVNVDNAFLEVVRLIR 479
              + +LDTAGQ+ ++A+R  Y R G+GFL +FSIT+  SF       + ILR K  +  P ++VGNK DL ++R+VT EE +  A E  V Y+ETSAK    NVD  F +++R IR
Sbjct:   59 CQIDILDTAGQEDYAAIRDNYFRSGEGFLCVFSITEPESFAATTEFREQILRVKGDDKIPFLLVGNKSDLTDKRQVTSEEGQSKADEWGVPYVETSAKTRS-NVDKVFFDLMREIR 173          

HSP 2 Score: 31.187 bits (69), Expect = 2.644e-21
Identity = 13/26 (50.00%), Postives = 17/26 (65.38%), Query Frame = 1
Query:   16 FVEDYDPTIEDTYIQSKEFDGEWCDL 93
            FVEDY+PT  D+Y +    DGE C +
Sbjct:   36 FVEDYEPTKADSYRKKAILDGEECQI 61          
BLAST of Ras-related protein vs. Ensembl Medaka
Match: si:ch73-116o1.2 (muscle RAS oncogene homolog [Source:NCBI gene;Acc:101159234])

HSP 1 Score: 131.724 bits (330), Expect = 1.702e-38
Identity = 68/114 (59.65%), Postives = 90/114 (78.95%), Query Frame = 3
Query:  138 VSVLDTAGQDSFSAMRQQYMRKGDGFLVMFSITDRNSFQMVRHLYKDILRTKDKENFPVIIVGNKVDLXXXXXXXXXXXXXXXXXXNVQYMETSAKPPPVNVDNAFLEVVRLIR 479
            + VLDTAGQ+ FSAMR+QYMR GDGFL++FS+TD+ SF+ V   ++ ILR KD+E FP+++V NKVDL   RKVT E+  E+A + N+ Y+ETSAK PP+NVD AF E+VR+IR
Sbjct:   63 LDVLDTAGQEEFSAMREQYMRTGDGFLIVFSVTDKASFEHVDRFHQLILRVKDREAFPMVLVANKVDLVHLRKVTAEQGHEMAAKHNITYIETSAKDPPMNVDKAFHELVRVIR 176          

HSP 2 Score: 46.9802 bits (110), Expect = 1.702e-38
Identity = 18/31 (58.06%), Postives = 24/31 (77.42%), Query Frame = 1
Query:    1 YFQRTFVEDYDPTIEDTYIQSKEFDGEWCDL 93
            +FQ+ FV DYDPTIED+Y++  E DG+W  L
Sbjct:   33 FFQKIFVPDYDPTIEDSYLKHTEIDGQWAIL 63          
BLAST of Ras-related protein vs. Ensembl Medaka
Match: rras2 (RAS related 2 [Source:NCBI gene;Acc:101162668])

HSP 1 Score: 113.62 bits (283), Expect = 1.459e-30
Identity = 63/114 (55.26%), Postives = 87/114 (76.32%), Query Frame = 3
Query:  138 VSVLDTAGQDSFSAMRQQYMRKGDGFLVMFSITDRNSFQMVRHLYKDILRTKDKENFPVIIVGNKVDLXXXXXXXXXXXXXXXXXXNVQYMETSAKPPPVNVDNAFLEVVRLIR 479
            + +LDTAGQ+ F AMR+QYMR G+GFL++FS+TDR SF+ +    + ILR KD++ FP+I+VGNK DL  +R+V +EE + LA++L V YME SAK   +NVD AF E+VR+IR
Sbjct:   62 LDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILVGNKADLEIQRQVNQEEGQNLARQLKVTYMEASAK-IRMNVDQAFHELVRVIR 174          
BLAST of Ras-related protein vs. Ensembl Medaka
Match: rras (ras-related protein R-Ras [Source:NCBI gene;Acc:101174431])

HSP 1 Score: 107.071 bits (266), Expect = 3.437e-28
Identity = 55/114 (48.25%), Postives = 84/114 (73.68%), Query Frame = 3
Query:  138 VSVLDTAGQDSFSAMRQQYMRKGDGFLVMFSITDRNSFQMVRHLYKDILRTKDKENFPVIIVGNKVDLXXXXXXXXXXXXXXXXXXNVQYMETSAKPPPVNVDNAFLEVVRLIR 479
            + +LDTAGQ+ F AMR+QYMR G+GFL++F++ DR S+  V+  +  ILR KD+++FP+++VGNK DL ++R ++ E+A+  A+E  + YME SAK    NVD  FL++V +IR
Sbjct:   56 LDILDTAGQEEFGAMREQYMRSGEGFLLVFALNDRGSYHEVQKFHTQILRVKDRDDFPMLLVGNKADLEQQRVISSEDAQAFARENRIHYMEASAK-NRYNVDEVFLKLVHIIR 168          
BLAST of Ras-related protein vs. Ensembl Medaka
Match: kras (KRAS proto-oncogene, GTPase [Source:NCBI gene;Acc:100049322])

HSP 1 Score: 92.4337 bits (228), Expect = 1.615e-23
Identity = 53/114 (46.49%), Postives = 78/114 (68.42%), Query Frame = 3
Query:  138 VSVLDTAGQDSFSAMRQQYMRKGDGFLVMFSITDRNSFQMVRHLYKDILRTKDKENFPVIIVGNKVDLXXXXXXXXXXXXXXXXXXNVQYMETSAKPPPVNVDNAFLEVVRLIR 479
            + +LDTAGQ+ +SAMR QYMR G+GFL +F+I +  SF+ + H  + I R KD E+ P+++VGNK DL   R V  ++A++LA+   + ++ETSAK     VD+AF  +VR IR
Sbjct:   53 LDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL-PTRTVDTKQAQDLARSFGIPFIETSAKTRQ-GVDDAFYTLVREIR 164          

HSP 2 Score: 35.8094 bits (81), Expect = 1.615e-23
Identity = 18/37 (48.65%), Postives = 24/37 (64.86%), Query Frame = 1
Query:    4 FQRTFVEDYDPTIEDTYIQSKEFDGEWCDLTGLVDML 114
             Q  FV++YDPTIED+Y +    DGE C    L+D+L
Sbjct:   24 IQNHFVDEYDPTIEDSYRKQVVIDGETC----LLDIL 56          
BLAST of Ras-related protein vs. Ensembl Medaka
Match: ENSORLT00000001678.2 (ras-related protein O-RAL [Source:NCBI gene;Acc:101156149])

HSP 1 Score: 93.5893 bits (231), Expect = 4.993e-23
Identity = 52/116 (44.83%), Postives = 78/116 (67.24%), Query Frame = 3
Query:  132 LNVSVLDTAGQDSFSAMRQQYMRKGDGFLVMFSITDRNSFQMVRHLYKDILRTKDKENFPVIIVGNKVDLXXXXXXXXXXXXXXXXXXNVQYMETSAKPPPVNVDNAFLEVVRLIR 479
            + + +LDTAGQ+ ++A+R  Y R G+GFL++FSIT+  SF       + ILR K++E  P+++VGNK DL + R++T E+A   A E  VQY+ETSAK    NVD  F +++R +R
Sbjct:   62 VQIDILDTAGQEDYAAIRDNYFRSGEGFLLVFSITELESFTATSEFREQILRVKEEEAIPLLLVGNKSDLEDRRQITAEDAASKAGEWGVQYVETSAK-TRANVDKVFFDLMREVR 176          
BLAST of Ras-related protein vs. Planmine SMEST
Match: SMESG000075044.1 (SMESG000075044.1)

HSP 1 Score: 193.356 bits (490), Expect = 1.148e-68
Identity = 112/117 (95.73%), Postives = 115/117 (98.29%), Query Frame = 3
Query:  129 LLNVSVLDTAGQDSFSAMRQQYMRKGDGFLVMFSITDRNSFQMVRHLYKDILRTKDKENFPVIIVGNKVDLXXXXXXXXXXXXXXXXXXNVQYMETSAKPPPVNVDNAFLEVVRLIR 479
              +++VLDTAGQDSFSAMRQQYMRKGDGFLVMFSITDRNSFQMVRHLYKDILRTKDKENFPVIIVGNKVDLAEERKVTEEEAKELAKELNVQYMETSAKPPPVNVDNAFLEVVRLIR
Sbjct:   62 WCDLTVLDTAGQDSFSAMRQQYMRKGDGFLVMFSITDRNSFQMVRHLYKDILRTKDKENFPVIIVGNKVDLAEERKVTEEEAKELAKELNVQYMETSAKPPPVNVDNAFLEVVRLIR 178          

HSP 2 Score: 73.1738 bits (178), Expect = 1.148e-68
Identity = 33/34 (97.06%), Postives = 33/34 (97.06%), Query Frame = 1
Query:    1 YFQRTFVEDYDPTIEDTYIQSKEFDGEWCDLTGL 102
            YFQRTFVEDYDPTIEDTYIQSKEFDGEWCDLT L
Sbjct:   35 YFQRTFVEDYDPTIEDTYIQSKEFDGEWCDLTVL 68          

HSP 3 Score: 33.4982 bits (75), Expect = 1.148e-68
Identity = 25/29 (86.21%), Postives = 27/29 (93.10%), Query Frame = 1
Query:  520 LAIYRRFAHAALANQXXXXXXXXXXCEIV 606
            + + RRFAHAALANQKSRKKSKKTKCEIV
Sbjct:  174 VRLIRRFAHAALANQKSRKKSKKTKCEIV 202          
BLAST of Ras-related protein vs. Planmine SMEST
Match: SMESG000024796.1 (SMESG000024796.1)

HSP 1 Score: 114.39 bits (285), Expect = 1.512e-32
Identity = 58/115 (50.43%), Postives = 88/115 (76.52%), Query Frame = 3
Query:  135 NVSVLDTAGQDSFSAMRQQYMRKGDGFLVMFSITDRNSFQMVRHLYKDILRTKDKENFPVIIVGNKVDLXXXXXXXXXXXXXXXXXXNVQYMETSAKPPPVNVDNAFLEVVRLIR 479
            N+ V DTAGQ+ F++MR+ Y R  +GFL++FS+T R SF++VR  ++  LR++D+++FP+++V NK DL   RKVT  E + LAKEL + Y+ETSAK PP+N+++AF ++VR IR
Sbjct:   52 NLEVQDTAGQEEFASMRESYYRAANGFLIVFSLTTRESFEIVRRFFQSALRSRDRDHFPMLLVANKTDLEMNRKVTTSEIESLAKELQIDYIETSAKNPPINIEDAFSQIVRKIR 166          

HSP 2 Score: 43.5134 bits (101), Expect = 1.512e-32
Identity = 17/31 (54.84%), Postives = 24/31 (77.42%), Query Frame = 1
Query:    1 YFQRTFVEDYDPTIEDTYIQSKEFDGEWCDL 93
            + Q+ FVE++DPTIE TY ++ E DGEW +L
Sbjct:   23 FMQKIFVENHDPTIESTYYKNYEVDGEWSNL 53          
BLAST of Ras-related protein vs. Planmine SMEST
Match: SMESG000017314.1 (SMESG000017314.1)

HSP 1 Score: 90.1225 bits (222), Expect = 7.223e-24
Identity = 51/113 (45.13%), Postives = 80/113 (70.80%), Query Frame = 3
Query:  138 VSVLDTAGQDSFSAMRQQYMRKGDGFLVMFSITDRNSFQMVRHLYKDILRTKDKENFPVIIVGNKVDLXXXXXXXXXXXXXXXXXXNVQYMETSAKPPPVNVDNAFLEVVRLI 476
            + +LDTAG + F+AMR  YM+ G GF++++SIT ++SF  +  L + ILR KD +N P+++VGNK DL ++R V +E+ + LA++ N  +METSAK   +NV+  F ++VR I
Sbjct:   53 LEILDTAGTEQFTAMRDLYMKNGQGFVLVYSITAQSSFNELEDLREQILRVKDTDNVPMVLVGNKCDLEDDRSVGKEQGQVLARKFNCSFMETSAK-NKINVNEIFYDLVRQI 164          

HSP 2 Score: 38.5058 bits (88), Expect = 7.223e-24
Identity = 17/31 (54.84%), Postives = 20/31 (64.52%), Query Frame = 1
Query:    1 YFQRTFVEDYDPTIEDTYIQSKEFDGEWCDL 93
            + Q  FVE YDPTIED+Y +  E DG  C L
Sbjct:   23 FVQGIFVEKYDPTIEDSYRKQVEVDGSQCML 53          
BLAST of Ras-related protein vs. Planmine SMEST
Match: SMESG000075225.1 (SMESG000075225.1)

HSP 1 Score: 87.0409 bits (214), Expect = 4.234e-23
Identity = 49/113 (43.36%), Postives = 74/113 (65.49%), Query Frame = 3
Query:  132 LNVSVLDTAGQDSFSAMRQQYMRKGDGFLVMFSITDRNSFQMVRHLYKDILRTKDKENFPVIIVGNKVDLXXXXXXXXXXXXXXXXXXNVQYMETSAKPPPVNVDNAFLEVVR 470
              + +LDTAGQ+ +SAMR QYMR G+GFL +F++ ++ SF+ + +    + R KD E  P+++VGNKVDL   R V +   K +A++ ++ Y+ETSAK     VD AF  +VR
Sbjct:   51 CQLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAVNNQKSFEEIPNYRDRVKRVKDAEEIPMVLVGNKVDL-ANRTVIKTTGKAMAEDFSIPYVETSAKTRE-GVDEAFYTLVR 161          

HSP 2 Score: 38.891 bits (89), Expect = 4.234e-23
Identity = 17/30 (56.67%), Postives = 20/30 (66.67%), Query Frame = 1
Query:    4 FQRTFVEDYDPTIEDTYIQSKEFDGEWCDL 93
             Q  FVE+YDPTIED+Y +    DGE C L
Sbjct:   24 IQNHFVEEYDPTIEDSYRKQMMIDGETCQL 53          
BLAST of Ras-related protein vs. Planmine SMEST
Match: SMESG000016219.1 (SMESG000016219.1)

HSP 1 Score: 91.6633 bits (226), Expect = 2.091e-22
Identity = 53/116 (45.69%), Postives = 75/116 (64.66%), Query Frame = 3
Query:  132 LNVSVLDTAGQDSFSAMRQQYMRKGDGFLVMFSITDRNSFQMVRHLYKDILRTKDKENFPVIIVGNKVDLXXXXXXXXXXXXXXXXXXNVQYMETSAKPPPVNVDNAFLEVVRLIR 479
            + + +LDTAGQ+ +  +R  Y R G+GF+ +FSITD  S +      + ILR K  EN P I+VGNK+DL  +  VT EEA+ELA + NV Y+ETSAK    NVD  + +++R I+
Sbjct:   59 VQIDILDTAGQEDYVGIRDHYFRTGEGFMCVFSITDHASLEAASEFREQILRVKSNENVPFILVGNKIDLRSQSVVTSEEARELANKWNVDYIETSAKTKE-NVDRVYFQLLRDIQ 173          
The following BLAST results are available for this feature:
BLAST of Ras-related protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MRAS8.235e-3758.77muscle RAS oncogene homolog [Source:HGNC Symbol;Ac... [more]
MRAS8.235e-3758.77muscle RAS oncogene homolog [Source:HGNC Symbol;Ac... [more]
MRAS8.235e-3758.77muscle RAS oncogene homolog [Source:HGNC Symbol;Ac... [more]
RRAS27.647e-3154.78RAS related 2 [Source:HGNC Symbol;Acc:HGNC:17271][more]
RRAS21.372e-3055.26RAS related 2 [Source:HGNC Symbol;Acc:HGNC:17271][more]
back to top
BLAST of Ras-related protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ras-22.040e-3458.04GTP binding protein; R-RAS related [Source:UniPro... [more]
ras-22.040e-3458.04GTP binding protein; R-RAS related [Source:UniPro... [more]
ras-14.327e-3253.85GTP binding protein; R-RAS related; R-ras1 homolog... [more]
let-601.033e-2143.86Ras protein let-60 [Source:UniProtKB/Swiss-Prot;A... [more]
rap-13.939e-2142.48Ras-related protein Rap-1 [Source:UniProtKB/Swiss... [more]
back to top
BLAST of Ras-related protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ras64B7.681e-2846.40gene:FBgn0003206 transcript:FBtr0073212[more]
Rap12.026e-2346.90gene:FBgn0004636 transcript:FBtr0303154[more]
Rap12.026e-2346.90gene:FBgn0004636 transcript:FBtr0072867[more]
Rap12.026e-2346.90gene:FBgn0004636 transcript:FBtr0332671[more]
Rala3.031e-2345.69gene:FBgn0015286 transcript:FBtr0070583[more]
back to top
BLAST of Ras-related protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch73-116o1.26.960e-3858.77si:ch73-116o1.2 [Source:ZFIN;Acc:ZDB-GENE-110411-6... [more]
MRAS6.960e-3858.77si:ch73-116o1.2 [Source:ZFIN;Acc:ZDB-GENE-110411-6... [more]
mras7.435e-3857.89muscle RAS oncogene homolog [Source:ZFIN;Acc:ZDB-G... [more]
mras7.454e-3857.89muscle RAS oncogene homolog [Source:ZFIN;Acc:ZDB-G... [more]
rras25.265e-3155.65RAS related 2 [Source:ZFIN;Acc:ZDB-GENE-050417-352... [more]
back to top
BLAST of Ras-related protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
thbs31.084e-3759.65thrombospondin 3 [Source:Xenbase;Acc:XB-GENE-57619... [more]
tle12.007e-2853.51transducin like enhancer of split 1 [Source:Xenbas... [more]
rpp381.350e-2347.41ribonuclease P/MRP 38kDa subunit [Source:Xenbase;A... [more]
krasl2.040e-2346.49Kirsten rat sarcoma viral oncogene homolog like [S... [more]
krasl9.036e-2345.61Kirsten rat sarcoma viral oncogene homolog like [S... [more]
back to top
BLAST of Ras-related protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mras3.452e-3657.89muscle and microspikes RAS [Source:MGI Symbol;Acc:... [more]
Mras3.452e-3657.89muscle and microspikes RAS [Source:MGI Symbol;Acc:... [more]
Mras3.452e-3657.89muscle and microspikes RAS [Source:MGI Symbol;Acc:... [more]
Rras21.696e-3054.78related RAS viral (r-ras) oncogene 2 [Source:MGI S... [more]
Rras4.226e-2849.12related RAS viral (r-ras) oncogene [Source:MGI Sym... [more]
back to top
BLAST of Ras-related protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O14807|RASM_HUMAN3.485e-3658.77Ras-related protein M-Ras OS=Homo sapiens OX=9606 ... [more]
sp|O08989|RASM_MOUSE2.008e-3557.89Ras-related protein M-Ras OS=Mus musculus OX=10090... [more]
sp|P97538|RASM_RAT2.145e-3557.89Ras-related protein M-Ras OS=Rattus norvegicus OX=... [more]
sp|P62071|RRAS2_MOUSE1.186e-2954.78Ras-related protein R-Ras2 OS=Mus musculus OX=1009... [more]
sp|P62070|RRAS2_HUMAN1.186e-2954.78Ras-related protein R-Ras2 OS=Homo sapiens OX=9606... [more]
back to top
BLAST of Ras-related protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
R7U6361.576e-3863.16Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A210Q3234.147e-3858.77Ras-related protein M-Ras OS=Mizuhopecten yessoens... [more]
A0A1S3JDF11.013e-3760.53ras-related protein M-Ras-like OS=Lingula unguis O... [more]
A0A1S3JBY11.128e-3760.53ras-related protein M-Ras-like isoform X1 OS=Lingu... [more]
A0A212FEK51.342e-3759.65Ras-related protein M-Ras OS=Danaus plexippus plex... [more]
back to top
BLAST of Ras-related protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch73-116o1.26.979e-3857.89muscle RAS oncogene homolog [Source:HGNC Symbol;Ac... [more]
mras7.900e-3857.89ras-related protein M-Ras [Source:NCBI gene;Acc:10... [more]
rras27.007e-3153.91RAS related 2 [Source:NCBI gene;Acc:103027563][more]
rras5.333e-2951.75RAS related [Source:ZFIN;Acc:ZDB-GENE-041010-217][more]
kras1.334e-2346.49GTPase KRas [Source:NCBI gene;Acc:103038241][more]
back to top
BLAST of Ras-related protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000005561.12.619e-3855.26pep scaffold:Pmarinus_7.0:GL481089:12431:17765:1 g... [more]
mras2.965e-3856.25muscle RAS oncogene homolog [Source:ZFIN;Acc:ZDB-G... [more]
ENSPMAT00000000518.13.497e-3856.14pep scaffold:Pmarinus_7.0:GL479781:11597:21619:-1 ... [more]
hrasb2.621e-2244.74HRas proto-oncogene, GTPase b [Source:ZFIN;Acc:ZDB... [more]
ralba3.092e-2143.10v-ral simian leukemia viral oncogene homolog Ba (r... [more]
back to top
BLAST of Ras-related protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
RAS19.143e-2852.68GTPase involved in G-protein signaling in adenylat... [more]
RAS24.180e-2546.43GTP-binding protein; regulates nitrogen starvation... [more]
RSR13.167e-1640.17GTP-binding protein of the Ras superfamily; requir... [more]
GSP17.210e-1131.19Ran GTPase; GTP binding protein (mammalian Ranp ho... [more]
GSP28.437e-1131.19GTP binding protein (mammalian Ranp homolog); invo... [more]
back to top
BLAST of Ras-related protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO391712.386e-3353.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO329142.094e-2347.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO390476.558e-2242.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO363961.915e-2145.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458272.644e-2144.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ras-related protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch73-116o1.21.702e-3859.65muscle RAS oncogene homolog [Source:NCBI gene;Acc:... [more]
rras21.459e-3055.26RAS related 2 [Source:NCBI gene;Acc:101162668][more]
rras3.437e-2848.25ras-related protein R-Ras [Source:NCBI gene;Acc:10... [more]
kras1.615e-2346.49KRAS proto-oncogene, GTPase [Source:NCBI gene;Acc:... [more]
ENSORLT00000001678.24.993e-2344.83ras-related protein O-RAL [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Ras-related protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000075044.11.148e-6895.73SMESG000075044.1[more]
SMESG000024796.11.512e-3250.43SMESG000024796.1[more]
SMESG000017314.17.223e-2445.13SMESG000017314.1[more]
SMESG000075225.14.234e-2343.36SMESG000075225.1[more]
SMESG000016219.12.091e-2245.69SMESG000016219.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024514 ID=SMED30024514|Name=Ras-related protein|organism=Schmidtea mediterranea sexual|type=transcript|length=781bp
TACTTTCAACGGACATTTGTTGAAGATTATGACCCTACAATCGAAGATAC
ATATATTCAAAGCAAAGAATTCGATGGAGAATGGTGTGACCTTACTGGTT
TGGTAGATATGTTGCGGCGCTGAAGTAGTTATTAAATGTTTCAGTGTTGG
ACACTGCTGGTCAAGATTCATTCAGTGCAATGCGTCAACAGTATATGCGG
AAAGGTGACGGATTTCTAGTCATGTTTTCAATTACTGATCGAAACAGTTT
CCAAATGGTTAGACACCTTTATAAAGATATTCTCAGAACGAAAGACAAAG
AAAATTTCCCGGTTATCATTGTTGGAAACAAAGTCGATTTAGCGGAAGAA
AGAAAAGTCACAGAAGAGGAAGCGAAAGAATTGGCAAAGGAATTGAACGT
TCAATATATGGAAACGAGTGCCAAGCCACCGCCGGTAAATGTCGATAATG
CATTCTTGGAAGTTGTCAGATTAATCAGGTTCATTTTAATTAGCATTAAG
ATTTTGGCAGAAACATTATCTAGCTATTTACAGACGCTTTGCGCATGCCG
CACTCGCCAATCAGAAATCGAGAAAAAAATCGAAAAAAACAAAATGTGAA
ATAGTTTGAAGATTTTTGAGATTTTTCATTGAATCTCTTAGAATTATTCT
CGATTGTTTTGTTTTTTGGATTTTATATGCAGGGGATTATTGTCTATGAA
TATATTTTAATACACTTTTCCTTTAATTGTCATATTTTCTGTTTAGATTT
GATTGGTTCTTGTATGCAGATCATAATTAAT
back to top

protein sequence of SMED30024514-orf-1

>SMED30024514-orf-1 ID=SMED30024514-orf-1|Name=SMED30024514-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=140bp
MRQQYMRKGDGFLVMFSITDRNSFQMVRHLYKDILRTKDKENFPVIIVGN
KVDLAEERKVTEEEAKELAKELNVQYMETSAKPPPVNVDNAFLEVVRLIR
FILISIKILAETLSSYLQTLCACRTRQSEIEKKIEKNKM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003924GTPase activity
GO:0005525GTP binding
GO:0000166nucleotide binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000418head
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR027417P-loop_NTPase
IPR001806Small_GTPase
IPR020849Small_GTPase_Ras-type
Vocabulary: biological process
TermDefinition
GO:0007264small GTPase mediated signal transduction
GO:0007165signal transduction
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005622intracellular
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 51..82
NoneNo IPR availableSMARTSM00173ras_sub_4coord: 1..102
e-value: 6.5E-21
score: 85.5
NoneNo IPR availableSMARTSM00175rab_sub_5coord: 1..102
e-value: 6.3E-9
score: 1.8
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 1..102
e-value: 2.4E-34
score: 120.4
NoneNo IPR availablePANTHERPTHR24070:SF268RAS-RELATED PROTEIN M-RAScoord: 1..101
IPR001806Small GTPasePFAMPF00071Rascoord: 1..99
e-value: 1.6E-28
score: 99.3
IPR020849Small GTPase superfamily, Ras-typePANTHERPTHR24070FAMILY NOT NAMEDcoord: 1..101
IPR020849Small GTPase superfamily, Ras-typePROSITEPS51421RAScoord: 1..139
score: 22.826
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 1..111