cytoplasmic poly(A) binding protein

Overview
Namecytoplasmic poly(A) binding protein (ADG08184.1)
Smed IDSMED30024486
Length (bp)2452
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of cytoplasmic poly(A) binding protein (SMED30024486) t-SNE clustered cells

Violin plots show distribution of expression levels for cytoplasmic poly(A) binding protein (SMED30024486) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of cytoplasmic poly(A) binding protein (SMED30024486) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for cytoplasmic poly(A) binding protein (SMED30024486) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024486

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30024486SMESG000004978.1 SmedASXL_017868SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30024486SMESG000004978.1 dd_Smed_v4_11729_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
oocyteSMED30024486SMESG000028724.1 Contig4801GPL15192PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30024486SMESG000028724.1 Contig4801GPL15192PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
oocyteSMED30024486SMESG000004978.1 Contig4801GPL15192PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30024486SMESG000004978.1 Contig4801GPL15192PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
zeta neoblastSMED30024486SMESG000004978.1 dd_Smed_v4_11729_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
oocyteSMED30024486SMESG000004978.1 HM100651smed_ncbi_20200123PMID:20844018
Wang et al., 2010
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30024486SMESG000004978.1 HM100651smed_ncbi_20200123PMID:20844018
Wang et al., 2010
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
spermatocyteSMED30024486SMESG000004978.1 HM100651smed_ncbi_20200123PMID:20844018
Wang et al., 2010
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
spermatidSMED30024486SMESG000004978.1 HM100651smed_ncbi_20200123PMID:20844018
Wang et al., 2010
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
oogonial cellSMED30024486SMESG000004978.1 HM100651smed_ncbi_20200123PMID:20844018
Wang et al., 2010
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testis primordiumSMED30024486SMESG000004978.1 PL06020A1E09_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
testis primordiumSMED30024486SMESG000004978.1 Contig4801_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of cytoplasmic poly(A) binding protein vs. Ensembl Human
Match: PABPC1 (poly(A) binding protein cytoplasmic 1 [Source:HGNC Symbol;Acc:HGNC:8554])

HSP 1 Score: 646.736 bits (1667), Expect = 0.000e+0
Identity = 364/674 (54.01%), Postives = 436/674 (64.69%), Query Frame = 2
Query:  143 SIPMASLYVGDLHPEVTEAMIYEKFSSCGPVLSIRVCRDMITRKSLGYAYVNFQNAADAESALDRMNFDTMKGRSIRIMWSQRDPSLRKSGIGNIFIKNLDKSITQKELHDTFVAFGNILSCKIAADERSKSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVGRFIPRTNR-ANSDSDVK-FTNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDRKAHLASQYMQRVNPHRNNYPNQVSVNTXXXXXXXXXXXXXXYAFAPN-----ASTPRVYTQSAAFMP-------PQNRWS---NRMHPSQLQFNGGNMRQLA-NAHFGNMEGSSVPIQNNTMGMQANQIRQVSMIPNQRPMLXXXXXXXXXXXXXXGVANTVKSAPQNSRPITGVQMPITSQASNISQQRPPNQPTRQITGQSVISGNQNVNRPINNGSNQLVSGNLEPLTISTLASAPIAEQKQMLGERLYPLVHRMYPELAGKITGMLLEIDNTELLHMLESEDSLTTKIEEAMNVLQSHK 2110
            S PMASLYVGDLHP+VTEAM+YEKFS  GP+LSIRVCRDMITR+SLGYAYVNFQ  ADAE ALD MNFD +KG+ +RIMWSQRDPSLRKSG+GNIFIKNLDKSI  K L+DTF AFGNILSCK+  DE   SKGYGFVHFET+ AA  AI+ +NGML+ ++KVFVGRF  R  R A   +  K FTN YIKNFGED+DDE+L+++F +FG   S KVM DE+GKSKGFGFV F+  E A+ AV  +NGK    +Q+YVGRAQKK ER  EL+  FE+ + +R +RY QGVNLYVKNLDD IDD RL++EF  FG ITSAKVM +   RSKGFGFVCFS+PEEATKAVTEMNG+I  +KPLYVALAQRKE+R+AHL +QYMQR+   R   PN V +N               Y  AP      A+ P+   ++A + P       P  RW+    R HP   Q   G +R  A    F  M  +S  +       +       +M P  RP  +  A               V++ PQ      GV+ P   Q  N   Q    QP   + GQ                         EPLT S LASAP  EQKQMLGERL+PL+  M+P LAGKITGMLLEIDN+ELLHMLES +SL +K++EA+ VLQ+H+
Sbjct:    7 SYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFVGRFKSRKEREAELGARAKEFTNVYIKNFGEDMDDERLKDLFGKFGPALSVKVMTDESGKSKGFGFVSFERHEDAQKAVDEMNGKELNGKQIYVGRAQKKVERQTELKRKFEQMKQDRITRY-QGVNLYVKNLDDGIDDERLRKEFSPFGTITSAKVMME-GGRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEERQAHLTNQYMQRMASVR-AVPNPV-INP--------------YQPAPPSGYFMAAIPQTQNRAAYYPPSQIAQLRPSPRWTAQGARPHP--FQNMPGAIRPAAPRPPFSTMRPASSQVPRVMSTQRVANTSTQTMGP--RPAAAAAAATP-----------AVRTVPQYKY-AAGVRNP--QQHLNAQPQVTMQQPAVHVQGQ-------------------------EPLTASMLASAPPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQ 618          

HSP 2 Score: 197.208 bits (500), Expect = 3.853e-53
Identity = 113/297 (38.05%), Postives = 168/297 (56.57%), Query Frame = 2
Query:  392 DPSLRKSGIGNIFIKNLDKSITQKELHDTFVAFGNILSCKIAADERS-KSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVGRFIPRTNRANSDSDVKFTNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDRKAHLASQYMQ 1279
            +PS     + ++++ +L   +T+  L++ F   G ILS ++  D  + +S GY +V+F+  A A  A+D +N  +IK K V     I  + R  S       N +IKN  + +D++ L + F  FG I S KV+ DENG SKG+GFV F+  E AE A++ +NG +  DR+++VGR + + ER            AE  +R  +  N+Y+KN  + +DD RLK  F  FG   S KVMTD + +SKGFGFV F   E+A KAV EMNGK    K +YV  AQ+K +R+  L  ++ Q
Sbjct:    2 NPSAPSYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPV----RIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFVGRFKSRKER-----------EAELGARAKEFTNVYIKNFGEDMDDERLKDLFGKFGPALSVKVMTDESGKSKGFGFVSFERHEDAQKAVDEMNGKELNGKQIYVGRAQKKVERQTELKRKFEQ 282          
BLAST of cytoplasmic poly(A) binding protein vs. Ensembl Human
Match: PABPC1 (poly(A) binding protein cytoplasmic 1 [Source:HGNC Symbol;Acc:HGNC:8554])

HSP 1 Score: 575.859 bits (1483), Expect = 0.000e+0
Identity = 338/674 (50.15%), Postives = 408/674 (60.53%), Query Frame = 2
Query:  143 SIPMASLYVGDLHPEVTEAMIYEKFSSCGPVLSIRVCRDMITRKSLGYAYVNFQNAADAESALDRMNFDTMKGRSIRIMWSQRDPSLRKSGIGNIFIKNLDKSITQKELHDTFVAFGNILSCKIAADERSKSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVGRFIPRTNR-ANSDSDVK-FTNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDRKAHLASQYMQRVNPHRNNYPNQVSVNTXXXXXXXXXXXXXXYAFAPN-----ASTPRVYTQSAAFMP-------PQNRWS---NRMHPSQLQFNGGNMRQLA-NAHFGNMEGSSVPIQNNTMGMQANQIRQVSMIPNQRPMLXXXXXXXXXXXXXXGVANTVKSAPQNSRPITGVQMPITSQASNISQQRPPNQPTRQITGQSVISGNQNVNRPINNGSNQLVSGNLEPLTISTLASAPIAEQKQMLGERLYPLVHRMYPELAGKITGMLLEIDNTELLHMLESEDSLTTKIEEAMNVLQSHK 2110
            S PMASLYVGDLHP+VTEAM+YEKFS  GP+LSIRVCRDMITR+SLGYAYVNFQ  ADAE ALD MNFD +KG+ +RIMWSQRDPSLRKSG+                                  DE   SKGYGFVHFET+ AA  AI+ +NGML+ ++KVFVGRF  R  R A   +  K FTN YIKNFGED+DDE+L+++F +FG   S KVM DE+GKSKGFGFV F+  E A+ AV  +NGK    +Q+YVGRAQKK ER  EL+  FE+ + +R +RY QGVNLYVKNLDD IDD RL++EF  FG ITSAKVM +   RSKGFGFVCFS+PEEATKAVTEMNG+I  +KPLYVALAQRKE+R+AHL +QYMQR+   R   PN V +N               Y  AP      A+ P+   ++A + P       P  RW+    R HP   Q   G +R  A    F  M  +S  +       +       +M P  RP  +  A               V++ PQ      GV+ P   Q  N   Q    QP   + GQ                         EPLT S LASAP  EQKQMLGERL+PL+  M+P LAGKITGMLLEIDN+ELLHMLES +SL +K++EA+ VLQ+H+
Sbjct:    7 SYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPVRIMWSQRDPSLRKSGV--------------------------------VCDENG-SKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFVGRFKSRKEREAELGARAKEFTNVYIKNFGEDMDDERLKDLFGKFGPALSVKVMTDESGKSKGFGFVSFERHEDAQKAVDEMNGKELNGKQIYVGRAQKKVERQTELKRKFEQMKQDRITRY-QGVNLYVKNLDDGIDDERLRKEFSPFGTITSAKVMME-GGRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEERQAHLTNQYMQRMASVR-AVPNPV-INP--------------YQPAPPSGYFMAAIPQTQNRAAYYPPSQIAQLRPSPRWTAQGARPHP--FQNMPGAIRPAAPRPPFSTMRPASSQVPRVMSTQRVANTSTQTMGP--RPAAAAAAATP-----------AVRTVPQYKY-AAGVRNP--QQHLNAQPQVTMQQPAVHVQGQ-------------------------EPLTASMLASAPPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQ 586          
BLAST of cytoplasmic poly(A) binding protein vs. Ensembl Human
Match: PABPC1 (poly(A) binding protein cytoplasmic 1 [Source:HGNC Symbol;Acc:HGNC:8554])

HSP 1 Score: 572.007 bits (1473), Expect = 0.000e+0
Identity = 331/635 (52.13%), Postives = 401/635 (63.15%), Query Frame = 2
Query:  260 MITRKSLGYAYVNFQNAADAESALDRMNFDTMKGRSIRIMWSQRDPSLRKSGIGNIFIKNLDKSITQKELHDTFVAFGNILSCKIAADERSKSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVGRFIPRTNR-ANSDSDVK-FTNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDRKAHLASQYMQRVNPHRNNYPNQVSVNTXXXXXXXXXXXXXXYAFAPN-----ASTPRVYTQSAAFMP-------PQNRWS---NRMHPSQLQFNGGNMRQLA-NAHFGNMEGSSVPIQNNTMGMQANQIRQVSMIPNQRPMLXXXXXXXXXXXXXXGVANTVKSAPQNSRPITGVQMPITSQASNISQQRPPNQPTRQITGQSVISGNQNVNRPINNGSNQLVSGNLEPLTISTLASAPIAEQKQMLGERLYPLVHRMYPELAGKITGMLLEIDNTELLHMLESEDSLTTKIEEAMNVLQSHK 2110
            MITR+SLGYAYVNFQ  ADAE ALD MNFD +KG+ +RIMWSQRDPSLRKSG+GNIFIKNLDKSI  K L+DTF AFGNILSCK+  DE   SKGYGFVHFET+ AA  AI+ +NGML+ ++KVFVGRF  R  R A   +  K FTN YIKNFGED+DDE+L+++F +FG   S KVM DE+GKSKGFGFV F+  E A+ AV  +NGK    +Q+YVGRAQKK ER  EL+  FE+ + +R +RY QGVNLYVKNLDD IDD RL++EF  FG ITSAKVM +   RSKGFGFVCFS+PEEATKAVTEMNG+I  +KPLYVALAQRKE+R+AHL +QYMQR+   R   PN V +N               Y  AP      A+ P+   ++A + P       P  RW+    R HP   Q   G +R  A    F  M  +S  +       +       +M P  RP  +  A               V++ PQ  +   GV+ P   Q  N   Q    QP   + GQ                         EPLT S LASAP  EQKQMLGERL+PL+  M+P LAGKITGMLLEIDN+ELLHMLES +SL +K++EA+ VLQ+H+
Sbjct:    1 MITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFVGRFKSRKEREAELGARAKEFTNVYIKNFGEDMDDERLKDLFGKFGPALSVKVMTDESGKSKGFGFVSFERHEDAQKAVDEMNGKELNGKQIYVGRAQKKVERQTELKRKFEQMKQDRITRY-QGVNLYVKNLDDGIDDERLRKEFSPFGTITSAKVMME-GGRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEERQAHLTNQYMQRMASVR-AVPNPV-INP--------------YQPAPPSGYFMAAIPQTQNRAAYYPPSQIAQLRPSPRWTAQGARPHP--FQNMPGAIRPAAPRPPFSTMRPASSQVPRVMSTQRVANTSTQTMGP--RPAAAAAAATP-----------AVRTVPQ-YKYAAGVRNP--QQHLNAQPQVTMQQPAVHVQGQ-------------------------EPLTASMLASAPPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQ 573          
BLAST of cytoplasmic poly(A) binding protein vs. Ensembl Human
Match: PABPC4 (poly(A) binding protein cytoplasmic 4 [Source:HGNC Symbol;Acc:HGNC:8557])

HSP 1 Score: 547.354 bits (1409), Expect = 0.000e+0
Identity = 267/388 (68.81%), Postives = 312/388 (80.41%), Query Frame = 2
Query:  128 NQINNSIPMASLYVGDLHPEVTEAMIYEKFSSCGPVLSIRVCRDMITRKSLGYAYVNFQNAADAESALDRMNFDTMKGRSIRIMWSQRDPSLRKSGIGNIFIKNLDKSITQKELHDTFVAFGNILSCKIAADERSKSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVGRFIPRTNR-ANSDSDVK-FTNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDRKAHLASQYMQRV 1285
            N   +S PMASLYVGDLH +VTEAM+YEKFS  GPVLSIRVCRDMITR+SLGYAYVNFQ  ADAE ALD MNFD +KG+ IRIMWSQRDPSLRKSG+GN+FIKNLDKSI  K L+DTF AFGNILSCK+  DE   SKGY FVHFET+ AA  AI+ +NGML+ ++KVFVGRF  R  R A   +  K FTN YIKNFGE++DDE L+E+F +FG+  S KVM D NGKSKGFGFV ++  E A  AV+ +NGK    + ++VGRAQKK ER  EL+  FE+ + ER SRY QGVNLY+KNLDD+IDD +L++EF  FG+ITSAKVM + + RSKGFGFVCFS+PEEATKAVTEMNG+I GSKPLYVALAQRKE+RKAHL +QYMQRV
Sbjct:    2 NAAASSYPMASLYVGDLHSDVTEAMLYEKFSPAGPVLSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPIRIMWSQRDPSLRKSGVGNVFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYAFVHFETQEAADKAIEKMNGMLLNDRKVFVGRFKSRKEREAELGAKAKEFTNVYIKNFGEEVDDESLKELFSQFGKTLSVKVMRDPNGKSKGFGFVSYEKHEDANKAVEEMNGKEISGKIIFVGRAQKKVERQAELKRKFEQLKQERISRY-QGVNLYIKNLDDTIDDEKLRKEFSPFGSITSAKVMLE-DGRSKGFGFVCFSSPEEATKAVTEMNGRIVGSKPLYVALAQRKEERKAHLTNQYMQRV 386          

HSP 2 Score: 114.005 bits (284), Expect = 1.648e-25
Identity = 54/86 (62.79%), Postives = 67/86 (77.91%), Query Frame = 2
Query: 1883 EPLTISTLASAPIAEQKQMLGERLYPLVHRMYPELAGKITGMLLEIDNTELLHMLESEDSLTTKIEEAMNVLQSHKNQNVIVTDMG 2140
            EPLT S LA+AP  EQKQMLGERL+PL+  M+  LAGKITGMLLEIDN+ELLHMLES +SL +K++EA+ VLQ+H  +      +G
Sbjct:  539 EPLTASMLAAAPPQEQKQMLGERLFPLIQTMHSNLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHHAKKEAAQKVG 624          
BLAST of cytoplasmic poly(A) binding protein vs. Ensembl Human
Match: PABPC4 (poly(A) binding protein cytoplasmic 4 [Source:HGNC Symbol;Acc:HGNC:8557])

HSP 1 Score: 547.354 bits (1409), Expect = 0.000e+0
Identity = 267/388 (68.81%), Postives = 312/388 (80.41%), Query Frame = 2
Query:  128 NQINNSIPMASLYVGDLHPEVTEAMIYEKFSSCGPVLSIRVCRDMITRKSLGYAYVNFQNAADAESALDRMNFDTMKGRSIRIMWSQRDPSLRKSGIGNIFIKNLDKSITQKELHDTFVAFGNILSCKIAADERSKSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVGRFIPRTNR-ANSDSDVK-FTNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDRKAHLASQYMQRV 1285
            N   +S PMASLYVGDLH +VTEAM+YEKFS  GPVLSIRVCRDMITR+SLGYAYVNFQ  ADAE ALD MNFD +KG+ IRIMWSQRDPSLRKSG+GN+FIKNLDKSI  K L+DTF AFGNILSCK+  DE   SKGY FVHFET+ AA  AI+ +NGML+ ++KVFVGRF  R  R A   +  K FTN YIKNFGE++DDE L+E+F +FG+  S KVM D NGKSKGFGFV ++  E A  AV+ +NGK    + ++VGRAQKK ER  EL+  FE+ + ER SRY QGVNLY+KNLDD+IDD +L++EF  FG+ITSAKVM + + RSKGFGFVCFS+PEEATKAVTEMNG+I GSKPLYVALAQRKE+RKAHL +QYMQRV
Sbjct:    2 NAAASSYPMASLYVGDLHSDVTEAMLYEKFSPAGPVLSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPIRIMWSQRDPSLRKSGVGNVFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYAFVHFETQEAADKAIEKMNGMLLNDRKVFVGRFKSRKEREAELGAKAKEFTNVYIKNFGEEVDDESLKELFSQFGKTLSVKVMRDPNGKSKGFGFVSYEKHEDANKAVEEMNGKEISGKIIFVGRAQKKVERQAELKRKFEQLKQERISRY-QGVNLYIKNLDDTIDDEKLRKEFSPFGSITSAKVMLE-DGRSKGFGFVCFSSPEEATKAVTEMNGRIVGSKPLYVALAQRKEERKAHLTNQYMQRV 386          

HSP 2 Score: 114.005 bits (284), Expect = 1.558e-25
Identity = 54/86 (62.79%), Postives = 67/86 (77.91%), Query Frame = 2
Query: 1883 EPLTISTLASAPIAEQKQMLGERLYPLVHRMYPELAGKITGMLLEIDNTELLHMLESEDSLTTKIEEAMNVLQSHKNQNVIVTDMG 2140
            EPLT S LA+AP  EQKQMLGERL+PL+  M+  LAGKITGMLLEIDN+ELLHMLES +SL +K++EA+ VLQ+H  +      +G
Sbjct:  523 EPLTASMLAAAPPQEQKQMLGERLFPLIQTMHSNLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHHAKKEAAQKVG 608          
BLAST of cytoplasmic poly(A) binding protein vs. Ensembl Celegans
Match: pab-1 (Polyadenylate-binding protein [Source:UniProtKB/TrEMBL;Acc:Q7K797])

HSP 1 Score: 511.146 bits (1315), Expect = 7.079e-172
Identity = 250/394 (63.45%), Postives = 303/394 (76.90%), Query Frame = 2
Query:  128 NQINNSIPMASLYVGDLHPEVTEAMIYEKFSSCGPVLSIRVCRDMITRKSLGYAYVNFQNAADAESALDRMNFDTMKGRSIRIMWSQRDPSLRKSGIGNIFIKNLDKSITQKELHDTFVAFGNILSCKIAADERSKSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVGRFIPRT--NRANSDSDVKFTNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFK--DRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDRKAHLASQYMQRVNPHR 1297
            NQ  +S  MASLYVGDLHP+V E++++EKFS+ GPVLSIRVCRD  TR SLGYAYVNFQ  ADAE A+D MNF+ + G+ +RIMWSQRDP++R+SG GNIFIKNLDK I  K ++DTF  FGNILSCK+A DE   SKGYGFVHFETE AA NAI  +NGML+  KKVFVG+F PR   NR   ++  +FTN Y+KNFG+  + E L ++F +FG ITS +VM  E GKSKGFGFV F + E AE+AV+AL+    +  D +L+V RAQKK+ER  EL+   E+ +AER  +Y QGVNLYVKNLD+++DD  LK++F  +GNITSAKVMTD N RSKGFGFVCF  PEEAT AVTEMN K+  SKPLYVA+AQRKEDR+A LASQYMQR+   R
Sbjct:   23 NQTGSSYTMASLYVGDLHPDVNESILFEKFSAAGPVLSIRVCRDNATRLSLGYAYVNFQQPADAERAMDTMNFEALHGKPMRIMWSQRDPAMRRSGAGNIFIKNLDKVIDNKSIYDTFSLFGNILSCKVAIDEDGFSKGYGFVHFETEEAAQNAIQKVNGMLLAGKKVFVGKFQPRAQRNRELGETAKQFTNVYVKNFGDHYNKETLEKLFAKFGNITSCEVMTVE-GKSKGFGFVAFANPEEAETAVQALHDSTIEGTDLKLHVCRAQKKSERHAELKKKHEQHKAERMQKY-QGVNLYVKNLDETVDDDGLKKQFESYGNITSAKVMTDENGRSKGFGFVCFEKPEEATSAVTEMNSKMVCSKPLYVAIAQRKEDRRAQLASQYMQRLASMR 414          
BLAST of cytoplasmic poly(A) binding protein vs. Ensembl Celegans
Match: pab-1 (Polyadenylate-binding protein [Source:UniProtKB/TrEMBL;Acc:Q7K797])

HSP 1 Score: 511.146 bits (1315), Expect = 7.079e-172
Identity = 250/394 (63.45%), Postives = 303/394 (76.90%), Query Frame = 2
Query:  128 NQINNSIPMASLYVGDLHPEVTEAMIYEKFSSCGPVLSIRVCRDMITRKSLGYAYVNFQNAADAESALDRMNFDTMKGRSIRIMWSQRDPSLRKSGIGNIFIKNLDKSITQKELHDTFVAFGNILSCKIAADERSKSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVGRFIPRT--NRANSDSDVKFTNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFK--DRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDRKAHLASQYMQRVNPHR 1297
            NQ  +S  MASLYVGDLHP+V E++++EKFS+ GPVLSIRVCRD  TR SLGYAYVNFQ  ADAE A+D MNF+ + G+ +RIMWSQRDP++R+SG GNIFIKNLDK I  K ++DTF  FGNILSCK+A DE   SKGYGFVHFETE AA NAI  +NGML+  KKVFVG+F PR   NR   ++  +FTN Y+KNFG+  + E L ++F +FG ITS +VM  E GKSKGFGFV F + E AE+AV+AL+    +  D +L+V RAQKK+ER  EL+   E+ +AER  +Y QGVNLYVKNLD+++DD  LK++F  +GNITSAKVMTD N RSKGFGFVCF  PEEAT AVTEMN K+  SKPLYVA+AQRKEDR+A LASQYMQR+   R
Sbjct:   23 NQTGSSYTMASLYVGDLHPDVNESILFEKFSAAGPVLSIRVCRDNATRLSLGYAYVNFQQPADAERAMDTMNFEALHGKPMRIMWSQRDPAMRRSGAGNIFIKNLDKVIDNKSIYDTFSLFGNILSCKVAIDEDGFSKGYGFVHFETEEAAQNAIQKVNGMLLAGKKVFVGKFQPRAQRNRELGETAKQFTNVYVKNFGDHYNKETLEKLFAKFGNITSCEVMTVE-GKSKGFGFVAFANPEEAETAVQALHDSTIEGTDLKLHVCRAQKKSERHAELKKKHEQHKAERMQKY-QGVNLYVKNLDETVDDDGLKKQFESYGNITSAKVMTDENGRSKGFGFVCFEKPEEATSAVTEMNSKMVCSKPLYVAIAQRKEDRRAQLASQYMQRLASMR 414          
BLAST of cytoplasmic poly(A) binding protein vs. Ensembl Celegans
Match: pab-1 (Polyadenylate-binding protein [Source:UniProtKB/TrEMBL;Acc:Q7K797])

HSP 1 Score: 511.146 bits (1315), Expect = 7.079e-172
Identity = 250/394 (63.45%), Postives = 303/394 (76.90%), Query Frame = 2
Query:  128 NQINNSIPMASLYVGDLHPEVTEAMIYEKFSSCGPVLSIRVCRDMITRKSLGYAYVNFQNAADAESALDRMNFDTMKGRSIRIMWSQRDPSLRKSGIGNIFIKNLDKSITQKELHDTFVAFGNILSCKIAADERSKSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVGRFIPRT--NRANSDSDVKFTNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFK--DRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDRKAHLASQYMQRVNPHR 1297
            NQ  +S  MASLYVGDLHP+V E++++EKFS+ GPVLSIRVCRD  TR SLGYAYVNFQ  ADAE A+D MNF+ + G+ +RIMWSQRDP++R+SG GNIFIKNLDK I  K ++DTF  FGNILSCK+A DE   SKGYGFVHFETE AA NAI  +NGML+  KKVFVG+F PR   NR   ++  +FTN Y+KNFG+  + E L ++F +FG ITS +VM  E GKSKGFGFV F + E AE+AV+AL+    +  D +L+V RAQKK+ER  EL+   E+ +AER  +Y QGVNLYVKNLD+++DD  LK++F  +GNITSAKVMTD N RSKGFGFVCF  PEEAT AVTEMN K+  SKPLYVA+AQRKEDR+A LASQYMQR+   R
Sbjct:   23 NQTGSSYTMASLYVGDLHPDVNESILFEKFSAAGPVLSIRVCRDNATRLSLGYAYVNFQQPADAERAMDTMNFEALHGKPMRIMWSQRDPAMRRSGAGNIFIKNLDKVIDNKSIYDTFSLFGNILSCKVAIDEDGFSKGYGFVHFETEEAAQNAIQKVNGMLLAGKKVFVGKFQPRAQRNRELGETAKQFTNVYVKNFGDHYNKETLEKLFAKFGNITSCEVMTVE-GKSKGFGFVAFANPEEAETAVQALHDSTIEGTDLKLHVCRAQKKSERHAELKKKHEQHKAERMQKY-QGVNLYVKNLDETVDDDGLKKQFESYGNITSAKVMTDENGRSKGFGFVCFEKPEEATSAVTEMNSKMVCSKPLYVAIAQRKEDRRAQLASQYMQRLASMR 414          
BLAST of cytoplasmic poly(A) binding protein vs. Ensembl Celegans
Match: pab-1 (Polyadenylate-binding protein [Source:UniProtKB/TrEMBL;Acc:Q7K797])

HSP 1 Score: 511.146 bits (1315), Expect = 7.079e-172
Identity = 250/394 (63.45%), Postives = 303/394 (76.90%), Query Frame = 2
Query:  128 NQINNSIPMASLYVGDLHPEVTEAMIYEKFSSCGPVLSIRVCRDMITRKSLGYAYVNFQNAADAESALDRMNFDTMKGRSIRIMWSQRDPSLRKSGIGNIFIKNLDKSITQKELHDTFVAFGNILSCKIAADERSKSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVGRFIPRT--NRANSDSDVKFTNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFK--DRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDRKAHLASQYMQRVNPHR 1297
            NQ  +S  MASLYVGDLHP+V E++++EKFS+ GPVLSIRVCRD  TR SLGYAYVNFQ  ADAE A+D MNF+ + G+ +RIMWSQRDP++R+SG GNIFIKNLDK I  K ++DTF  FGNILSCK+A DE   SKGYGFVHFETE AA NAI  +NGML+  KKVFVG+F PR   NR   ++  +FTN Y+KNFG+  + E L ++F +FG ITS +VM  E GKSKGFGFV F + E AE+AV+AL+    +  D +L+V RAQKK+ER  EL+   E+ +AER  +Y QGVNLYVKNLD+++DD  LK++F  +GNITSAKVMTD N RSKGFGFVCF  PEEAT AVTEMN K+  SKPLYVA+AQRKEDR+A LASQYMQR+   R
Sbjct:   23 NQTGSSYTMASLYVGDLHPDVNESILFEKFSAAGPVLSIRVCRDNATRLSLGYAYVNFQQPADAERAMDTMNFEALHGKPMRIMWSQRDPAMRRSGAGNIFIKNLDKVIDNKSIYDTFSLFGNILSCKVAIDEDGFSKGYGFVHFETEEAAQNAIQKVNGMLLAGKKVFVGKFQPRAQRNRELGETAKQFTNVYVKNFGDHYNKETLEKLFAKFGNITSCEVMTVE-GKSKGFGFVAFANPEEAETAVQALHDSTIEGTDLKLHVCRAQKKSERHAELKKKHEQHKAERMQKY-QGVNLYVKNLDETVDDDGLKKQFESYGNITSAKVMTDENGRSKGFGFVCFEKPEEATSAVTEMNSKMVCSKPLYVAIAQRKEDRRAQLASQYMQRLASMR 414          
BLAST of cytoplasmic poly(A) binding protein vs. Ensembl Celegans
Match: pab-1 (Polyadenylate-binding protein [Source:UniProtKB/TrEMBL;Acc:Q7K797])

HSP 1 Score: 511.146 bits (1315), Expect = 7.079e-172
Identity = 250/394 (63.45%), Postives = 303/394 (76.90%), Query Frame = 2
Query:  128 NQINNSIPMASLYVGDLHPEVTEAMIYEKFSSCGPVLSIRVCRDMITRKSLGYAYVNFQNAADAESALDRMNFDTMKGRSIRIMWSQRDPSLRKSGIGNIFIKNLDKSITQKELHDTFVAFGNILSCKIAADERSKSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVGRFIPRT--NRANSDSDVKFTNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFK--DRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDRKAHLASQYMQRVNPHR 1297
            NQ  +S  MASLYVGDLHP+V E++++EKFS+ GPVLSIRVCRD  TR SLGYAYVNFQ  ADAE A+D MNF+ + G+ +RIMWSQRDP++R+SG GNIFIKNLDK I  K ++DTF  FGNILSCK+A DE   SKGYGFVHFETE AA NAI  +NGML+  KKVFVG+F PR   NR   ++  +FTN Y+KNFG+  + E L ++F +FG ITS +VM  E GKSKGFGFV F + E AE+AV+AL+    +  D +L+V RAQKK+ER  EL+   E+ +AER  +Y QGVNLYVKNLD+++DD  LK++F  +GNITSAKVMTD N RSKGFGFVCF  PEEAT AVTEMN K+  SKPLYVA+AQRKEDR+A LASQYMQR+   R
Sbjct:   23 NQTGSSYTMASLYVGDLHPDVNESILFEKFSAAGPVLSIRVCRDNATRLSLGYAYVNFQQPADAERAMDTMNFEALHGKPMRIMWSQRDPAMRRSGAGNIFIKNLDKVIDNKSIYDTFSLFGNILSCKVAIDEDGFSKGYGFVHFETEEAAQNAIQKVNGMLLAGKKVFVGKFQPRAQRNRELGETAKQFTNVYVKNFGDHYNKETLEKLFAKFGNITSCEVMTVE-GKSKGFGFVAFANPEEAETAVQALHDSTIEGTDLKLHVCRAQKKSERHAELKKKHEQHKAERMQKY-QGVNLYVKNLDETVDDDGLKKQFESYGNITSAKVMTDENGRSKGFGFVCFEKPEEATSAVTEMNSKMVCSKPLYVAIAQRKEDRRAQLASQYMQRLASMR 414          
BLAST of cytoplasmic poly(A) binding protein vs. Ensembl Fly
Match: pAbp (gene:FBgn0265297 transcript:FBtr0086738)

HSP 1 Score: 521.546 bits (1342), Expect = 4.693e-176
Identity = 252/385 (65.45%), Postives = 302/385 (78.44%), Query Frame = 2
Query:  152 MASLYVGDLHPEVTEAMIYEKFSSCGPVLSIRVCRDMITRKSLGYAYVNFQNAADAESALDRMNFDTMKGRSIRIMWSQRDPSLRKSGIGNIFIKNLDKSITQKELHDTFVAFGNILSCKIAADERSKSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVGRFIPRTNRAN--SDSDVKFTNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGK-MFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDRKAHLASQYMQRVNPHR 1297
            MASLYVGDL  +V E+ +++KFSS GPVLSIRVCRD+ITR+SLGYAYVNFQ  ADAE ALD MNFD ++ + IRIMWSQRDPSLR+SG+GN+FIKNLD++I  K ++DTF AFGNILSCK+A DE+  SKGYGFVHFETE AA  +ID +NGML+  KKV+VG+FIPR  R     +    FTN Y+KNF ED DDEKL+E F  +G+ITS KVM  E+GKSKGFGFV F+ +E AE+AV+ALNGK M + + LYV RAQKK ER  EL+  FE+ + +R      GVNLYVKNLDD+IDD RL+  F  +GNITSAKVMTD   RSKGFGFVCF+   EAT AVTE+NG++ GSKPLYVALAQRKE+RKAHLASQYM+ +   R
Sbjct:    1 MASLYVGDLPQDVNESGLFDKFSSAGPVLSIRVCRDVITRRSLGYAYVNFQQPADAERALDTMNFDLVRNKPIRIMWSQRDPSLRRSGVGNVFIKNLDRAIDNKAIYDTFSAFGNILSCKVATDEKGNSKGYGFVHFETEEAANTSIDKVNGMLLNGKKVYVGKFIPRKEREKELGEKAKLFTNVYVKNFTEDFDDEKLKEFFEPYGKITSYKVMSKEDGKSKGFGFVAFETTEAAEAAVQALNGKDMGEGKSLYVARAQKKAERQQELKRKFEELKQKRHESVF-GVNLYVKNLDDTIDDDRLRIAFSPYGNITSAKVMTDEEGRSKGFGFVCFNAASEATCAVTELNGRVVGSKPLYVALAQRKEERKAHLASQYMRHMTGMR 384          

HSP 2 Score: 103.219 bits (256), Expect = 2.504e-22
Identity = 49/83 (59.04%), Postives = 63/83 (75.90%), Query Frame = 2
Query: 1862 QLVSGNLEPLTISTLASAPIAEQKQMLGERLYPLVHRMYPELAGKITGMLLEIDNTELLHMLESEDSLTTKIEEAMNVLQSHK 2110
            QL   N E L  S LA+A   EQKQ+LGERLYP++  M+  LAGKITGMLLEI+N+ELLHM+E +++L  K+EEA+ VLQ H+
Sbjct:  546 QLQGKNSEKLIASLLANAKPQEQKQILGERLYPMIEHMHANLAGKITGMLLEIENSELLHMIEDQEALKAKVEEAVAVLQVHR 628          
BLAST of cytoplasmic poly(A) binding protein vs. Ensembl Fly
Match: pAbp (gene:FBgn0265297 transcript:FBtr0086736)

HSP 1 Score: 521.546 bits (1342), Expect = 4.693e-176
Identity = 252/385 (65.45%), Postives = 302/385 (78.44%), Query Frame = 2
Query:  152 MASLYVGDLHPEVTEAMIYEKFSSCGPVLSIRVCRDMITRKSLGYAYVNFQNAADAESALDRMNFDTMKGRSIRIMWSQRDPSLRKSGIGNIFIKNLDKSITQKELHDTFVAFGNILSCKIAADERSKSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVGRFIPRTNRAN--SDSDVKFTNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGK-MFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDRKAHLASQYMQRVNPHR 1297
            MASLYVGDL  +V E+ +++KFSS GPVLSIRVCRD+ITR+SLGYAYVNFQ  ADAE ALD MNFD ++ + IRIMWSQRDPSLR+SG+GN+FIKNLD++I  K ++DTF AFGNILSCK+A DE+  SKGYGFVHFETE AA  +ID +NGML+  KKV+VG+FIPR  R     +    FTN Y+KNF ED DDEKL+E F  +G+ITS KVM  E+GKSKGFGFV F+ +E AE+AV+ALNGK M + + LYV RAQKK ER  EL+  FE+ + +R      GVNLYVKNLDD+IDD RL+  F  +GNITSAKVMTD   RSKGFGFVCF+   EAT AVTE+NG++ GSKPLYVALAQRKE+RKAHLASQYM+ +   R
Sbjct:    1 MASLYVGDLPQDVNESGLFDKFSSAGPVLSIRVCRDVITRRSLGYAYVNFQQPADAERALDTMNFDLVRNKPIRIMWSQRDPSLRRSGVGNVFIKNLDRAIDNKAIYDTFSAFGNILSCKVATDEKGNSKGYGFVHFETEEAANTSIDKVNGMLLNGKKVYVGKFIPRKEREKELGEKAKLFTNVYVKNFTEDFDDEKLKEFFEPYGKITSYKVMSKEDGKSKGFGFVAFETTEAAEAAVQALNGKDMGEGKSLYVARAQKKAERQQELKRKFEELKQKRHESVF-GVNLYVKNLDDTIDDDRLRIAFSPYGNITSAKVMTDEEGRSKGFGFVCFNAASEATCAVTELNGRVVGSKPLYVALAQRKEERKAHLASQYMRHMTGMR 384          

HSP 2 Score: 103.219 bits (256), Expect = 2.504e-22
Identity = 49/83 (59.04%), Postives = 63/83 (75.90%), Query Frame = 2
Query: 1862 QLVSGNLEPLTISTLASAPIAEQKQMLGERLYPLVHRMYPELAGKITGMLLEIDNTELLHMLESEDSLTTKIEEAMNVLQSHK 2110
            QL   N E L  S LA+A   EQKQ+LGERLYP++  M+  LAGKITGMLLEI+N+ELLHM+E +++L  K+EEA+ VLQ H+
Sbjct:  546 QLQGKNSEKLIASLLANAKPQEQKQILGERLYPMIEHMHANLAGKITGMLLEIENSELLHMIEDQEALKAKVEEAVAVLQVHR 628          
BLAST of cytoplasmic poly(A) binding protein vs. Ensembl Fly
Match: pAbp (gene:FBgn0265297 transcript:FBtr0086740)

HSP 1 Score: 521.546 bits (1342), Expect = 4.693e-176
Identity = 252/385 (65.45%), Postives = 302/385 (78.44%), Query Frame = 2
Query:  152 MASLYVGDLHPEVTEAMIYEKFSSCGPVLSIRVCRDMITRKSLGYAYVNFQNAADAESALDRMNFDTMKGRSIRIMWSQRDPSLRKSGIGNIFIKNLDKSITQKELHDTFVAFGNILSCKIAADERSKSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVGRFIPRTNRAN--SDSDVKFTNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGK-MFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDRKAHLASQYMQRVNPHR 1297
            MASLYVGDL  +V E+ +++KFSS GPVLSIRVCRD+ITR+SLGYAYVNFQ  ADAE ALD MNFD ++ + IRIMWSQRDPSLR+SG+GN+FIKNLD++I  K ++DTF AFGNILSCK+A DE+  SKGYGFVHFETE AA  +ID +NGML+  KKV+VG+FIPR  R     +    FTN Y+KNF ED DDEKL+E F  +G+ITS KVM  E+GKSKGFGFV F+ +E AE+AV+ALNGK M + + LYV RAQKK ER  EL+  FE+ + +R      GVNLYVKNLDD+IDD RL+  F  +GNITSAKVMTD   RSKGFGFVCF+   EAT AVTE+NG++ GSKPLYVALAQRKE+RKAHLASQYM+ +   R
Sbjct:    1 MASLYVGDLPQDVNESGLFDKFSSAGPVLSIRVCRDVITRRSLGYAYVNFQQPADAERALDTMNFDLVRNKPIRIMWSQRDPSLRRSGVGNVFIKNLDRAIDNKAIYDTFSAFGNILSCKVATDEKGNSKGYGFVHFETEEAANTSIDKVNGMLLNGKKVYVGKFIPRKEREKELGEKAKLFTNVYVKNFTEDFDDEKLKEFFEPYGKITSYKVMSKEDGKSKGFGFVAFETTEAAEAAVQALNGKDMGEGKSLYVARAQKKAERQQELKRKFEELKQKRHESVF-GVNLYVKNLDDTIDDDRLRIAFSPYGNITSAKVMTDEEGRSKGFGFVCFNAASEATCAVTELNGRVVGSKPLYVALAQRKEERKAHLASQYMRHMTGMR 384          

HSP 2 Score: 103.219 bits (256), Expect = 2.504e-22
Identity = 49/83 (59.04%), Postives = 63/83 (75.90%), Query Frame = 2
Query: 1862 QLVSGNLEPLTISTLASAPIAEQKQMLGERLYPLVHRMYPELAGKITGMLLEIDNTELLHMLESEDSLTTKIEEAMNVLQSHK 2110
            QL   N E L  S LA+A   EQKQ+LGERLYP++  M+  LAGKITGMLLEI+N+ELLHM+E +++L  K+EEA+ VLQ H+
Sbjct:  546 QLQGKNSEKLIASLLANAKPQEQKQILGERLYPMIEHMHANLAGKITGMLLEIENSELLHMIEDQEALKAKVEEAVAVLQVHR 628          
BLAST of cytoplasmic poly(A) binding protein vs. Ensembl Fly
Match: CG4612 (gene:FBgn0035016 transcript:FBtr0306137)

HSP 1 Score: 180.644 bits (457), Expect = 1.349e-50
Identity = 88/190 (46.32%), Postives = 129/190 (67.89%), Query Frame = 2
Query:  425 IFIKNLDKSITQKELHDTFVAFGNILSCKIAADERSKSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVGRFIPRTNRANSDSDVKFTNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQ-LYVGRAQKKNERLDELRSHFEKQRAERSSR 991
            I+IKNL++SI  K ++DTF  FGNIL+C +A DE   S+GYGFVHF++E AA  AI+ +NGML  N+KV V +FIPR +R   +    F N Y+KN  E+  ++ LREMF  +G ITS K+M+DE G+S+ FGFV +++ ++A +AV  L+GK   D + LYV RA  K ER  E+    E+++ +++ +
Sbjct:  115 IYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDEDGNSRGYGFVHFDSEEAARAAIEKVNGMLCNNQKVHVVKFIPRRDR-EQEKATHFKNLYVKNLSEEFTEQHLREMFEPYGRITSHKLMLDEEGRSRRFGFVAYENPQSALAAVIGLHGKQLGDNKFLYVARALSKAERQQEINRKLEERKRQKAGQ 303          

HSP 2 Score: 119.398 bits (298), Expect = 2.784e-29
Identity = 68/195 (34.87%), Postives = 109/195 (55.90%), Query Frame = 2
Query:  701 YIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICG-SKPLYVALAQRKEDRKAHLASQYMQR 1282
            YIKN    +D++ + + F  FG I +  V  DE+G S+G+GFV F   E A +A++ +NG +  +++++V +   + +R  E  +HF+              NLYVKNL +   +  L++ F  +G ITS K+M D   RS+ FGFV + NP+ A  AV  ++GK  G +K LYVA A  K +R+  +  +  +R
Sbjct:  116 YIKNLERSIDNKAVYDTFSVFGNILNCNVAKDEDGNSRGYGFVHFDSEEAARAAIEKVNGMLCNNQKVHVVKFIPRRDREQEKATHFK--------------NLYVKNLSEEFTEQHLREMFEPYGRITSHKLMLDEEGRSRRFGFVAYENPQSALAAVIGLHGKQLGDNKFLYVARALSKAERQQEINRKLEER 296          

HSP 3 Score: 78.5666 bits (192), Expect = 2.128e-15
Identity = 47/172 (27.33%), Postives = 91/172 (52.91%), Query Frame = 2
Query:  161 LYVGDLHPEVTEAMIYEKFSSCGPVLSIRVCRDMITRKSLGYAYVNFQNAADAESALDRMNFDTMKGRSIRIM--WSQRDPSLRK-SGIGNIFIKNLDKSITQKELHDTFVAFGNILSCKIAADERSKSKGYGFVHFETEAAATNAIDAING-MLIKNKKVFVGRFIPRTNR 664
            +Y+ +L   +    +Y+ FS  G +L+  V +D     S GY +V+F +   A +A++++N      + + ++    +RD    K +   N+++KNL +  T++ L + F  +G I S K+  DE  +S+ +GFV +E   +A  A+  ++G  L  NK ++V R + +  R
Sbjct:  115 IYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDE-DGNSRGYGFVHFDSEEAARAAIEKVNGMLCNNQKVHVVKFIPRRDREQEKATHFKNLYVKNLSEEFTEQHLREMFEPYGRITSHKLMLDEEGRSRRFGFVAYENPQSALAAVIGLHGKQLGDNKFLYVARALSKAER 285          

HSP 4 Score: 67.3958 bits (163), Expect = 1.075e-11
Identity = 31/88 (35.23%), Postives = 53/88 (60.23%), Query Frame = 2
Query: 1010 LYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDRKAHLASQY 1273
            +Y+KNL+ SID+  +   F VFGNI +  V  D +  S+G+GFV F + E A  A+ ++NG +C ++ ++V     + DR+   A+ +
Sbjct:  115 IYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDEDGNSRGYGFVHFDSEEAARAAIEKVNGMLCNNQKVHVVKFIPRRDREQEKATHF 202          
BLAST of cytoplasmic poly(A) binding protein vs. Ensembl Fly
Match: CG4612 (gene:FBgn0035016 transcript:FBtr0072346)

HSP 1 Score: 180.644 bits (457), Expect = 1.349e-50
Identity = 88/190 (46.32%), Postives = 129/190 (67.89%), Query Frame = 2
Query:  425 IFIKNLDKSITQKELHDTFVAFGNILSCKIAADERSKSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVGRFIPRTNRANSDSDVKFTNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQ-LYVGRAQKKNERLDELRSHFEKQRAERSSR 991
            I+IKNL++SI  K ++DTF  FGNIL+C +A DE   S+GYGFVHF++E AA  AI+ +NGML  N+KV V +FIPR +R   +    F N Y+KN  E+  ++ LREMF  +G ITS K+M+DE G+S+ FGFV +++ ++A +AV  L+GK   D + LYV RA  K ER  E+    E+++ +++ +
Sbjct:  115 IYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDEDGNSRGYGFVHFDSEEAARAAIEKVNGMLCNNQKVHVVKFIPRRDR-EQEKATHFKNLYVKNLSEEFTEQHLREMFEPYGRITSHKLMLDEEGRSRRFGFVAYENPQSALAAVIGLHGKQLGDNKFLYVARALSKAERQQEINRKLEERKRQKAGQ 303          

HSP 2 Score: 119.398 bits (298), Expect = 2.784e-29
Identity = 68/195 (34.87%), Postives = 109/195 (55.90%), Query Frame = 2
Query:  701 YIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICG-SKPLYVALAQRKEDRKAHLASQYMQR 1282
            YIKN    +D++ + + F  FG I +  V  DE+G S+G+GFV F   E A +A++ +NG +  +++++V +   + +R  E  +HF+              NLYVKNL +   +  L++ F  +G ITS K+M D   RS+ FGFV + NP+ A  AV  ++GK  G +K LYVA A  K +R+  +  +  +R
Sbjct:  116 YIKNLERSIDNKAVYDTFSVFGNILNCNVAKDEDGNSRGYGFVHFDSEEAARAAIEKVNGMLCNNQKVHVVKFIPRRDREQEKATHFK--------------NLYVKNLSEEFTEQHLREMFEPYGRITSHKLMLDEEGRSRRFGFVAYENPQSALAAVIGLHGKQLGDNKFLYVARALSKAERQQEINRKLEER 296          

HSP 3 Score: 78.5666 bits (192), Expect = 2.128e-15
Identity = 47/172 (27.33%), Postives = 91/172 (52.91%), Query Frame = 2
Query:  161 LYVGDLHPEVTEAMIYEKFSSCGPVLSIRVCRDMITRKSLGYAYVNFQNAADAESALDRMNFDTMKGRSIRIM--WSQRDPSLRK-SGIGNIFIKNLDKSITQKELHDTFVAFGNILSCKIAADERSKSKGYGFVHFETEAAATNAIDAING-MLIKNKKVFVGRFIPRTNR 664
            +Y+ +L   +    +Y+ FS  G +L+  V +D     S GY +V+F +   A +A++++N      + + ++    +RD    K +   N+++KNL +  T++ L + F  +G I S K+  DE  +S+ +GFV +E   +A  A+  ++G  L  NK ++V R + +  R
Sbjct:  115 IYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDE-DGNSRGYGFVHFDSEEAARAAIEKVNGMLCNNQKVHVVKFIPRRDREQEKATHFKNLYVKNLSEEFTEQHLREMFEPYGRITSHKLMLDEEGRSRRFGFVAYENPQSALAAVIGLHGKQLGDNKFLYVARALSKAER 285          

HSP 4 Score: 67.3958 bits (163), Expect = 1.075e-11
Identity = 31/88 (35.23%), Postives = 53/88 (60.23%), Query Frame = 2
Query: 1010 LYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDRKAHLASQY 1273
            +Y+KNL+ SID+  +   F VFGNI +  V  D +  S+G+GFV F + E A  A+ ++NG +C ++ ++V     + DR+   A+ +
Sbjct:  115 IYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDEDGNSRGYGFVHFDSEEAARAAIEKVNGMLCNNQKVHVVKFIPRRDREQEKATHF 202          
BLAST of cytoplasmic poly(A) binding protein vs. Ensembl Zebrafish
Match: pabpc1a (poly(A) binding protein, cytoplasmic 1a [Source:ZFIN;Acc:ZDB-GENE-030131-3238])

HSP 1 Score: 646.736 bits (1667), Expect = 0.000e+0
Identity = 362/664 (54.52%), Postives = 433/664 (65.21%), Query Frame = 2
Query:  143 SIPMASLYVGDLHPEVTEAMIYEKFSSCGPVLSIRVCRDMITRKSLGYAYVNFQNAADAESALDRMNFDTMKGRSIRIMWSQRDPSLRKSGIGNIFIKNLDKSITQKELHDTFVAFGNILSCKIAADERSKSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVGRFIPRTNR-ANSDSDVK-FTNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDRKAHLASQYMQRVNPHRNNYPNQVSVNTXXXXXXXXXXXXXXYAFAPNASTPRVY--TQSAAFMPPQNRWSNRMHPSQLQFNGGNMRQLANAHFGNMEGSSVPIQNNTMGMQANQIRQVSMIP----NQRPMLXXXXXXXXXXXXXXGVANTVKSAPQNSRPITGVQMPITSQASNISQQRPPNQPTRQITGQSVISGNQNVNRPINNGSNQLVSGNLEPLTISTLASAPIAEQKQMLGERLYPLVHRMYPELAGKITGMLLEIDNTELLHMLESEDSLTTKIEEAMNVLQSHK 2110
            S PMASLYVGDLHP+VTEAM+YEKFS  GP+LSIRVCRDM+TR+SLGYAYVNFQ  ADAE ALD MNFD +KGR +RIMWSQRDPSLRKSG+GNIFIKNLDKSI  K L+DTF AFGNILSCK+  DE   SKGYGFVHFET  AA  AI+ +NGML+ ++KVFVGRF  R  R A   +  K FTN YIKNFGED+DDEKL+E+F ++G   S +VM D++GKSKGFGFV F+  E A+ AV  +NGK    +Q+YVGRAQKK ER  EL+  FE+ + +R +RY QGVNLYVKNLDD +DD RL++EF  FG ITSAKVM +   RSKGFGFVCFS+PEEATKAVTEMNG+I  +KPLYVALAQRKE+R+AHL SQYMQR+   R   PN V     ++   P  PS    A  P A     Y  T   A + P  RW+ +    Q              HF NM  ++V   +       N +R  S +P    +QR M S       +          V+  PQ      GV+ P   Q      Q P  QP   + GQ                         EPLT S LA+AP  EQKQMLGERL+PL+  M+P LAGKITGMLLEIDN+ELLHMLES +SL +K++EA+ VLQ+H+
Sbjct:    7 SYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMMTRRSLGYAYVNFQQPADAERALDTMNFDVIKGRPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYGFVHFETHEAAERAIEKMNGMLLNDRKVFVGRFKSRKEREAEMGARAKEFTNVYIKNFGEDMDDEKLKEIFCKYGPALSIRVMTDDSGKSKGFGFVSFERHEDAQRAVDEMNGKEMNGKQVYVGRAQKKGERQTELKRKFEQMKQDRMTRY-QGVNLYVKNLDDGLDDERLRKEFSPFGTITSAKVMME-GGRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEERQAHLTSQYMQRMASVR-AVPNPV-----LNPYQPAPPSGYFMAAIPQAQNRAAYYPTSQLAQLRPSPRWATQGVRPQ--------------HFQNMPNAAV-RPSAPRPQTFNPVRPASQVPRMMTSQR-MGSQAMGPRPAAAGAATGPAQVRGVPQYKY-APGVRNP--QQHMPTQPQVPMQQPAVHVQGQ-------------------------EPLTASMLAAAPPQEQKQMLGERLFPLIQNMHPSLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQ 617          

HSP 2 Score: 193.741 bits (491), Expect = 4.438e-52
Identity = 108/297 (36.36%), Postives = 169/297 (56.90%), Query Frame = 2
Query:  392 DPSLRKSGIGNIFIKNLDKSITQKELHDTFVAFGNILSCKIAADERS-KSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVGRFIPRTNRANSDSDVKFTNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDRKAHLASQYMQ 1279
            +PS     + ++++ +L   +T+  L++ F   G ILS ++  D  + +S GY +V+F+  A A  A+D +N  +IK + V     I  + R  S       N +IKN  + +D++ L + F  FG I S KV+ DENG SKG+GFV F+  E AE A++ +NG +  DR+++VGR + + ER            AE  +R  +  N+Y+KN  + +DD +LK+ F  +G   S +VMTD + +SKGFGFV F   E+A +AV EMNGK    K +YV  AQ+K +R+  L  ++ Q
Sbjct:    2 NPSAPSYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMMTRRSLGYAYVNFQQPADAERALDTMNFDVIKGRPV----RIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYGFVHFETHEAAERAIEKMNGMLLNDRKVFVGRFKSRKER-----------EAEMGARAKEFTNVYIKNFGEDMDDEKLKEIFCKYGPALSIRVMTDDSGKSKGFGFVSFERHEDAQRAVDEMNGKEMNGKQVYVGRAQKKGERQTELKRKFEQ 282          
BLAST of cytoplasmic poly(A) binding protein vs. Ensembl Zebrafish
Match: pabpc1a (poly(A) binding protein, cytoplasmic 1a [Source:ZFIN;Acc:ZDB-GENE-030131-3238])

HSP 1 Score: 646.736 bits (1667), Expect = 0.000e+0
Identity = 362/664 (54.52%), Postives = 433/664 (65.21%), Query Frame = 2
Query:  143 SIPMASLYVGDLHPEVTEAMIYEKFSSCGPVLSIRVCRDMITRKSLGYAYVNFQNAADAESALDRMNFDTMKGRSIRIMWSQRDPSLRKSGIGNIFIKNLDKSITQKELHDTFVAFGNILSCKIAADERSKSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVGRFIPRTNR-ANSDSDVK-FTNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDRKAHLASQYMQRVNPHRNNYPNQVSVNTXXXXXXXXXXXXXXYAFAPNASTPRVY--TQSAAFMPPQNRWSNRMHPSQLQFNGGNMRQLANAHFGNMEGSSVPIQNNTMGMQANQIRQVSMIP----NQRPMLXXXXXXXXXXXXXXGVANTVKSAPQNSRPITGVQMPITSQASNISQQRPPNQPTRQITGQSVISGNQNVNRPINNGSNQLVSGNLEPLTISTLASAPIAEQKQMLGERLYPLVHRMYPELAGKITGMLLEIDNTELLHMLESEDSLTTKIEEAMNVLQSHK 2110
            S PMASLYVGDLHP+VTEAM+YEKFS  GP+LSIRVCRDM+TR+SLGYAYVNFQ  ADAE ALD MNFD +KGR +RIMWSQRDPSLRKSG+GNIFIKNLDKSI  K L+DTF AFGNILSCK+  DE   SKGYGFVHFET  AA  AI+ +NGML+ ++KVFVGRF  R  R A   +  K FTN YIKNFGED+DDEKL+E+F ++G   S +VM D++GKSKGFGFV F+  E A+ AV  +NGK    +Q+YVGRAQKK ER  EL+  FE+ + +R +RY QGVNLYVKNLDD +DD RL++EF  FG ITSAKVM +   RSKGFGFVCFS+PEEATKAVTEMNG+I  +KPLYVALAQRKE+R+AHL SQYMQR+   R   PN V     ++   P  PS    A  P A     Y  T   A + P  RW+ +    Q              HF NM  ++V   +       N +R  S +P    +QR M S       +          V+  PQ      GV+ P   Q      Q P  QP   + GQ                         EPLT S LA+AP  EQKQMLGERL+PL+  M+P LAGKITGMLLEIDN+ELLHMLES +SL +K++EA+ VLQ+H+
Sbjct:    7 SYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMMTRRSLGYAYVNFQQPADAERALDTMNFDVIKGRPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYGFVHFETHEAAERAIEKMNGMLLNDRKVFVGRFKSRKEREAEMGARAKEFTNVYIKNFGEDMDDEKLKEIFCKYGPALSIRVMTDDSGKSKGFGFVSFERHEDAQRAVDEMNGKEMNGKQVYVGRAQKKGERQTELKRKFEQMKQDRMTRY-QGVNLYVKNLDDGLDDERLRKEFSPFGTITSAKVMME-GGRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEERQAHLTSQYMQRMASVR-AVPNPV-----LNPYQPAPPSGYFMAAIPQAQNRAAYYPTSQLAQLRPSPRWATQGVRPQ--------------HFQNMPNAAV-RPSAPRPQTFNPVRPASQVPRMMTSQR-MGSQAMGPRPAAAGAATGPAQVRGVPQYKY-APGVRNP--QQHMPTQPQVPMQQPAVHVQGQ-------------------------EPLTASMLAAAPPQEQKQMLGERLFPLIQNMHPSLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQ 617          

HSP 2 Score: 193.741 bits (491), Expect = 4.438e-52
Identity = 108/297 (36.36%), Postives = 169/297 (56.90%), Query Frame = 2
Query:  392 DPSLRKSGIGNIFIKNLDKSITQKELHDTFVAFGNILSCKIAADERS-KSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVGRFIPRTNRANSDSDVKFTNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDRKAHLASQYMQ 1279
            +PS     + ++++ +L   +T+  L++ F   G ILS ++  D  + +S GY +V+F+  A A  A+D +N  +IK + V     I  + R  S       N +IKN  + +D++ L + F  FG I S KV+ DENG SKG+GFV F+  E AE A++ +NG +  DR+++VGR + + ER            AE  +R  +  N+Y+KN  + +DD +LK+ F  +G   S +VMTD + +SKGFGFV F   E+A +AV EMNGK    K +YV  AQ+K +R+  L  ++ Q
Sbjct:    2 NPSAPSYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMMTRRSLGYAYVNFQQPADAERALDTMNFDVIKGRPV----RIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYGFVHFETHEAAERAIEKMNGMLLNDRKVFVGRFKSRKER-----------EAEMGARAKEFTNVYIKNFGEDMDDEKLKEIFCKYGPALSIRVMTDDSGKSKGFGFVSFERHEDAQRAVDEMNGKEMNGKQVYVGRAQKKGERQTELKRKFEQ 282          
BLAST of cytoplasmic poly(A) binding protein vs. Ensembl Zebrafish
Match: pabpc1b (poly A binding protein, cytoplasmic 1 b [Source:ZFIN;Acc:ZDB-GENE-050308-1])

HSP 1 Score: 633.639 bits (1633), Expect = 0.000e+0
Identity = 362/671 (53.95%), Postives = 428/671 (63.79%), Query Frame = 2
Query:  143 SIPMASLYVGDLHPEVTEAMIYEKFSSCGPVLSIRVCRDMITRKSLGYAYVNFQNAADAESALDRMNFDTMKGRSIRIMWSQRDPSLRKSGIGNIFIKNLDKSITQKELHDTFVAFGNILSCKIAADERSKSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVGRFIPRTNR-ANSDSDVK-FTNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDRKAHLASQYMQRVNPHRNNYPNQVSVNTXXXXXXXXXXXXXXYAFAPNASTPRVY--TQSAAFMPPQNRWSNR-MHPSQLQFNGGNMRQLAN--AHFGNME-GSSVP-------IQNNTMGMQANQIRQVSMIPNQRPMLXXXXXXXXXXXXXXGVANTVKSAPQNSRPITGVQMPITSQASNISQQRPPNQPTRQITGQSVISGNQNVNRPINNGSNQLVSGNLEPLTISTLASAPIAEQKQMLGERLYPLVHRMYPELAGKITGMLLEIDNTELLHMLESEDSLTTKIEEAMNVLQSHK 2110
            S PMASLYVGDLH +VTEAM+YEKFS  G +LSIRVCRDMITR+SLGYAYVNFQ  ADAE ALD MNFD +KGR +RIMWSQRDPSLRKSG+GNIFIKNLDKSI  K L+DTF AFGNILSCK+  DE   SKGYGFVHFET+ AA  AI+ +NGML+ ++KVFVGRF  R  R A   +  K FTN YIKNFGED+DD+KL+++F ++G   S +VM DENGKS+GFGFV F+  E A+ AV  +NGK    + +YVGRAQKK ER  EL+  FE+ + +R +RY QGVNLYVKNLDD IDD RL++EF  FG ITSAKVM D   RSKGFGFVCFS+PEEATKAVTEMNG+I  +KPLYVALAQRKE+R+AHL +QYMQR+   R   PN V +N      P G       A  P A     Y  T   A + P  RW+ + + P   Q   G MR  A     F  M   S VP       +   TMG + +     +  P  R                 GV    K AP    P          Q  N   Q    QP   + GQ                         EPLT S LA+AP  EQKQMLGERL+PL+  M+P LAGKITGMLLEIDN+ELLHMLES +SL +K++EA+ VLQ+H+
Sbjct:    7 SYPMASLYVGDLHQDVTEAMLYEKFSPAGAILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGRPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFVGRFKSRKEREAELGARAKEFTNVYIKNFGEDMDDDKLKDIFSKYGNAMSIRVMTDENGKSRGFGFVSFERHEDAQRAVDEMNGKEMNGKLIYVGRAQKKVERQTELKRKFEQMKQDRMTRY-QGVNLYVKNLDDGIDDERLRKEFSPFGTITSAKVMMD-GGRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEERQAHLTNQYMQRMASVRA-VPNPV-INPYQPAPPSGYFM----AAIPQAQNRAAYYPTSQLAQLRPSPRWTTQGVRPQHFQNMPGTMRPSAPRPQTFSTMRPASQVPRMMSTQRVATQTMGPRPSTAAAAASAPPVR-----------------GVPQ-YKYAPSVRNP---------QQHMNTQPQVTMQQPAVHVQGQ-------------------------EPLTASMLAAAPPQEQKQMLGERLFPLIQNMHPSLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQ 616          

HSP 2 Score: 194.897 bits (494), Expect = 1.492e-52
Identity = 109/297 (36.70%), Postives = 170/297 (57.24%), Query Frame = 2
Query:  392 DPSLRKSGIGNIFIKNLDKSITQKELHDTFVAFGNILSCKIAADERS-KSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVGRFIPRTNRANSDSDVKFTNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDRKAHLASQYMQ 1279
            +PS     + ++++ +L + +T+  L++ F   G ILS ++  D  + +S GY +V+F+  A A  A+D +N  +IK + V     I  + R  S       N +IKN  + +D++ L + F  FG I S KV+ DENG SKG+GFV F+  E AE A++ +NG +  DR+++VGR + + ER            AE  +R  +  N+Y+KN  + +DD +LK  F  +GN  S +VMTD N +S+GFGFV F   E+A +AV EMNGK    K +YV  AQ+K +R+  L  ++ Q
Sbjct:    2 NPSAPSYPMASLYVGDLHQDVTEAMLYEKFSPAGAILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGRPV----RIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFVGRFKSRKER-----------EAELGARAKEFTNVYIKNFGEDMDDDKLKDIFSKYGNAMSIRVMTDENGKSRGFGFVSFERHEDAQRAVDEMNGKEMNGKLIYVGRAQKKVERQTELKRKFEQ 282          
BLAST of cytoplasmic poly(A) binding protein vs. Ensembl Zebrafish
Match: pabpc4 (poly(A) binding protein, cytoplasmic 4 (inducible form) [Source:ZFIN;Acc:ZDB-GENE-030131-9663])

HSP 1 Score: 633.254 bits (1632), Expect = 0.000e+0
Identity = 356/683 (52.12%), Postives = 427/683 (62.52%), Query Frame = 2
Query:  122 VNNQINNSIPMASLYVGDLHPEVTEAMIYEKFSSCGPVLSIRVCRDMITRKSLGYAYVNFQNAADAESALDRMNFDTMKGRSIRIMWSQRDPSLRKSGIGNIFIKNLDKSITQKELHDTFVAFGNILSCKIAADERSKSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVGRFIPRTNR-ANSDSDVK-FTNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDRKAHLASQYMQRVNPHRNNYPNQVSVNTXXXXXXXXXXXXXXYAFAPNASTPRVYTQSAAFMPPQNRWSNR---MHPSQLQFNGGNMRQLANAHFGNMEGSSVPIQNNTMGMQANQIRQVSMIPNQRPMLXXXXXXXXXXXXXXGVANTVKSAPQNSRPITGV----QMPITSQASNISQQRPP-NQPTRQITGQSVISGNQNVNRPINNGSNQLVSGNLEPLTISTLASAPIAEQKQMLGERLYPLVHRMYPELAGKITGMLLEIDNTELLHMLESEDSLTTKIEEAMNVLQSHKNQNVIVTDMG 2140
            +N     S PMASLYVGDLHP++TEAM+YEKFS  GPVLSIRVCRDMITR+SLGYAYVNFQ  ADAE ALD MNFD +KG+ IRIMWSQRDPSLRKSG+GN+FIKNLDKSI  K L+DTF AFGNILSCK+  DE   SKGY FVHFET+ AA  AI+ +NGML+ ++KVFVGRF  R  R A   +  K FTN YIKNFG+D+DD++L+E+F ++G+  S KVM D  GKS+GFGFV ++  E A  AV+ +NG     + ++VGRAQKK ER  EL+  FE+ + ER SRY QGVNLY+KNLDD+IDD +L++EF  FG+ITSAKVM +   RSKGFGFVCFS+PEEATKAVTEMNG+I GSKPLYVALAQRKE+RKAHL +QYMQR+   R                          A   NA   +       FMP   +  NR     P+QL     N R       G      +P      G +AN         NQ P                 V  T    P   RP  G+     MP    AS I   +P   QP      Q  +                 V G  EPLT S LA+AP  EQKQMLGERL+PL+  M+P LAGKITGMLLEIDN+ELLHMLES +SL +K+EEA+ VLQ+H+ +      +G
Sbjct:    1 MNAATAGSYPMASLYVGDLHPDITEAMLYEKFSPAGPVLSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVVKGKPIRIMWSQRDPSLRKSGVGNVFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYAFVHFETQDAADRAIEKMNGMLLNDRKVFVGRFKSRKEREAEMGAKAKEFTNVYIKNFGDDMDDQRLKELFDKYGKTLSVKVMTDPTGKSRGFGFVSYEKHEDANKAVEEMNGTELNGKTVFVGRAQKKMERQAELKRKFEQLKQERISRY-QGVNLYIKNLDDTIDDEKLRKEFSPFGSITSAKVMLE-EGRSKGFGFVCFSSPEEATKAVTEMNGRIVGSKPLYVALAQRKEERKAHLTNQYMQRIAGMR--------------------------AMPANAIINQFQPAGGYFMPAVPQAQNRTTYYAPNQLTQMRPNPRWQQQGGRGQGGFQGMPSSLRQPGPRANIRHLAPNASNQGP--------RGMPTGAQRVGGT--GQPMGPRPAMGMTTPRAMPPYKYASTIRNTQPQVVQPIALQQAQPAVH----------------VQGQ-EPLTASMLAAAPPQEQKQMLGERLFPLIQAMHPSLAGKITGMLLEIDNSELLHMLESHESLRSKVEEAVAVLQAHQAKKDATQKVG 627          
BLAST of cytoplasmic poly(A) binding protein vs. Ensembl Zebrafish
Match: pabpc4 (poly(A) binding protein, cytoplasmic 4 (inducible form) [Source:ZFIN;Acc:ZDB-GENE-030131-9663])

HSP 1 Score: 633.254 bits (1632), Expect = 0.000e+0
Identity = 356/683 (52.12%), Postives = 427/683 (62.52%), Query Frame = 2
Query:  122 VNNQINNSIPMASLYVGDLHPEVTEAMIYEKFSSCGPVLSIRVCRDMITRKSLGYAYVNFQNAADAESALDRMNFDTMKGRSIRIMWSQRDPSLRKSGIGNIFIKNLDKSITQKELHDTFVAFGNILSCKIAADERSKSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVGRFIPRTNR-ANSDSDVK-FTNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDRKAHLASQYMQRVNPHRNNYPNQVSVNTXXXXXXXXXXXXXXYAFAPNASTPRVYTQSAAFMPPQNRWSNR---MHPSQLQFNGGNMRQLANAHFGNMEGSSVPIQNNTMGMQANQIRQVSMIPNQRPMLXXXXXXXXXXXXXXGVANTVKSAPQNSRPITGV----QMPITSQASNISQQRPP-NQPTRQITGQSVISGNQNVNRPINNGSNQLVSGNLEPLTISTLASAPIAEQKQMLGERLYPLVHRMYPELAGKITGMLLEIDNTELLHMLESEDSLTTKIEEAMNVLQSHKNQNVIVTDMG 2140
            +N     S PMASLYVGDLHP++TEAM+YEKFS  GPVLSIRVCRDMITR+SLGYAYVNFQ  ADAE ALD MNFD +KG+ IRIMWSQRDPSLRKSG+GN+FIKNLDKSI  K L+DTF AFGNILSCK+  DE   SKGY FVHFET+ AA  AI+ +NGML+ ++KVFVGRF  R  R A   +  K FTN YIKNFG+D+DD++L+E+F ++G+  S KVM D  GKS+GFGFV ++  E A  AV+ +NG     + ++VGRAQKK ER  EL+  FE+ + ER SRY QGVNLY+KNLDD+IDD +L++EF  FG+ITSAKVM +   RSKGFGFVCFS+PEEATKAVTEMNG+I GSKPLYVALAQRKE+RKAHL +QYMQR+   R                          A   NA   +       FMP   +  NR     P+QL     N R       G      +P      G +AN         NQ P                 V  T    P   RP  G+     MP    AS I   +P   QP      Q  +                 V G  EPLT S LA+AP  EQKQMLGERL+PL+  M+P LAGKITGMLLEIDN+ELLHMLES +SL +K+EEA+ VLQ+H+ +      +G
Sbjct:    1 MNAATAGSYPMASLYVGDLHPDITEAMLYEKFSPAGPVLSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVVKGKPIRIMWSQRDPSLRKSGVGNVFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYAFVHFETQDAADRAIEKMNGMLLNDRKVFVGRFKSRKEREAEMGAKAKEFTNVYIKNFGDDMDDQRLKELFDKYGKTLSVKVMTDPTGKSRGFGFVSYEKHEDANKAVEEMNGTELNGKTVFVGRAQKKMERQAELKRKFEQLKQERISRY-QGVNLYIKNLDDTIDDEKLRKEFSPFGSITSAKVMLE-EGRSKGFGFVCFSSPEEATKAVTEMNGRIVGSKPLYVALAQRKEERKAHLTNQYMQRIAGMR--------------------------AMPANAIINQFQPAGGYFMPAVPQAQNRTTYYAPNQLTQMRPNPRWQQQGGRGQGGFQGMPSSLRQPGPRANIRHLAPNASNQGP--------RGMPTGAQRVGGT--GQPMGPRPAMGMTTPRAMPPYKYASTIRNTQPQVVQPIALQQAQPAVH----------------VQGQ-EPLTASMLAAAPPQEQKQMLGERLFPLIQAMHPSLAGKITGMLLEIDNSELLHMLESHESLRSKVEEAVAVLQAHQAKKDATQKVG 627          
BLAST of cytoplasmic poly(A) binding protein vs. Ensembl Xenopus
Match: tmem101 (transmembrane protein 101 [Source:Xenbase;Acc:XB-GENE-977590])

HSP 1 Score: 640.958 bits (1652), Expect = 0.000e+0
Identity = 363/669 (54.26%), Postives = 433/669 (64.72%), Query Frame = 2
Query:  143 SIPMASLYVGDLHPEVTEAMIYEKFSSCGPVLSIRVCRDMITRKSLGYAYVNFQNAADAESALDRMNFDTMKGRSIRIMWSQRDPSLRKSGIGNIFIKNLDKSITQKELHDTFVAFGNILSCKIAADERSKSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVGRFIPRTNR-ANSDSDVK-FTNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDRKAHLASQYMQRVNPHRNNYPNQVSVNTXXXXXXXXXXXXXXYAFAPNASTPRVYTQSAAFMPPQNRWSNRMHP----SQLQFNGGNMRQLANAH-FGNMEGSSVPIQN-----NTMGMQANQI-RQVSMIPNQRPMLXXXXXXXXXXXXXXGVANTVKSAPQNSRPITGVQMPITSQASNISQQRPPNQPTRQITGQSVISGNQNVNRPINNGSNQLVSGNLEPLTISTLASAPIAEQKQMLGERLYPLVHRMYPELAGKITGMLLEIDNTELLHMLESEDSLTTKIEEAMNVLQSHK 2110
            S PMASLYVGDLHP+VTEAM+YEKFS  GP+LSIRVCRDMITR+SLGYAYVNFQ  ADAE ALD MNFD +KG+ +RIMWSQRDPSLRKSG+GNIFIKNLDKSI  K L+DTF AFGNILSCK+  DE   SKGYGFVHFET+ AA  AID +NGML+ ++KVFVGRF  R  R A   +  K FTN YIKNFGED+DDE+L+EMF ++G   S KVM D+NGKSKGFGFV F+  E A+ AV  +NGK    + +YVGRAQKK ER  EL+  FE+ + +R +RY QGVNLYVKNLDD IDD RL++EF  FG ITSAKVM +   RSKGFGFVCFS+PEEATKAVTEMNG+I  +KPLYVALAQRKE+R+AHL +QYMQR+   R   PN V +N                   P    P  Y   AA  P QNR +   +P    +QL+ +     Q A  H F NM G+  P        +TM   +NQ+ R VS     +   S                + V++ PQ         + IT             QP   + GQ                         EPLT S LA+AP  EQKQMLGERL+PL+  M+P LAGKITGMLLEIDN+ELLHMLES +SL +K++EA+ VLQ+H+
Sbjct:    7 SYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYGFVHFETQEAAERAIDKMNGMLLNDRKVFVGRFKSRKEREAELGARAKEFTNVYIKNFGEDMDDERLKEMFGKYGPALSVKVMTDDNGKSKGFGFVSFERHEDAQKAVDDMNGKDMNGKAIYVGRAQKKVERQTELKRKFEQMKQDRITRY-QGVNLYVKNLDDGIDDERLRKEFSPFGTITSAKVMME-GGRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEERQAHLTNQYMQRMASVR--VPNPV-IN-------------------PYQPPPSSYFM-AAIPPAQNRAA--YYPPGQIAQLRPSPRWTAQGARPHPFQNMPGAIRPTAPRPPTFSTMRPASNQVPRVVSAQRVGKANTSTQTMGPRPTTAAAAATSAVRTVPQYKYTALYTTILITCLL----------QPAVHVQGQ-------------------------EPLTASMLAAAPPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQ 612          

HSP 2 Score: 196.438 bits (498), Expect = 5.875e-53
Identity = 112/297 (37.71%), Postives = 168/297 (56.57%), Query Frame = 2
Query:  392 DPSLRKSGIGNIFIKNLDKSITQKELHDTFVAFGNILSCKIAADERS-KSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVGRFIPRTNRANSDSDVKFTNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDRKAHLASQYMQ 1279
            +PS     + ++++ +L   +T+  L++ F   G ILS ++  D  + +S GY +V+F+  A A  A+D +N  +IK K V     I  + R  S       N +IKN  + +D++ L + F  FG I S KV+ DENG SKG+GFV F+  E AE A+  +NG +  DR+++VGR + + ER            AE  +R  +  N+Y+KN  + +DD RLK+ F  +G   S KVMTD N +SKGFGFV F   E+A KAV +MNGK    K +YV  AQ+K +R+  L  ++ Q
Sbjct:    2 NPSAPSYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPV----RIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYGFVHFETQEAAERAIDKMNGMLLNDRKVFVGRFKSRKER-----------EAELGARAKEFTNVYIKNFGEDMDDERLKEMFGKYGPALSVKVMTDDNGKSKGFGFVSFERHEDAQKAVDDMNGKDMNGKAIYVGRAQKKVERQTELKRKFEQ 282          
BLAST of cytoplasmic poly(A) binding protein vs. Ensembl Xenopus
Match: tmem101 (transmembrane protein 101 [Source:Xenbase;Acc:XB-GENE-977590])

HSP 1 Score: 640.573 bits (1651), Expect = 0.000e+0
Identity = 361/665 (54.29%), Postives = 438/665 (65.86%), Query Frame = 2
Query:  143 SIPMASLYVGDLHPEVTEAMIYEKFSSCGPVLSIRVCRDMITRKSLGYAYVNFQNAADAESALDRMNFDTMKGRSIRIMWSQRDPSLRKSGIGNIFIKNLDKSITQKELHDTFVAFGNILSCKIAADERSKSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVGRFIPRTNR-ANSDSDVK-FTNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDRKAHLASQYMQRVNPHRNNYPNQVSVNTXXXXXXXXXXXXXXYAFAPNASTPRVYTQSAAFMPPQNRWSNRMHPSQLQFNGGNMRQLANAH-FGNMEGSSVPIQN-----NTMGMQANQIRQVSMIPNQRPM-LXXXXXXXXXXXXXXGVANTVKSAPQNSRPITGVQMPITSQASNISQQRPPNQPTRQITGQSVISGNQNVNRPINNGSNQLVSGNLEPLTISTLASAPIAEQKQMLGERLYPLVHRMYPELAGKITGMLLEIDNTELLHMLESEDSLTTKIEEAMNVLQSHK 2110
            S PMASLYVGDLHP+VTEAM+YEKFS  GP+LSIRVCRDMITR+SLGYAYVNFQ  ADAE ALD MNFD +KG+ +RIMWSQRDPSLRKSG+GNIFIKNLDKSI  K L+DTF AFGNILSCK+  DE   SKGYGFVHFET+ AA  AID +NGML+ ++KVFVGRF  R  R A   +  K FTN YIKNFGED+DDE+L+EMF ++G   S KVM D+NGKSKGFGFV F+  E A+ AV  +NGK    + +YVGRAQKK ER  EL+  FE+ + +R +RY QGVNLYVKNLDD IDD RL++EF  FG ITSAKVM +   RSKGFGFVCFS+PEEATKAVTEMNG+I  +KPLYVALAQRKE+R+AHL +QYMQR+   R   PN V +N                 + P  S+  +    AA+ PP          +QL+ +     Q A  H F NM G+  P        +TM   +NQ+ +V  +  QR    S                + V++ PQ  +   GV+ P      +++ Q  P  P   + GQ                         EPLT S LA+AP  EQKQMLGERL+PL+  M+P LAGKITGMLLEIDN+ELLHMLES +SL +K++EA+ VLQ+H+
Sbjct:    7 SYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYGFVHFETQEAAERAIDKMNGMLLNDRKVFVGRFKSRKEREAELGARAKEFTNVYIKNFGEDMDDERLKEMFGKYGPALSVKVMTDDNGKSKGFGFVSFERHEDAQKAVDDMNGKDMNGKAIYVGRAQKKVERQTELKRKFEQMKQDRITRY-QGVNLYVKNLDDGIDDERLRKEFSPFGTITSAKVMME-GGRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEERQAHLTNQYMQRMASVR--VPNPV-IN----------------PYQPPPSSYFMAQNRAAYYPPGQI-------AQLRPSPRWTAQGARPHPFQNMPGAIRPTAPRPPTFSTMRPASNQVPRV--VSAQRVANTSTQTMGPRPTTAAAAATSAVRTVPQ-YKYAAGVRNP----QQHLNTQ--PQVPAVHVQGQ-------------------------EPLTASMLAAAPPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQ 608          

HSP 2 Score: 196.438 bits (498), Expect = 5.025e-53
Identity = 112/297 (37.71%), Postives = 168/297 (56.57%), Query Frame = 2
Query:  392 DPSLRKSGIGNIFIKNLDKSITQKELHDTFVAFGNILSCKIAADERS-KSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVGRFIPRTNRANSDSDVKFTNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDRKAHLASQYMQ 1279
            +PS     + ++++ +L   +T+  L++ F   G ILS ++  D  + +S GY +V+F+  A A  A+D +N  +IK K V     I  + R  S       N +IKN  + +D++ L + F  FG I S KV+ DENG SKG+GFV F+  E AE A+  +NG +  DR+++VGR + + ER            AE  +R  +  N+Y+KN  + +DD RLK+ F  +G   S KVMTD N +SKGFGFV F   E+A KAV +MNGK    K +YV  AQ+K +R+  L  ++ Q
Sbjct:    2 NPSAPSYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPV----RIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYGFVHFETQEAAERAIDKMNGMLLNDRKVFVGRFKSRKER-----------EAELGARAKEFTNVYIKNFGEDMDDERLKEMFGKYGPALSVKVMTDDNGKSKGFGFVSFERHEDAQKAVDDMNGKDMNGKAIYVGRAQKKVERQTELKRKFEQ 282          
BLAST of cytoplasmic poly(A) binding protein vs. Ensembl Xenopus
Match: tmem101 (transmembrane protein 101 [Source:Xenbase;Acc:XB-GENE-977590])

HSP 1 Score: 636.336 bits (1640), Expect = 0.000e+0
Identity = 364/663 (54.90%), Postives = 436/663 (65.76%), Query Frame = 2
Query:  143 SIPMASLYVGDLHPEVTEAMIYEKFSSCGPVLSIRVCRDMITRKSLGYAYVNFQNAADAESALDRMNFDTMKGRSIRIMWSQRDPSLRKSGIGNIFIKNLDKSITQKELHDTFVAFGNILSCKIAADERSKSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVGRFIPRTNR-ANSDSDVK-FTNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDRKAHLASQYMQRVNPHRNNYPNQVSVNTXXXXXXXXXXXXXXYAFAPNASTPRVYTQSAAFMPP----QNRWSNRMHPSQLQFNGGNMRQLANAHFGNMEGSSVPIQNNTMGMQANQIRQVSMIPNQRPM-LXXXXXXXXXXXXXXGVANTVKSAPQNSRPITGVQMPITSQASNISQQRPPNQPTRQITGQSVISGNQNVNRPINNGSNQLVSGNLEPLTISTLASAPIAEQKQMLGERLYPLVHRMYPELAGKITGMLLEIDNTELLHMLESEDSLTTKIEEAMNVLQSHK 2110
            S PMASLYVGDLHP+VTEAM+YEKFS  GP+LSIRVCRDMITR+SLGYAYVNFQ  ADAE ALD MNFD +KG+ +RIMWSQRDPSLRKSG+GNIFIKNLDKSI  K L+DTF AFGNILSCK+  DE   SKGYGFVHFET+ AA  AID +NGML+ ++KVFVGRF  R  R A   +  K FTN YIKNFGED+DDE+L+EMF ++    S KVM D+NGKSKGFGFV F+  E A+ AV  +NGK    + +YVGRAQKK ER  EL+  FE+ + +R +RY QGVNLYVKNLDD IDD RL++EF  FG ITSAKVM +   RSKGFGFVCFS+PEEATKAVTEMNG+I  +KPLYVALAQRKE+R+AHL +QYMQR+   R   PN V +N                   P    P  Y  +A  +PP    Q R S R      Q   G +R  A            P   +TM   +NQ+ +V  +  QR    S                + V++ PQ  +   GV+ P         QQ    QP  Q+  Q++     N  RP  +   Q      EPLT S LA+AP  EQKQMLGERL+PL+  M+P LAGKITGMLLEIDN+ELLHMLES +SL +K++EA+ VLQ+H+
Sbjct:    7 SYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYGFVHFETQEAAERAIDKMNGMLLNDRKVFVGRFKSRKEREAELGARAKEFTNVYIKNFGEDMDDERLKEMFGKYA--LSVKVMTDDNGKSKGFGFVSFERHEDAQKAVDDMNGKDMNGKAIYVGRAQKKVERQTELKRKFEQMKQDRITRY-QGVNLYVKNLDDGIDDERLRKEFSPFGTITSAKVMME-GGRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEERQAHLTNQYMQRMASVR--VPNPV-IN-------------------PYQPPPSSYFMAA--IPPVCIAQLRPSPRWTAQAFQNMPGAIRPTA----------PRPPTFSTMRPASNQVPRV--VSAQRVANTSTQTMGPRPTTAAAAATSAVRTVPQ-YKYAAGVRNP---------QQHLNTQP--QVAMQNI----HNFPRPAVHVQGQ------EPLTASMLAAAPPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQ 606          

HSP 2 Score: 190.274 bits (482), Expect = 7.639e-51
Identity = 111/297 (37.37%), Postives = 167/297 (56.23%), Query Frame = 2
Query:  392 DPSLRKSGIGNIFIKNLDKSITQKELHDTFVAFGNILSCKIAADERS-KSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVGRFIPRTNRANSDSDVKFTNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDRKAHLASQYMQ 1279
            +PS     + ++++ +L   +T+  L++ F   G ILS ++  D  + +S GY +V+F+  A A  A+D +N  +IK K V     I  + R  S       N +IKN  + +D++ L + F  FG I S KV+ DENG SKG+GFV F+  E AE A+  +NG +  DR+++VGR + + ER            AE  +R  +  N+Y+KN  + +DD RLK+ F  +    S KVMTD N +SKGFGFV F   E+A KAV +MNGK    K +YV  AQ+K +R+  L  ++ Q
Sbjct:    2 NPSAPSYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPV----RIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYGFVHFETQEAAERAIDKMNGMLLNDRKVFVGRFKSRKER-----------EAELGARAKEFTNVYIKNFGEDMDDERLKEMFGKYA--LSVKVMTDDNGKSKGFGFVSFERHEDAQKAVDDMNGKDMNGKAIYVGRAQKKVERQTELKRKFEQ 280          
BLAST of cytoplasmic poly(A) binding protein vs. Ensembl Xenopus
Match: tmem101 (transmembrane protein 101 [Source:Xenbase;Acc:XB-GENE-977590])

HSP 1 Score: 629.017 bits (1621), Expect = 0.000e+0
Identity = 368/681 (54.04%), Postives = 446/681 (65.49%), Query Frame = 2
Query:  143 SIPMASLYVGDLHPEVTEAMIYEKFSSCGPVLSIRVCRDMITRKSLGYAYVNFQNAADAESALDRMNFDTMKGRSIRIMWSQRDPSLRKSGIGNIFIKNLDKSITQKELHDTFVAFGNILSCKIAADERSKSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVGRFIPRTNR-ANSDSDVK-FTNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDRKAHLASQYMQRVNPHRNNYPNQVSVNTXXXXXXXXXXXXXXYAFAPNASTPRVYTQSAAFMPPQNRWSNRMHP----SQLQFNGGNMRQLANAH-FGNMEGSSVPIQN-----NTMGMQANQIRQVSMIPNQRPMLXXXXXXXXXXXXXXGVANTVKSAPQ---NSRPITGVQMPITSQASNISQQRPPNQPTRQITGQSVISGNQNV-NRPINNGSNQLVSGNLEP---------LTISTLASAPIAEQKQMLGERLYPLVHRMYPELAGKITGMLLEIDNTELLHMLESEDSLTTKIEEAMNVLQSHK 2110
            S PMASLYVGDLHP+VTEAM+YEKFS  GP+LSIRVCRDMITR+SLGYAYVNFQ  ADAE ALD MNFD +KG+ +RIMWSQRDPSLRKSG+GNIFIKNLDKSI  K L+DTF AFGNILSCK+  DE   SKGYGFVHFET+ AA  AID +NGML+ ++KVFVGRF  R  R A   +  K FTN YIKNFGED+DDE+L+EMF ++    S KVM D+NGKSKGFGFV F+  E A+ AV  +NGK    + +YVGRAQKK ER  EL+  FE+ + +R +RY QGVNLYVKNLDD IDD RL++EF  FG ITSAKVM +   RSKGFGFVCFS+PEEATKAVTEMNG+I  +KPLYVALAQRKE+R+AHL +QYMQR+   R   PN V +N                   P    P  Y   AA  P QNR +   +P    +QL+ +     Q A  H F NM G+  P        +TM   +NQ+ +V  +  QR                 GV N     PQ   N++P   +Q     Q   +         T Q    +   G +N+ N P    ++ L++  L+P         LT S LA+AP  EQKQMLGERL+PL+  M+P LAGKITGMLLEIDN+ELLHMLES +SL +K++EA+ VLQ+H+
Sbjct:    7 SYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYGFVHFETQEAAERAIDKMNGMLLNDRKVFVGRFKSRKEREAELGARAKEFTNVYIKNFGEDMDDERLKEMFGKYA--LSVKVMTDDNGKSKGFGFVSFERHEDAQKAVDDMNGKDMNGKAIYVGRAQKKVERQTELKRKFEQMKQDRITRY-QGVNLYVKNLDDGIDDERLRKEFSPFGTITSAKVMME-GGRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEERQAHLTNQYMQRMASVR--VPNPV-IN-------------------PYQPPPSSYFM-AAIPPAQNRAA--YYPPGQIAQLRPSPRWTAQGARPHPFQNMPGAIRPTAPRPPTFSTMRPASNQVPRV--VSAQR-----VGKGFCIYKYAAGVRN-----PQQHLNTQPQVAMQ-----QVCVLVMLL-----TMQTALYTTFQGCRNIHNFP---RASILITCLLQPAVHVQGQEPLTASMLAAAPPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQ 632          

HSP 2 Score: 189.889 bits (481), Expect = 1.752e-50
Identity = 111/297 (37.37%), Postives = 167/297 (56.23%), Query Frame = 2
Query:  392 DPSLRKSGIGNIFIKNLDKSITQKELHDTFVAFGNILSCKIAADERS-KSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVGRFIPRTNRANSDSDVKFTNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDRKAHLASQYMQ 1279
            +PS     + ++++ +L   +T+  L++ F   G ILS ++  D  + +S GY +V+F+  A A  A+D +N  +IK K V     I  + R  S       N +IKN  + +D++ L + F  FG I S KV+ DENG SKG+GFV F+  E AE A+  +NG +  DR+++VGR + + ER            AE  +R  +  N+Y+KN  + +DD RLK+ F  +    S KVMTD N +SKGFGFV F   E+A KAV +MNGK    K +YV  AQ+K +R+  L  ++ Q
Sbjct:    2 NPSAPSYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPV----RIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYGFVHFETQEAAERAIDKMNGMLLNDRKVFVGRFKSRKER-----------EAELGARAKEFTNVYIKNFGEDMDDERLKEMFGKYA--LSVKVMTDDNGKSKGFGFVSFERHEDAQKAVDDMNGKDMNGKAIYVGRAQKKVERQTELKRKFEQ 280          
BLAST of cytoplasmic poly(A) binding protein vs. Ensembl Xenopus
Match: pabpc4 (poly(A) binding protein cytoplasmic 4 [Source:NCBI gene;Acc:548470])

HSP 1 Score: 627.861 bits (1618), Expect = 0.000e+0
Identity = 357/677 (52.73%), Postives = 436/677 (64.40%), Query Frame = 2
Query:  140 NSIPMASLYVGDLHPEVTEAMIYEKFSSCGPVLSIRVCRDMITRKSLGYAYVNFQNAADAESALDRMNFDTMKGRSIRIMWSQRDPSLRKSGIGNIFIKNLDKSITQKELHDTFVAFGNILSCKIAADERSKSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVGRFIPRTNR-ANSDSDVK-FTNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDRKAHLASQYMQRVNPHRNNYPNQVSVNTXXXXXXXXXXXXXXYAFAPNASTPRVYTQS-AAFMPPQNRWSNRMHPSQLQFNGGNMRQ------LANAHFGNMEGS-SVPIQNNTMGMQANQIRQVSMIPNQRPMLXXXXXXXXXXXXXXGVANTVKSAPQNSRPITGVQMPITSQASNISQQRPPNQPTRQITGQSVISGNQNVNRPINNGSNQLVSGNLEPLTISTLASAPIAEQKQMLGERLYPLVHRMYPELAGKITGMLLEIDNTELLHMLESEDSLTTKIEEAMNVLQSHKNQNVIVTDMG 2140
            +S PMASLYVGDLHP+VTEAM+YEKFS  GPVLSIRVCRDMITR+SLGYAYVNFQ  ADAE ALD MNFD +KG+ IRIMWSQRDPSLRKSG+GN+FIKNLDKSI  K L+DTF AFGNILSCK+  DE   SKGY FVHFET+ AA  AI+ +NGML+ ++KVFVGRF  R  R A   +  K FTN YIKNFGED+DDE+L+E F ++G+  S KVM D +GKSKGFGFV F+  E A  AV  +NGK    + ++VGRAQKK ER  EL+  FE+ + ER SRY QGVNLY+KNLDD+IDD +L++EF  FG+ITSAKVM +   RSKGFGFVCFS+PEEATKAVTEMNG+I GSKPLYVALAQRKE+RKAHL +QYMQR+   R      +  NTLI+   P        A     S P  Y  +  A + P  RW     P   Q     +RQ      L +    N +G+  +P     +G +  Q    ++  N+  + S+   +     +       V        P+ GVQ P+         Q P  QP   + GQ  ++                          S LASAP  EQKQMLGERL+PL+  M+P LAGKITGMLLEIDN+ELLHMLES +SL +K+EEA+ VLQ+H+ +      +G
Sbjct:    6 SSYPMASLYVGDLHPDVTEAMLYEKFSPAGPVLSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPIRIMWSQRDPSLRKSGVGNVFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYAFVHFETQDAADRAIEKMNGMLLNDRKVFVGRFKCRREREAELGAKAKEFTNVYIKNFGEDMDDERLKETFSKYGKTLSVKVMTDPSGKSKGFGFVSFERHEDANKAVDDMNGKDVNGKIMFVGRAQKKVERQAELKRRFEQLKQERISRY-QGVNLYIKNLDDTIDDEKLRKEFSPFGSITSAKVMLE-EGRSKGFGFVCFSSPEEATKAVTEMNGRIVGSKPLYVALAQRKEERKAHLTNQYMQRIAGMR-----ALPANTLINQFQPAPGGYFVPAVPQTQSRPTYYAPNHMAQIRPGPRWQQTGRPQGFQPMPNTLRQSGPRQSLRHMPPSNTQGTRGIPSVTQRVGKKHIQTCAFALHFNR--VSSSTQTMGPRPPVSAPPPRAVPPYKYTRCPLPGVQ-PL---------QTP--QPAVHVQGQEPLTA-------------------------SMLASAPPQEQKQMLGERLFPLIQAMHPSLAGKITGMLLEIDNSELLHMLESPESLRSKVEEAVAVLQAHQAKKDAAQKVG 635          
BLAST of cytoplasmic poly(A) binding protein vs. Ensembl Mouse
Match: Pabpc1 (poly(A) binding protein, cytoplasmic 1 [Source:MGI Symbol;Acc:MGI:1349722])

HSP 1 Score: 648.662 bits (1672), Expect = 0.000e+0
Identity = 365/674 (54.15%), Postives = 436/674 (64.69%), Query Frame = 2
Query:  143 SIPMASLYVGDLHPEVTEAMIYEKFSSCGPVLSIRVCRDMITRKSLGYAYVNFQNAADAESALDRMNFDTMKGRSIRIMWSQRDPSLRKSGIGNIFIKNLDKSITQKELHDTFVAFGNILSCKIAADERSKSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVGRFIPRTNR-ANSDSDVK-FTNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDRKAHLASQYMQRVNPHRNNYPNQVSVNTXXXXXXXXXXXXXXYAFAPN-----ASTPRVYTQSAAFMP-------PQNRWS---NRMHPSQLQFNGGNMRQLA-NAHFGNMEGSSVPIQNNTMGMQANQIRQVSMIPNQRPMLXXXXXXXXXXXXXXGVANTVKSAPQNSRPITGVQMPITSQASNISQQRPPNQPTRQITGQSVISGNQNVNRPINNGSNQLVSGNLEPLTISTLASAPIAEQKQMLGERLYPLVHRMYPELAGKITGMLLEIDNTELLHMLESEDSLTTKIEEAMNVLQSHK 2110
            S PMASLYVGDLHP+VTEAM+YEKFS  GP+LSIRVCRDMITR+SLGYAYVNFQ  ADAE ALD MNFD +KG+ +RIMWSQRDPSLRKSG+GNIFIKNLDKSI  K L+DTF AFGNILSCK+  DE   SKGYGFVHFET+ AA  AI+ +NGML+ ++KVFVGRF  R  R A   +  K FTN YIKNFGED+DDE+L+E+F +FG   S KVM DE+GKSKGFGFV F+  E A+ AV  +NGK    +Q+YVGRAQKK ER  EL+  FE+ + +R +RY QGVNLYVKNLDD IDD RL++EF  FG ITSAKVM +   RSKGFGFVCFS+PEEATKAVTEMNG+I  +KPLYVALAQRKE+R+AHL +QYMQR+   R   PN V +N               Y  AP      A+ P+   ++A + P       P  RW+    R HP   Q   G +R  A    F  M  +S  +       +       +M P  RP  +  A               V++ PQ      GV+ P   Q  N   Q    QP   + GQ                         EPLT S LASAP  EQKQMLGERL+PL+  M+P LAGKITGMLLEIDN+ELLHMLES +SL +K++EA+ VLQ+H+
Sbjct:    7 SYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFVGRFKSRKEREAELGARAKEFTNVYIKNFGEDMDDERLKELFGKFGPALSVKVMTDESGKSKGFGFVSFERHEDAQKAVDEMNGKELNGKQIYVGRAQKKVERQTELKRKFEQMKQDRITRY-QGVNLYVKNLDDGIDDERLRKEFSPFGTITSAKVMME-GGRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEERQAHLTNQYMQRMASVR-AVPNPV-INP--------------YQPAPPSGYFMAAIPQTQNRAAYYPPSQIAQLRPSPRWTAQGARPHP--FQNMPGAIRPAAPRPPFSTMRPASSQVPRVMSTQRVANTSTQTMGP--RPAAAAAAATP-----------AVRTVPQYKY-AAGVRNP--QQHLNAQPQVTMQQPAVHVQGQ-------------------------EPLTASMLASAPPQEQKQMLGERLFPLIQAMHPSLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQ 618          

HSP 2 Score: 197.978 bits (502), Expect = 1.305e-53
Identity = 113/297 (38.05%), Postives = 169/297 (56.90%), Query Frame = 2
Query:  392 DPSLRKSGIGNIFIKNLDKSITQKELHDTFVAFGNILSCKIAADERS-KSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVGRFIPRTNRANSDSDVKFTNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDRKAHLASQYMQ 1279
            +PS     + ++++ +L   +T+  L++ F   G ILS ++  D  + +S GY +V+F+  A A  A+D +N  +IK K V     I  + R  S       N +IKN  + +D++ L + F  FG I S KV+ DENG SKG+GFV F+  E AE A++ +NG +  DR+++VGR + + ER            AE  +R  +  N+Y+KN  + +DD RLK+ F  FG   S KVMTD + +SKGFGFV F   E+A KAV EMNGK    K +YV  AQ+K +R+  L  ++ Q
Sbjct:    2 NPSAPSYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPV----RIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFVGRFKSRKER-----------EAELGARAKEFTNVYIKNFGEDMDDERLKELFGKFGPALSVKVMTDESGKSKGFGFVSFERHEDAQKAVDEMNGKELNGKQIYVGRAQKKVERQTELKRKFEQ 282          
BLAST of cytoplasmic poly(A) binding protein vs. Ensembl Mouse
Match: Pabpc2 (poly(A) binding protein, cytoplasmic 2 [Source:MGI Symbol;Acc:MGI:1349723])

HSP 1 Score: 587.415 bits (1513), Expect = 0.000e+0
Identity = 337/667 (50.52%), Postives = 415/667 (62.22%), Query Frame = 2
Query:  128 NQINNSIPMASLYVGDLHPEVTEAMIYEKFSSCGPVLSIRVCRDMITRKSLGYAYVNFQNAADAESALDRMNFDTMKGRSIRIMWSQRDPSLRKSGIGNIFIKNLDKSITQKELHDTFVAFGNILSCKIAADERSKSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVGRFIPRTNR-ANSDSDVK-FTNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDRKAHLASQYMQRVNPHRNNYPNQVSVNTXXXXXXXXXXXXXXYAFAPNASTPRVYTQSAAFMP-PQNRW---SNRMHPSQLQFNGGNMRQLANAHFGNMEGSSVPIQNNTMGMQANQIRQVSMIPNQRPMLXXXXXXXXXXXXXXGVANTVKSAPQNSRPITGVQMPITSQASNISQQRPPNQPTRQITGQSVISGNQNVNRPINNGSNQLVSGNLEPLTISTLASAPIAEQKQMLGERLYPLVHRMYPELAGKITGMLLEIDNTELLHMLESEDSLTTKIEEAMNVLQSHK 2110
            N  +   PMASLYVGDLHP+VTEAM+YEKFSS GP+LSIRV RD+ITR+SLGYA VNF+  ADAE ALD MNFD +KG+ +RIMWSQRDPSLR+SG+GN+FIKNL+K+I  K L+DTF AFGNILSCK+ +DE   SKG+GFVHFETE AA  AI+ +NGML+ ++KVFVGRF  +  R A   +  K FTN YIKNFG+ +DDE L  +F  FG+I S KVM DE GKSKGFGFV F+  E A+ AV  +NGK    + +YVGRAQKK++R  EL+  FE+   ++S RY QG+NLYVKNLDD IDD RL++EF  FG ITS KVMT+   RSKGFGFVCFS+PEEATKAV+EMNG+I  +KPLYVALAQRKE+R+AHL +QY+QR+   R+  PN V+             S    A  P          S    P P  RW    +R HP      G        +    +  SS  +Q  T     N   Q++    QRP               +  A  V S PQ  +   GVQ       + ++Q     QP   I GQ                         EP T S L +AP  E KQMLGERL+PL+  M+P LAGKITGMLL+IDN+E L MLES  S  ++ EEA+  LQ+H+
Sbjct:    2 NSSDPGCPMASLYVGDLHPDVTEAMLYEKFSSAGPILSIRVYRDVITRRSLGYASVNFEQPADAERALDTMNFDVIKGKPVRIMWSQRDPSLRRSGVGNVFIKNLNKTIDNKALYDTFSAFGNILSCKVVSDENG-SKGHGFVHFETEEAAERAIEKMNGMLLNDRKVFVGRFKSQKEREAELGTGTKEFTNVYIKNFGDRMDDETLNGLFGRFGQILSVKVMTDEGGKSKGFGFVSFERHEDAQKAVDEMNGKELNGKHIYVGRAQKKDDRHTELKHKFEQVTQDKSIRY-QGINLYVKNLDDGIDDERLQKEFSPFGTITSTKVMTE-GGRSKGFGFVCFSSPEEATKAVSEMNGRIVATKPLYVALAQRKEERQAHLTNQYIQRMASVRSG-PNPVN-------PYQPASSSYSVAAVPQTQNCVPCCPSQIAQPRPSARWIAQGSRPHPFP-NVPGAIHPAAPRSSLTTVRPSSSHVQVTTAHRITNTSAQIT---GQRP-----------APASSATATPVHSIPQ-YKYAAGVQNSQQHLNAQLAQ-----QPAVCIQGQ-------------------------EPWTASMLVTAP-QEPKQMLGERLFPLIQAMHPTLAGKITGMLLDIDNSEPLRMLESPVSRCSRAEEAVATLQAHQ 610          
BLAST of cytoplasmic poly(A) binding protein vs. Ensembl Mouse
Match: Pabpc4 (poly(A) binding protein, cytoplasmic 4 [Source:MGI Symbol;Acc:MGI:2385206])

HSP 1 Score: 545.814 bits (1405), Expect = 0.000e+0
Identity = 266/388 (68.56%), Postives = 311/388 (80.15%), Query Frame = 2
Query:  128 NQINNSIPMASLYVGDLHPEVTEAMIYEKFSSCGPVLSIRVCRDMITRKSLGYAYVNFQNAADAESALDRMNFDTMKGRSIRIMWSQRDPSLRKSGIGNIFIKNLDKSITQKELHDTFVAFGNILSCKIAADERSKSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVGRFIPRTNR-ANSDSDVK-FTNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDRKAHLASQYMQRV 1285
            N   +S PMASLYVGDLH +VTEAM+YEKFS  GPVLSIRVCRDMITR+SLGYAYVNFQ  ADAE ALD MNFD MKG+ IRIMWSQRDPSLRKSG+GN+FIKNLDKSI  K L+DTF AFGNILSCK+  DE   SKGY FVHFET+ AA  AI+ +NGML+ ++KVFVGRF  R  R A   +  K FTN YIKNFGE++DD  L+E+F +FG+  S KVM D +GKSKGFGFV ++  E A  AV+ +NGK    + ++VGRAQKK ER  EL+  FE+ + ER SRY QGVNLY+KNLDD+IDD +L++EF  FG+ITSAKVM + + RSKGFGFVCFS+PEEATKAVTEMNG+I GSKPLYVALAQRKE+RKAHL +QYMQRV
Sbjct:    2 NAAASSYPMASLYVGDLHSDVTEAMLYEKFSPAGPVLSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVMKGKPIRIMWSQRDPSLRKSGVGNVFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYAFVHFETQEAADKAIEKMNGMLLNDRKVFVGRFKSRKEREAELGAKAKEFTNVYIKNFGEEVDDGNLKELFSQFGKTLSVKVMRDSSGKSKGFGFVSYEKHEDANKAVEEMNGKEMSGKAIFVGRAQKKVERQAELKRKFEQLKQERISRY-QGVNLYIKNLDDTIDDEKLRREFSPFGSITSAKVMLE-DGRSKGFGFVCFSSPEEATKAVTEMNGRIVGSKPLYVALAQRKEERKAHLTNQYMQRV 386          

HSP 2 Score: 114.39 bits (285), Expect = 9.824e-26
Identity = 54/86 (62.79%), Postives = 67/86 (77.91%), Query Frame = 2
Query: 1883 EPLTISTLASAPIAEQKQMLGERLYPLVHRMYPELAGKITGMLLEIDNTELLHMLESEDSLTTKIEEAMNVLQSHKNQNVIVTDMG 2140
            EPLT S LA+AP  EQKQMLGERL+PL+  M+  LAGKITGMLLEIDN+ELLHMLES +SL +K++EA+ VLQ+H  +      +G
Sbjct:  539 EPLTASMLAAAPPQEQKQMLGERLFPLIQTMHSNLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHHAKKEAAQKVG 624          
BLAST of cytoplasmic poly(A) binding protein vs. Ensembl Mouse
Match: Pabpc4 (poly(A) binding protein, cytoplasmic 4 [Source:MGI Symbol;Acc:MGI:2385206])

HSP 1 Score: 544.658 bits (1402), Expect = 0.000e+0
Identity = 266/388 (68.56%), Postives = 311/388 (80.15%), Query Frame = 2
Query:  128 NQINNSIPMASLYVGDLHPEVTEAMIYEKFSSCGPVLSIRVCRDMITRKSLGYAYVNFQNAADAESALDRMNFDTMKGRSIRIMWSQRDPSLRKSGIGNIFIKNLDKSITQKELHDTFVAFGNILSCKIAADERSKSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVGRFIPRTNR-ANSDSDVK-FTNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDRKAHLASQYMQRV 1285
            N   +S PMASLYVGDLH +VTEAM+YEKFS  GPVLSIRVCRDMITR+SLGYAYVNFQ  ADAE ALD MNFD MKG+ IRIMWSQRDPSLRKSG+GN+FIKNLDKSI  K L+DTF AFGNILSCK+  DE   SKGY FVHFET+ AA  AI+ +NGML+ ++KVFVGRF  R  R A   +  K FTN YIKNFGE++DD  L+E+F +FG+  S KVM D +GKSKGFGFV ++  E A  AV+ +NGK    + ++VGRAQKK ER  EL+  FE+ + ER SRY QGVNLY+KNLDD+IDD +L++EF  FG+ITSAKVM + + RSKGFGFVCFS+PEEATKAVTEMNG+I GSKPLYVALAQRKE+RKAHL +QYMQRV
Sbjct:    2 NAAASSYPMASLYVGDLHSDVTEAMLYEKFSPAGPVLSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVMKGKPIRIMWSQRDPSLRKSGVGNVFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYAFVHFETQEAADKAIEKMNGMLLNDRKVFVGRFKSRKEREAELGAKAKEFTNVYIKNFGEEVDDGNLKELFSQFGKTLSVKVMRDSSGKSKGFGFVSYEKHEDANKAVEEMNGKEMSGKAIFVGRAQKKVERQAELKRKFEQLKQERISRY-QGVNLYIKNLDDTIDDEKLRREFSPFGSITSAKVMLE-DGRSKGFGFVCFSSPEEATKAVTEMNGRIVGSKPLYVALAQRKEERKAHLTNQYMQRV 386          

HSP 2 Score: 114.39 bits (285), Expect = 1.096e-25
Identity = 54/86 (62.79%), Postives = 67/86 (77.91%), Query Frame = 2
Query: 1883 EPLTISTLASAPIAEQKQMLGERLYPLVHRMYPELAGKITGMLLEIDNTELLHMLESEDSLTTKIEEAMNVLQSHKNQNVIVTDMG 2140
            EPLT S LA+AP  EQKQMLGERL+PL+  M+  LAGKITGMLLEIDN+ELLHMLES +SL +K++EA+ VLQ+H  +      +G
Sbjct:  568 EPLTASMLAAAPPQEQKQMLGERLFPLIQTMHSNLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHHAKKEAAQKVG 653          
BLAST of cytoplasmic poly(A) binding protein vs. Ensembl Mouse
Match: Pabpc4 (poly(A) binding protein, cytoplasmic 4 [Source:MGI Symbol;Acc:MGI:2385206])

HSP 1 Score: 544.273 bits (1401), Expect = 0.000e+0
Identity = 266/388 (68.56%), Postives = 311/388 (80.15%), Query Frame = 2
Query:  128 NQINNSIPMASLYVGDLHPEVTEAMIYEKFSSCGPVLSIRVCRDMITRKSLGYAYVNFQNAADAESALDRMNFDTMKGRSIRIMWSQRDPSLRKSGIGNIFIKNLDKSITQKELHDTFVAFGNILSCKIAADERSKSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVGRFIPRTNR-ANSDSDVK-FTNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDRKAHLASQYMQRV 1285
            N   +S PMASLYVGDLH +VTEAM+YEKFS  GPVLSIRVCRDMITR+SLGYAYVNFQ  ADAE ALD MNFD MKG+ IRIMWSQRDPSLRKSG+GN+FIKNLDKSI  K L+DTF AFGNILSCK+  DE   SKGY FVHFET+ AA  AI+ +NGML+ ++KVFVGRF  R  R A   +  K FTN YIKNFGE++DD  L+E+F +FG+  S KVM D +GKSKGFGFV ++  E A  AV+ +NGK    + ++VGRAQKK ER  EL+  FE+ + ER SRY QGVNLY+KNLDD+IDD +L++EF  FG+ITSAKVM + + RSKGFGFVCFS+PEEATKAVTEMNG+I GSKPLYVALAQRKE+RKAHL +QYMQRV
Sbjct:    2 NAAASSYPMASLYVGDLHSDVTEAMLYEKFSPAGPVLSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVMKGKPIRIMWSQRDPSLRKSGVGNVFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYAFVHFETQEAADKAIEKMNGMLLNDRKVFVGRFKSRKEREAELGAKAKEFTNVYIKNFGEEVDDGNLKELFSQFGKTLSVKVMRDSSGKSKGFGFVSYEKHEDANKAVEEMNGKEMSGKAIFVGRAQKKVERQAELKRKFEQLKQERISRY-QGVNLYIKNLDDTIDDEKLRREFSPFGSITSAKVMLE-DGRSKGFGFVCFSSPEEATKAVTEMNGRIVGSKPLYVALAQRKEERKAHLTNQYMQRV 386          

HSP 2 Score: 114.005 bits (284), Expect = 1.098e-25
Identity = 54/86 (62.79%), Postives = 67/86 (77.91%), Query Frame = 2
Query: 1883 EPLTISTLASAPIAEQKQMLGERLYPLVHRMYPELAGKITGMLLEIDNTELLHMLESEDSLTTKIEEAMNVLQSHKNQNVIVTDMG 2140
            EPLT S LA+AP  EQKQMLGERL+PL+  M+  LAGKITGMLLEIDN+ELLHMLES +SL +K++EA+ VLQ+H  +      +G
Sbjct:  523 EPLTASMLAAAPPQEQKQMLGERLFPLIQTMHSNLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHHAKKEAAQKVG 608          
BLAST of cytoplasmic poly(A) binding protein vs. UniProt/SwissProt
Match: sp|P29341|PABP1_MOUSE (Polyadenylate-binding protein 1 OS=Mus musculus OX=10090 GN=Pabpc1 PE=1 SV=2)

HSP 1 Score: 648.662 bits (1672), Expect = 0.000e+0
Identity = 365/674 (54.15%), Postives = 436/674 (64.69%), Query Frame = 2
Query:  143 SIPMASLYVGDLHPEVTEAMIYEKFSSCGPVLSIRVCRDMITRKSLGYAYVNFQNAADAESALDRMNFDTMKGRSIRIMWSQRDPSLRKSGIGNIFIKNLDKSITQKELHDTFVAFGNILSCKIAADERSKSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVGRFIPRTNR-ANSDSDVK-FTNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDRKAHLASQYMQRVNPHRNNYPNQVSVNTXXXXXXXXXXXXXXYAFAPN-----ASTPRVYTQSAAFMP-------PQNRWS---NRMHPSQLQFNGGNMRQLA-NAHFGNMEGSSVPIQNNTMGMQANQIRQVSMIPNQRPMLXXXXXXXXXXXXXXGVANTVKSAPQNSRPITGVQMPITSQASNISQQRPPNQPTRQITGQSVISGNQNVNRPINNGSNQLVSGNLEPLTISTLASAPIAEQKQMLGERLYPLVHRMYPELAGKITGMLLEIDNTELLHMLESEDSLTTKIEEAMNVLQSHK 2110
            S PMASLYVGDLHP+VTEAM+YEKFS  GP+LSIRVCRDMITR+SLGYAYVNFQ  ADAE ALD MNFD +KG+ +RIMWSQRDPSLRKSG+GNIFIKNLDKSI  K L+DTF AFGNILSCK+  DE   SKGYGFVHFET+ AA  AI+ +NGML+ ++KVFVGRF  R  R A   +  K FTN YIKNFGED+DDE+L+E+F +FG   S KVM DE+GKSKGFGFV F+  E A+ AV  +NGK    +Q+YVGRAQKK ER  EL+  FE+ + +R +RY QGVNLYVKNLDD IDD RL++EF  FG ITSAKVM +   RSKGFGFVCFS+PEEATKAVTEMNG+I  +KPLYVALAQRKE+R+AHL +QYMQR+   R   PN V +N               Y  AP      A+ P+   ++A + P       P  RW+    R HP   Q   G +R  A    F  M  +S  +       +       +M P  RP  +  A               V++ PQ      GV+ P   Q  N   Q    QP   + GQ                         EPLT S LASAP  EQKQMLGERL+PL+  M+P LAGKITGMLLEIDN+ELLHMLES +SL +K++EA+ VLQ+H+
Sbjct:    7 SYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFVGRFKSRKEREAELGARAKEFTNVYIKNFGEDMDDERLKELFGKFGPALSVKVMTDESGKSKGFGFVSFERHEDAQKAVDEMNGKELNGKQIYVGRAQKKVERQTELKRKFEQMKQDRITRY-QGVNLYVKNLDDGIDDERLRKEFSPFGTITSAKVMME-GGRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEERQAHLTNQYMQRMASVR-AVPNPV-INP--------------YQPAPPSGYFMAAIPQTQNRAAYYPPSQIAQLRPSPRWTAQGARPHP--FQNMPGAIRPAAPRPPFSTMRPASSQVPRVMSTQRVANTSTQTMGP--RPAAAAAAATP-----------AVRTVPQYKY-AAGVRNP--QQHLNAQPQVTMQQPAVHVQGQ-------------------------EPLTASMLASAPPQEQKQMLGERLFPLIQAMHPSLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQ 618          

HSP 2 Score: 197.978 bits (502), Expect = 9.126e-53
Identity = 113/297 (38.05%), Postives = 169/297 (56.90%), Query Frame = 2
Query:  392 DPSLRKSGIGNIFIKNLDKSITQKELHDTFVAFGNILSCKIAADERS-KSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVGRFIPRTNRANSDSDVKFTNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDRKAHLASQYMQ 1279
            +PS     + ++++ +L   +T+  L++ F   G ILS ++  D  + +S GY +V+F+  A A  A+D +N  +IK K V     I  + R  S       N +IKN  + +D++ L + F  FG I S KV+ DENG SKG+GFV F+  E AE A++ +NG +  DR+++VGR + + ER            AE  +R  +  N+Y+KN  + +DD RLK+ F  FG   S KVMTD + +SKGFGFV F   E+A KAV EMNGK    K +YV  AQ+K +R+  L  ++ Q
Sbjct:    2 NPSAPSYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPV----RIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFVGRFKSRKER-----------EAELGARAKEFTNVYIKNFGEDMDDERLKELFGKFGPALSVKVMTDESGKSKGFGFVSFERHEDAQKAVDEMNGKELNGKQIYVGRAQKKVERQTELKRKFEQ 282          
BLAST of cytoplasmic poly(A) binding protein vs. UniProt/SwissProt
Match: sp|Q9EPH8|PABP1_RAT (Polyadenylate-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Pabpc1 PE=1 SV=1)

HSP 1 Score: 647.121 bits (1668), Expect = 0.000e+0
Identity = 364/677 (53.77%), Postives = 437/677 (64.55%), Query Frame = 2
Query:  143 SIPMASLYVGDLHPEVTEAMIYEKFSSCGPVLSIRVCRDMITRKSLGYAYVNFQNAADAESALDRMNFDTMKGRSIRIMWSQRDPSLRKSGIGNIFIKNLDKSITQKELHDTFVAFGNILSCKIAADERSKSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVGRFIPRTNR-ANSDSDVK-FTNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDRKAHLASQYMQRVNPHRNNYPNQVSVNTXXXXXXXXXXXXXXYAFAPN-----ASTPRVYTQSAAFMP-------PQNRWS---NRMHPSQLQFNGGNMRQLANAHFGNMEGSSVPIQN----NTMGMQANQIRQVSMIPNQRPMLXXXXXXXXXXXXXXGVANTVKSAPQNSRPITGVQMPITSQASNISQQRPPNQPTRQITGQSVISGNQNVNRPINNGSNQLVSGNLEPLTISTLASAPIAEQKQMLGERLYPLVHRMYPELAGKITGMLLEIDNTELLHMLESEDSLTTKIEEAMNVLQSHK 2110
            S PMASLYVGDLHP+VTEAM+YEKFS  GP+LSIRVCRDMITR+SLGYAYVNFQ  ADAE ALD MNFD +KG+ +RIMWSQRDPSLRKSG+GNIFIKNLDKSI  K L+DTF AFGNILSCK+  DE   SKGYGFVHFET+ AA  AI+ +NGML+ ++KVFVGRF  R  R A   +  K FTN YIKNFGED+DDE+L+E+F +FG   S KVM DE+GKSKGFGFV F+  E A+ AV  +NGK    +Q+YVGRAQKK ER  EL+  FE+ + +R +RY QGVNLYVKNLDD IDD RL++EF  FG ITSAKVM +   RSKGFGFVCFS+PEEATKAVTEMNG+I  +KPLYVALAQRKE+R+AHL +QYMQR+   R   PN V +N               Y  AP      A+ P+   ++A + P       P  RW+    R HP                 F NM G+  P       +TM   ++Q+ +V M   +    S                  V++ PQ  +   GV+ P   Q  N   Q    QP   + GQ                         EPLT S LASAP  EQKQMLGERL+PL+  M+P LAGKITGMLLEIDN+ELLHMLES +SL +K++EA+ VLQ+H+
Sbjct:    7 SYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFVGRFKSRKEREAELGARAKEFTNVYIKNFGEDMDDERLKELFGKFGPALSVKVMTDESGKSKGFGFVSFERHEDAQKAVDEMNGKELNGKQIYVGRAQKKVERQTELKRKFEQMKQDRITRY-QGVNLYVKNLDDGIDDERLRKEFSPFGTITSAKVMME-GGRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEERQAHLTNQYMQRMASVR-AVPNPV-INP--------------YQPAPPSGYFMAAIPQTQNRAAYYPPSQIAQLRPSPRWTAQGARPHP-----------------FQNMPGAIRPAAPRPPFSTMRPASSQVPRV-MSTQRVANTSTQTMGPRPAAAATAATPAVRTVPQ-YKYAAGVRNP--QQHLNAQPQVTMQQPAVHVQGQ-------------------------EPLTASMLASAPPQEQKQMLGERLFPLIQAMHPSLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQ 618          

HSP 2 Score: 197.978 bits (502), Expect = 1.129e-52
Identity = 113/297 (38.05%), Postives = 169/297 (56.90%), Query Frame = 2
Query:  392 DPSLRKSGIGNIFIKNLDKSITQKELHDTFVAFGNILSCKIAADERS-KSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVGRFIPRTNRANSDSDVKFTNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDRKAHLASQYMQ 1279
            +PS     + ++++ +L   +T+  L++ F   G ILS ++  D  + +S GY +V+F+  A A  A+D +N  +IK K V     I  + R  S       N +IKN  + +D++ L + F  FG I S KV+ DENG SKG+GFV F+  E AE A++ +NG +  DR+++VGR + + ER            AE  +R  +  N+Y+KN  + +DD RLK+ F  FG   S KVMTD + +SKGFGFV F   E+A KAV EMNGK    K +YV  AQ+K +R+  L  ++ Q
Sbjct:    2 NPSAPSYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPV----RIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFVGRFKSRKER-----------EAELGARAKEFTNVYIKNFGEDMDDERLKELFGKFGPALSVKVMTDESGKSKGFGFVSFERHEDAQKAVDEMNGKELNGKQIYVGRAQKKVERQTELKRKFEQ 282          
BLAST of cytoplasmic poly(A) binding protein vs. UniProt/SwissProt
Match: sp|F1QB54|PABPA_DANRE (Polyadenylate-binding protein 1A OS=Danio rerio OX=7955 GN=pabpc1a PE=1 SV=1)

HSP 1 Score: 646.736 bits (1667), Expect = 0.000e+0
Identity = 362/664 (54.52%), Postives = 433/664 (65.21%), Query Frame = 2
Query:  143 SIPMASLYVGDLHPEVTEAMIYEKFSSCGPVLSIRVCRDMITRKSLGYAYVNFQNAADAESALDRMNFDTMKGRSIRIMWSQRDPSLRKSGIGNIFIKNLDKSITQKELHDTFVAFGNILSCKIAADERSKSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVGRFIPRTNR-ANSDSDVK-FTNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDRKAHLASQYMQRVNPHRNNYPNQVSVNTXXXXXXXXXXXXXXYAFAPNASTPRVY--TQSAAFMPPQNRWSNRMHPSQLQFNGGNMRQLANAHFGNMEGSSVPIQNNTMGMQANQIRQVSMIP----NQRPMLXXXXXXXXXXXXXXGVANTVKSAPQNSRPITGVQMPITSQASNISQQRPPNQPTRQITGQSVISGNQNVNRPINNGSNQLVSGNLEPLTISTLASAPIAEQKQMLGERLYPLVHRMYPELAGKITGMLLEIDNTELLHMLESEDSLTTKIEEAMNVLQSHK 2110
            S PMASLYVGDLHP+VTEAM+YEKFS  GP+LSIRVCRDM+TR+SLGYAYVNFQ  ADAE ALD MNFD +KGR +RIMWSQRDPSLRKSG+GNIFIKNLDKSI  K L+DTF AFGNILSCK+  DE   SKGYGFVHFET  AA  AI+ +NGML+ ++KVFVGRF  R  R A   +  K FTN YIKNFGED+DDEKL+E+F ++G   S +VM D++GKSKGFGFV F+  E A+ AV  +NGK    +Q+YVGRAQKK ER  EL+  FE+ + +R +RY QGVNLYVKNLDD +DD RL++EF  FG ITSAKVM +   RSKGFGFVCFS+PEEATKAVTEMNG+I  +KPLYVALAQRKE+R+AHL SQYMQR+   R   PN V     ++   P  PS    A  P A     Y  T   A + P  RW+ +    Q              HF NM  ++V   +       N +R  S +P    +QR M S       +          V+  PQ      GV+ P   Q      Q P  QP   + GQ                         EPLT S LA+AP  EQKQMLGERL+PL+  M+P LAGKITGMLLEIDN+ELLHMLES +SL +K++EA+ VLQ+H+
Sbjct:    7 SYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMMTRRSLGYAYVNFQQPADAERALDTMNFDVIKGRPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYGFVHFETHEAAERAIEKMNGMLLNDRKVFVGRFKSRKEREAEMGARAKEFTNVYIKNFGEDMDDEKLKEIFCKYGPALSIRVMTDDSGKSKGFGFVSFERHEDAQRAVDEMNGKEMNGKQVYVGRAQKKGERQTELKRKFEQMKQDRMTRY-QGVNLYVKNLDDGLDDERLRKEFSPFGTITSAKVMME-GGRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEERQAHLTSQYMQRMASVR-AVPNPV-----LNPYQPAPPSGYFMAAIPQAQNRAAYYPTSQLAQLRPSPRWATQGVRPQ--------------HFQNMPNAAV-RPSAPRPQTFNPVRPASQVPRMMTSQR-MGSQAMGPRPAAAGAATGPAQVRGVPQYKY-APGVRNP--QQHMPTQPQVPMQQPAVHVQGQ-------------------------EPLTASMLAAAPPQEQKQMLGERLFPLIQNMHPSLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQ 617          

HSP 2 Score: 193.741 bits (491), Expect = 3.350e-51
Identity = 108/297 (36.36%), Postives = 169/297 (56.90%), Query Frame = 2
Query:  392 DPSLRKSGIGNIFIKNLDKSITQKELHDTFVAFGNILSCKIAADERS-KSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVGRFIPRTNRANSDSDVKFTNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDRKAHLASQYMQ 1279
            +PS     + ++++ +L   +T+  L++ F   G ILS ++  D  + +S GY +V+F+  A A  A+D +N  +IK + V     I  + R  S       N +IKN  + +D++ L + F  FG I S KV+ DENG SKG+GFV F+  E AE A++ +NG +  DR+++VGR + + ER            AE  +R  +  N+Y+KN  + +DD +LK+ F  +G   S +VMTD + +SKGFGFV F   E+A +AV EMNGK    K +YV  AQ+K +R+  L  ++ Q
Sbjct:    2 NPSAPSYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMMTRRSLGYAYVNFQQPADAERALDTMNFDVIKGRPV----RIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYGFVHFETHEAAERAIEKMNGMLLNDRKVFVGRFKSRKER-----------EAEMGARAKEFTNVYIKNFGEDMDDEKLKEIFCKYGPALSIRVMTDDSGKSKGFGFVSFERHEDAQRAVDEMNGKEMNGKQVYVGRAQKKGERQTELKRKFEQ 282          
BLAST of cytoplasmic poly(A) binding protein vs. UniProt/SwissProt
Match: sp|P11940|PABP1_HUMAN (Polyadenylate-binding protein 1 OS=Homo sapiens OX=9606 GN=PABPC1 PE=1 SV=2)

HSP 1 Score: 646.736 bits (1667), Expect = 0.000e+0
Identity = 364/674 (54.01%), Postives = 436/674 (64.69%), Query Frame = 2
Query:  143 SIPMASLYVGDLHPEVTEAMIYEKFSSCGPVLSIRVCRDMITRKSLGYAYVNFQNAADAESALDRMNFDTMKGRSIRIMWSQRDPSLRKSGIGNIFIKNLDKSITQKELHDTFVAFGNILSCKIAADERSKSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVGRFIPRTNR-ANSDSDVK-FTNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDRKAHLASQYMQRVNPHRNNYPNQVSVNTXXXXXXXXXXXXXXYAFAPN-----ASTPRVYTQSAAFMP-------PQNRWS---NRMHPSQLQFNGGNMRQLA-NAHFGNMEGSSVPIQNNTMGMQANQIRQVSMIPNQRPMLXXXXXXXXXXXXXXGVANTVKSAPQNSRPITGVQMPITSQASNISQQRPPNQPTRQITGQSVISGNQNVNRPINNGSNQLVSGNLEPLTISTLASAPIAEQKQMLGERLYPLVHRMYPELAGKITGMLLEIDNTELLHMLESEDSLTTKIEEAMNVLQSHK 2110
            S PMASLYVGDLHP+VTEAM+YEKFS  GP+LSIRVCRDMITR+SLGYAYVNFQ  ADAE ALD MNFD +KG+ +RIMWSQRDPSLRKSG+GNIFIKNLDKSI  K L+DTF AFGNILSCK+  DE   SKGYGFVHFET+ AA  AI+ +NGML+ ++KVFVGRF  R  R A   +  K FTN YIKNFGED+DDE+L+++F +FG   S KVM DE+GKSKGFGFV F+  E A+ AV  +NGK    +Q+YVGRAQKK ER  EL+  FE+ + +R +RY QGVNLYVKNLDD IDD RL++EF  FG ITSAKVM +   RSKGFGFVCFS+PEEATKAVTEMNG+I  +KPLYVALAQRKE+R+AHL +QYMQR+   R   PN V +N               Y  AP      A+ P+   ++A + P       P  RW+    R HP   Q   G +R  A    F  M  +S  +       +       +M P  RP  +  A               V++ PQ      GV+ P   Q  N   Q    QP   + GQ                         EPLT S LASAP  EQKQMLGERL+PL+  M+P LAGKITGMLLEIDN+ELLHMLES +SL +K++EA+ VLQ+H+
Sbjct:    7 SYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFVGRFKSRKEREAELGARAKEFTNVYIKNFGEDMDDERLKDLFGKFGPALSVKVMTDESGKSKGFGFVSFERHEDAQKAVDEMNGKELNGKQIYVGRAQKKVERQTELKRKFEQMKQDRITRY-QGVNLYVKNLDDGIDDERLRKEFSPFGTITSAKVMME-GGRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEERQAHLTNQYMQRMASVR-AVPNPV-INP--------------YQPAPPSGYFMAAIPQTQNRAAYYPPSQIAQLRPSPRWTAQGARPHP--FQNMPGAIRPAAPRPPFSTMRPASSQVPRVMSTQRVANTSTQTMGP--RPAAAAAAATP-----------AVRTVPQYKY-AAGVRNP--QQHLNAQPQVTMQQPAVHVQGQ-------------------------EPLTASMLASAPPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQ 618          

HSP 2 Score: 197.208 bits (500), Expect = 1.850e-52
Identity = 113/297 (38.05%), Postives = 168/297 (56.57%), Query Frame = 2
Query:  392 DPSLRKSGIGNIFIKNLDKSITQKELHDTFVAFGNILSCKIAADERS-KSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVGRFIPRTNRANSDSDVKFTNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDRKAHLASQYMQ 1279
            +PS     + ++++ +L   +T+  L++ F   G ILS ++  D  + +S GY +V+F+  A A  A+D +N  +IK K V     I  + R  S       N +IKN  + +D++ L + F  FG I S KV+ DENG SKG+GFV F+  E AE A++ +NG +  DR+++VGR + + ER            AE  +R  +  N+Y+KN  + +DD RLK  F  FG   S KVMTD + +SKGFGFV F   E+A KAV EMNGK    K +YV  AQ+K +R+  L  ++ Q
Sbjct:    2 NPSAPSYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPV----RIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFVGRFKSRKER-----------EAELGARAKEFTNVYIKNFGEDMDDERLKDLFGKFGPALSVKVMTDESGKSKGFGFVSFERHEDAQKAVDEMNGKELNGKQIYVGRAQKKVERQTELKRKFEQ 282          
BLAST of cytoplasmic poly(A) binding protein vs. UniProt/SwissProt
Match: sp|P61286|PABP1_BOVIN (Polyadenylate-binding protein 1 OS=Bos taurus OX=9913 GN=PABPC1 PE=2 SV=1)

HSP 1 Score: 646.736 bits (1667), Expect = 0.000e+0
Identity = 364/674 (54.01%), Postives = 436/674 (64.69%), Query Frame = 2
Query:  143 SIPMASLYVGDLHPEVTEAMIYEKFSSCGPVLSIRVCRDMITRKSLGYAYVNFQNAADAESALDRMNFDTMKGRSIRIMWSQRDPSLRKSGIGNIFIKNLDKSITQKELHDTFVAFGNILSCKIAADERSKSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVGRFIPRTNR-ANSDSDVK-FTNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDRKAHLASQYMQRVNPHRNNYPNQVSVNTXXXXXXXXXXXXXXYAFAPN-----ASTPRVYTQSAAFMP-------PQNRWS---NRMHPSQLQFNGGNMRQLA-NAHFGNMEGSSVPIQNNTMGMQANQIRQVSMIPNQRPMLXXXXXXXXXXXXXXGVANTVKSAPQNSRPITGVQMPITSQASNISQQRPPNQPTRQITGQSVISGNQNVNRPINNGSNQLVSGNLEPLTISTLASAPIAEQKQMLGERLYPLVHRMYPELAGKITGMLLEIDNTELLHMLESEDSLTTKIEEAMNVLQSHK 2110
            S PMASLYVGDLHP+VTEAM+YEKFS  GP+LSIRVCRDMITR+SLGYAYVNFQ  ADAE ALD MNFD +KG+ +RIMWSQRDPSLRKSG+GNIFIKNLDKSI  K L+DTF AFGNILSCK+  DE   SKGYGFVHFET+ AA  AI+ +NGML+ ++KVFVGRF  R  R A   +  K FTN YIKNFGED+DDE+L+++F +FG   S KVM DE+GKSKGFGFV F+  E A+ AV  +NGK    +Q+YVGRAQKK ER  EL+  FE+ + +R +RY QGVNLYVKNLDD IDD RL++EF  FG ITSAKVM +   RSKGFGFVCFS+PEEATKAVTEMNG+I  +KPLYVALAQRKE+R+AHL +QYMQR+   R   PN V +N               Y  AP      A+ P+   ++A + P       P  RW+    R HP   Q   G +R  A    F  M  +S  +       +       +M P  RP  +  A               V++ PQ      GV+ P   Q  N   Q    QP   + GQ                         EPLT S LASAP  EQKQMLGERL+PL+  M+P LAGKITGMLLEIDN+ELLHMLES +SL +K++EA+ VLQ+H+
Sbjct:    7 SYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFVGRFKSRKEREAELGARAKEFTNVYIKNFGEDMDDERLKDLFGKFGPALSVKVMTDESGKSKGFGFVSFERHEDAQKAVDEMNGKELNGKQIYVGRAQKKVERQTELKRKFEQMKQDRITRY-QGVNLYVKNLDDGIDDERLRKEFSPFGTITSAKVMME-GGRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEERQAHLTNQYMQRMASVR-AVPNPV-INP--------------YQPAPPSGYFMAAIPQTQNRAAYYPPSQIAQLRPSPRWTAQGARPHP--FQNMPGAIRPAAPRPPFSTMRPASSQVPRVMSTQRVANTSTQTMGP--RPAAAAAAATP-----------AVRTVPQYKY-AAGVRNP--QQHLNAQPQVTMQQPAVHVQGQ-------------------------EPLTASMLASAPPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQ 618          

HSP 2 Score: 197.208 bits (500), Expect = 1.850e-52
Identity = 113/297 (38.05%), Postives = 168/297 (56.57%), Query Frame = 2
Query:  392 DPSLRKSGIGNIFIKNLDKSITQKELHDTFVAFGNILSCKIAADERS-KSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVGRFIPRTNRANSDSDVKFTNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDRKAHLASQYMQ 1279
            +PS     + ++++ +L   +T+  L++ F   G ILS ++  D  + +S GY +V+F+  A A  A+D +N  +IK K V     I  + R  S       N +IKN  + +D++ L + F  FG I S KV+ DENG SKG+GFV F+  E AE A++ +NG +  DR+++VGR + + ER            AE  +R  +  N+Y+KN  + +DD RLK  F  FG   S KVMTD + +SKGFGFV F   E+A KAV EMNGK    K +YV  AQ+K +R+  L  ++ Q
Sbjct:    2 NPSAPSYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPV----RIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFVGRFKSRKER-----------EAELGARAKEFTNVYIKNFGEDMDDERLKDLFGKFGPALSVKVMTDESGKSKGFGFVSFERHEDAQKAVDEMNGKELNGKQIYVGRAQKKVERQTELKRKFEQ 282          
BLAST of cytoplasmic poly(A) binding protein vs. TrEMBL
Match: E2FB12 (Cytoplasmic poly(A) binding protein (Fragment) OS=Schmidtea mediterranea OX=79327 GN=PABPC PE=2 SV=1)

HSP 1 Score: 934.095 bits (2413), Expect = 0.000e+0
Identity = 483/483 (100.00%), Postives = 483/483 (100.00%), Query Frame = 2
Query:  737 KLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDRKAHLASQYMQRVNPHRNNYPNQVSVNTXXXXXXXXXXXXXXYAFAPNASTPRVYTQSAAFMPPQNRWSNRMHPSQLQFNGGNMRQLANAHFGNMEGSSVPIQNNTMGMQANQIRQVSMIPNQRPMLXXXXXXXXXXXXXXGVANTVKSAPQNSRPITGVQMPITSQASNISQQRPPNQPTRQITGQSVISGNQNVNRPINNGSNQLVSGNLEPLTISTLASAPIAEQKQMLGERLYPLVHRMYPELAGKITGMLLEIDNTELLHMLESEDSLTTKIEEAMNVLQSHKNQNVIVTDMGQGLPKQQTGSKVAAN 2185
            KLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDRKAHLASQYMQRVNPHRNNYPNQVSVNTLISGGPPGGPSILPYAFAPNASTPRVYTQSAAFMPPQNRWSNRMHPSQLQFNGGNMRQLANAHFGNMEGSSVPIQNNTMGMQANQIRQVSMIPNQRPMLSNNANVSASNVMMNGVANTVKSAPQNSRPITGVQMPITSQASNISQQRPPNQPTRQITGQSVISGNQNVNRPINNGSNQLVSGNLEPLTISTLASAPIAEQKQMLGERLYPLVHRMYPELAGKITGMLLEIDNTELLHMLESEDSLTTKIEEAMNVLQSHKNQNVIVTDMGQGLPKQQTGSKVAAN
Sbjct:    9 KLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDRKAHLASQYMQRVNPHRNNYPNQVSVNTLISGGPPGGPSILPYAFAPNASTPRVYTQSAAFMPPQNRWSNRMHPSQLQFNGGNMRQLANAHFGNMEGSSVPIQNNTMGMQANQIRQVSMIPNQRPMLSNNANVSASNVMMNGVANTVKSAPQNSRPITGVQMPITSQASNISQQRPPNQPTRQITGQSVISGNQNVNRPINNGSNQLVSGNLEPLTISTLASAPIAEQKQMLGERLYPLVHRMYPELAGKITGMLLEIDNTELLHMLESEDSLTTKIEEAMNVLQSHKNQNVIVTDMGQGLPKQQTGSKVAAN 491          

HSP 2 Score: 148.288 bits (373), Expect = 3.737e-34
Identity = 77/205 (37.56%), Postives = 118/205 (57.56%), Query Frame = 2
Query:  464 ELHDTFVAFGNILSCKIAADERSKSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVGRFIPRTNRAN----------SDSDVKFT---NCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSI 1039
            +L + F+ FG I S K+  DE  KSKG+GFV F+    A +A+ A+NG + K+++++VGR   +  R +          ++   ++T   N Y+KN  + +DD +L++ F+ FG ITSAKVM D N +SKGFGFVCF + E A  AV  +NGK+   + LYV  AQ+K +R           +A  +S+Y Q VN +  N  + +
Sbjct:    9 KLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDR-----------KAHLASQYMQRVNPHRNNYPNQV 202          

HSP 3 Score: 85.1149 bits (209), Expect = 2.020e-13
Identity = 52/163 (31.90%), Postives = 81/163 (49.69%), Query Frame = 2
Query:  203 IYEKFSSCGPVLSIRVCRDMITRKSLGYAYVNFQNAADAESALDRMNFDTMKGRSIRIMWSQR-----------------DPSLRKSGIGNIFIKNLDKSITQKELHDTFVAFGNILSCKIAADERSKSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVG 640
            + E F   G + S +V  D    KS G+ +V F+++  AESA+  +N    K R + +  +Q+                 + S R +   N+++KNLD SI    L   FV FGNI S K+  D  ++SKG+GFV F     AT A+  +NG +  +K ++V 
Sbjct:   10 LREMFLEFGEITSAKVMIDE-NGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVA 171          
BLAST of cytoplasmic poly(A) binding protein vs. TrEMBL
Match: A0A267DA93 (Polyadenylate-binding protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig009946g3 PE=3 SV=1)

HSP 1 Score: 711.064 bits (1834), Expect = 0.000e+0
Identity = 389/688 (56.54%), Postives = 447/688 (64.97%), Query Frame = 2
Query:  140 NSIPMASLYVGDLHPEVTEAMIYEKFSSCGPVLSIRVCRDMITRKSLGYAYVNFQNAADAESALDRMNFDTMKGRSIRIMWSQRDPSLRKSGIGNIFIKNLDKSITQKELHDTFVAFGNILSCKIAADERSKSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVGRFIPRTNRANSDSDVKFTNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDRKAHLASQYMQRVNPHR--NNYPNQVSVNTXXXXXXXXXXXXXXYAFAPNASTPRVYTQSAAFM------PPQNRWSNRMHPSQLQFNGGNMRQLANAHFGNMEGSSVP-IQNNTMGMQANQIR-----QVSMIPNQRPMLXXXXXXXXXXXXXXGVANTVKSAPQNSRPITGVQMPITSQASNISQQRPPNQPTRQITGQSVISGNQNVNRPINNGS-----------------NQLVSGNLEPLTISTLASAPIAEQKQMLGERLYPLVHRMYPELAGKITGMLLEIDNTELLHMLESEDSLTTKIEEAMNVLQSHK 2110
            +S PMASLYVGDLHPEVTEAMI+EKFS  GPVLSIRVCRDMITRKSLGYAYVNFQ  ADAE ALD MNFD MKGR IRIMWSQRDPSLRKSG GNIFIKNLDK I  K + DTF AFGNILSCKIA DE   S+GYGFVHFET+ AA  AI+ +NGML+  KKVFVG F+PR  R ++ SD KFTN ++KNFG++L +E    MF EFGEITS++VM+DE GK KGFGFVCFK+ E+AE+AV ALNGK    + LYVGRAQKK ER  ELR  FE+Q+ ER +RY  GVNLYVKNLDD+IDD +LK EF  FGNITSAKVM DS  RSKGFGFVCF  PEEATKAVTEMNGKI  SKPLYVALAQRKEDRKAHLASQYMQR+  +R     P+Q        G            F P    PR +    A M      PP  RW     PS     G  +R    A +G   G  VP +Q    G+ A   R     Q ++ P  RP+ +    + A       + NTV       RP  G  +P   Q       R P  P  QI   +     +NV  P   G                  +  V G  EPLT + LA+AP  EQKQMLGERLYPL+H M+ +LAGKITGMLLEIDN ELLHMLES D+L +K++EA+ VL +H+
Sbjct:   19 SSYPMASLYVGDLHPEVTEAMIFEKFSQAGPVLSIRVCRDMITRKSLGYAYVNFQQPADAERALDTMNFDPMKGRPIRIMWSQRDPSLRKSGQGNIFIKNLDKQIDNKAMFDTFSAFGNILSCKIANDETGNSRGYGFVHFETQEAADQAIEKVNGMLLAGKKVFVGPFVPRKERHSNSSDKKFTNVFVKNFGDELTEESFHTMFSEFGEITSSRVMLDETGKGKGFGFVCFKEPESAEAAVSALNGKEINGKTLYVGRAQKKGERQAELREKFERQKQERMNRYQTGVNLYVKNLDDTIDDEKLKAEFASFGNITSAKVMIDSTGRSKGFGFVCFVAPEEATKAVTEMNGKIVVSKPLYVALAQRKEDRKAHLASQYMQRLASYRMQGQLPSQFMPQAQAPGY-----------FVPTMQQPRNFFNPIAGMNMNIQRPPPQRWGTAGQPS-----GQPIRP---AQYGGPAGPQVPAMQPQPAGLGARPQRPAGVPQATIRPTSRPITNQQGPMPAGRP----MPNTV------GRP--GGVIPPQQQMGVPGGPRKP-APNYQINPMA-----RNVVAPGGYGQQAVAAQMQQQAQGQLSHHDRVPGAQEPLTTAMLAAAPPQEQKQMLGERLYPLIHEMHSQLAGKITGMLLEIDNAELLHMLESHDALKSKVDEAVAVLHAHQ 669          
BLAST of cytoplasmic poly(A) binding protein vs. TrEMBL
Match: A0A1I8I3V7 (Polyadenylate-binding protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig009946g1 PE=3 SV=1)

HSP 1 Score: 711.064 bits (1834), Expect = 0.000e+0
Identity = 389/688 (56.54%), Postives = 447/688 (64.97%), Query Frame = 2
Query:  140 NSIPMASLYVGDLHPEVTEAMIYEKFSSCGPVLSIRVCRDMITRKSLGYAYVNFQNAADAESALDRMNFDTMKGRSIRIMWSQRDPSLRKSGIGNIFIKNLDKSITQKELHDTFVAFGNILSCKIAADERSKSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVGRFIPRTNRANSDSDVKFTNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDRKAHLASQYMQRVNPHR--NNYPNQVSVNTXXXXXXXXXXXXXXYAFAPNASTPRVYTQSAAFM------PPQNRWSNRMHPSQLQFNGGNMRQLANAHFGNMEGSSVP-IQNNTMGMQANQIR-----QVSMIPNQRPMLXXXXXXXXXXXXXXGVANTVKSAPQNSRPITGVQMPITSQASNISQQRPPNQPTRQITGQSVISGNQNVNRPINNGS-----------------NQLVSGNLEPLTISTLASAPIAEQKQMLGERLYPLVHRMYPELAGKITGMLLEIDNTELLHMLESEDSLTTKIEEAMNVLQSHK 2110
            +S PMASLYVGDLHPEVTEAMI+EKFS  GPVLSIRVCRDMITRKSLGYAYVNFQ  ADAE ALD MNFD MKGR IRIMWSQRDPSLRKSG GNIFIKNLDK I  K + DTF AFGNILSCKIA DE   S+GYGFVHFET+ AA  AI+ +NGML+  KKVFVG F+PR  R ++ SD KFTN ++KNFG++L +E    MF EFGEITS++VM+DE GK KGFGFVCFK+ E+AE+AV ALNGK    + LYVGRAQKK ER  ELR  FE+Q+ ER +RY  GVNLYVKNLDD+IDD +LK EF  FGNITSAKVM DS  RSKGFGFVCF  PEEATKAVTEMNGKI  SKPLYVALAQRKEDRKAHLASQYMQR+  +R     P+Q        G            F P    PR +    A M      PP  RW     PS     G  +R    A +G   G  VP +Q    G+ A   R     Q ++ P  RP+ +    + A       + NTV       RP  G  +P   Q       R P  P  QI   +     +NV  P   G                  +  V G  EPLT + LA+AP  EQKQMLGERLYPL+H M+ +LAGKITGMLLEIDN ELLHMLES D+L +K++EA+ VL +H+
Sbjct:   19 SSYPMASLYVGDLHPEVTEAMIFEKFSQAGPVLSIRVCRDMITRKSLGYAYVNFQQPADAERALDTMNFDPMKGRPIRIMWSQRDPSLRKSGQGNIFIKNLDKQIDNKAMFDTFSAFGNILSCKIANDETGNSRGYGFVHFETQEAADQAIEKVNGMLLAGKKVFVGPFVPRKERHSNSSDKKFTNVFVKNFGDELTEESFHTMFSEFGEITSSRVMLDETGKGKGFGFVCFKEPESAEAAVSALNGKEINGKTLYVGRAQKKGERQAELREKFERQKQERMNRYQTGVNLYVKNLDDTIDDEKLKAEFASFGNITSAKVMIDSTGRSKGFGFVCFVAPEEATKAVTEMNGKIVVSKPLYVALAQRKEDRKAHLASQYMQRLASYRMQGQLPSQFMPQAQAPGY-----------FVPTMQQPRNFFNPIAGMNMNIQRPPPQRWGTAGQPS-----GQPIRP---AQYGGPAGPQVPAMQPQPAGLGARPQRPAGVPQATIRPTSRPITNQQGPMPAGRP----MPNTV------GRP--GGVIPPQQQMGVPGGPRKP-APNYQINPMA-----RNVVAPGGYGQQAVAAQMQQQAQGQLSQHDRVPGAQEPLTTAMLAAAPPQEQKQMLGERLYPLIHEMHSQLAGKITGMLLEIDNAELLHMLESHDALKSKVDEAVAVLHAHQ 669          
BLAST of cytoplasmic poly(A) binding protein vs. TrEMBL
Match: A0A267DL86 (Polyadenylate-binding protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig009946g2 PE=3 SV=1)

HSP 1 Score: 709.909 bits (1831), Expect = 0.000e+0
Identity = 387/688 (56.25%), Postives = 447/688 (64.97%), Query Frame = 2
Query:  140 NSIPMASLYVGDLHPEVTEAMIYEKFSSCGPVLSIRVCRDMITRKSLGYAYVNFQNAADAESALDRMNFDTMKGRSIRIMWSQRDPSLRKSGIGNIFIKNLDKSITQKELHDTFVAFGNILSCKIAADERSKSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVGRFIPRTNRANSDSDVKFTNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDRKAHLASQYMQRVNPHR--NNYPNQVSVNTXXXXXXXXXXXXXXYAFAPNASTPRVYTQSAAFM------PPQNRWSNRMHPSQLQFNGGNMRQLANAHFGNMEGSSVP-IQNNTMGMQANQIR-----QVSMIPNQRPMLXXXXXXXXXXXXXXGVANTVKSAPQNSRPITGVQMPITSQASNISQQRPPNQPTRQITGQSVISGNQNVNRPINNGS-----------------NQLVSGNLEPLTISTLASAPIAEQKQMLGERLYPLVHRMYPELAGKITGMLLEIDNTELLHMLESEDSLTTKIEEAMNVLQSHK 2110
            +S PMASLYVGDLHPEVTEAMI+EKFS  GPVLSIRVCRDMITRKSLGYAYVNFQ  ADAE ALD MNFD MKGR IRIMWSQRDPSLRKSG GNIFIKNLDK I  K + DTF AFGNILSCKI+ DE   S+GYGFVHFET+ AA  AI+ +NGML+  KKVFVG F+PR  R ++ SD KFTN ++KNFG++L +E    MF EFGEITS++VM+DE GK KGFGFVCFK+ E+AE+AV ALNGK    + LYVGRAQKK ER  ELR  FE+Q+ ER +RY  GVNLYVKNLDD++DD +LK EF  FGNITSAKVM DS  RSKGFGFVCF  PEEATKAVTEMNGKI  SKPLYVALAQRKEDRKAHLASQYMQR+  +R     P+Q        G            F P    PR +    A M      PP  RW     PS     G  +R    A +G   G  VP +Q    G+ A   R     Q ++ P  RP+ +    + A       + NTV       RP  G  +P   Q       R P  P  QI   +     +NV  P   G                  +  V G  EPLT + LA+AP  EQKQMLGERLYPL+H M+ +LAGKITGMLLEIDN ELLHMLES D+L +K++EA+ VL +H+
Sbjct:   19 SSYPMASLYVGDLHPEVTEAMIFEKFSQAGPVLSIRVCRDMITRKSLGYAYVNFQQPADAERALDTMNFDPMKGRPIRIMWSQRDPSLRKSGQGNIFIKNLDKQIDNKAMFDTFSAFGNILSCKISNDETGNSRGYGFVHFETQEAADQAIEKVNGMLLAGKKVFVGPFVPRKERHSNSSDKKFTNVFVKNFGDELTEESFHTMFSEFGEITSSRVMLDETGKGKGFGFVCFKEPESAEAAVSALNGKEINGKTLYVGRAQKKGERQAELREKFERQKQERMNRYQTGVNLYVKNLDDTVDDEKLKAEFASFGNITSAKVMIDSTGRSKGFGFVCFVAPEEATKAVTEMNGKIVVSKPLYVALAQRKEDRKAHLASQYMQRLASYRMQGQLPSQFMPQAQAPGY-----------FVPTMQQPRNFFNPMAGMNMNIQRPPPQRWGTAGQPS-----GQPIRP---AQYGGPAGPQVPAMQPQPAGLGARPQRPAGVPQATIRPTSRPITNQQGPMPAGRP----MPNTV------GRP--GGVIPPQQQMGVPGGPRKPT-PNYQINPMA-----RNVVAPGGYGQQAVAAQMQQQAQGQLSQHDRVPGAQEPLTTAMLAAAPPQEQKQMLGERLYPLIHEMHSQLAGKITGMLLEIDNAELLHMLESHDALKSKVDEAVAVLHAHQ 669          
BLAST of cytoplasmic poly(A) binding protein vs. TrEMBL
Match: A0A1I8HLB8 (Polyadenylate-binding protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 684.871 bits (1766), Expect = 0.000e+0
Identity = 380/688 (55.23%), Postives = 439/688 (63.81%), Query Frame = 2
Query:  140 NSIPMASLYVGDLHPEVTEAMIYEKFSSCGPVLSIRVCRDMITRKSLGYAYVNFQNAADAESALDRMNFDTMKGRSIRIMWSQRDPSLRKSGIGNIFIKNLDKSITQKELHDTFVAFGNILSCKIAADERSKSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVGRFIPRTNRANSDSDVKFTNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDRKAHLASQYMQRVNPHR--NNYPNQVSVNTXXXXXXXXXXXXXXYAFAPNASTPRVYTQSAAFM------PPQNRWSNRMHPSQLQFNGGNMRQLANAHFGNMEGSSVP-IQNNTMGMQANQIR-----QVSMIPNQRPMLXXXXXXXXXXXXXXGVANTVKSAPQNSRPITGVQMPITSQASNISQQRPPNQPTRQITGQSVISGNQNVNRPINNGS-----------------NQLVSGNLEPLTISTLASAPIAEQKQMLGERLYPLVHRMYPELAGKITGMLLEIDNTELLHMLESEDSLTTKIEEAMNVLQSHK 2110
            +S PMASLYVGDLHPEVTEAMI+EKFS  GPVLSIRVCRDMITRKSLGYAYVNFQ  ADAE ALD MNFD MKGR IRIMWSQRDPSLRKSG GNIFIKNLDK I  K + DTF AFGNILSCKIA DE   S+GYGFVHFET+ AA  AI+ +NGML+  KKVFVG F+PR  R ++ SD KFTN ++KNFG++L +E    MF EFGEITS++VM+DE GK KGFGFVCFK+ E+AE+AV ALNGK    + LYVGRAQKK ER  ELR  FE+Q+ ER +RY  GVNLYVKNLDD+IDD +LK EF  FGNITSAK         +G  FVCF  PEEATKAVTEMNGKI  SKPLYVALAQRKEDRKAHLASQYMQR+  +R     P+Q        G            F P    PR +    A M      PP  RW     PS     G  +R    A +G   G  VP +Q    G+ A   R     Q ++ P  RP+ +    + A       + NTV       RP  G  +P   Q       R P  P  QI   +     +NV  P   G                  +  V G  EPLT + LA+AP  EQKQMLGERLYPL+H M+ +LAGKITGMLLEIDN ELLHMLES D+L +K++EA+ VL +H+
Sbjct:   19 SSYPMASLYVGDLHPEVTEAMIFEKFSQAGPVLSIRVCRDMITRKSLGYAYVNFQQPADAERALDTMNFDPMKGRPIRIMWSQRDPSLRKSGQGNIFIKNLDKQIDNKAMFDTFSAFGNILSCKIANDETGNSRGYGFVHFETQEAADQAIEKVNGMLLAGKKVFVGPFVPRKERHSNSSDKKFTNVFVKNFGDELTEESFHTMFSEFGEITSSRVMLDETGKGKGFGFVCFKEPESAEAAVSALNGKEINGKTLYVGRAQKKGERQAELREKFERQKQERMNRYQTGVNLYVKNLDDTIDDEKLKAEFASFGNITSAK---------QGLRFVCFVAPEEATKAVTEMNGKIVVSKPLYVALAQRKEDRKAHLASQYMQRLASYRMQGQLPSQFMPQAQAPGY-----------FVPTMQQPRNFFNPIAGMNMNIQRPPPQRWGTAGQPS-----GQPIRP---AQYGGPAGPQVPAMQPQPAGLGARPQRPAGVPQATIRPTSRPITNQQGPMPAGRP----MPNTV------GRP--GGVIPPQQQMGVPGGPRKP-APNYQINPMA-----RNVVAPGGYGQQAVAAQMQQQAQGQLSQHDRVPGAQEPLTTAMLAAAPPQEQKQMLGERLYPLIHEMHSQLAGKITGMLLEIDNAELLHMLESHDALKSKVDEAVAVLHAHQ 660          
BLAST of cytoplasmic poly(A) binding protein vs. Ensembl Cavefish
Match: pabpc1b (poly(A) binding protein cytoplasmic 1 [Source:NCBI gene;Acc:103023186])

HSP 1 Score: 639.032 bits (1647), Expect = 0.000e+0
Identity = 366/663 (55.20%), Postives = 436/663 (65.76%), Query Frame = 2
Query:  143 SIPMASLYVGDLHPEVTEAMIYEKFSSCGPVLSIRVCRDMITRKSLGYAYVNFQNAADAESALDRMNFDTMKGRSIRIMWSQRDPSLRKSGIGNIFIKNLDKSITQKELHDTFVAFGNILSCKIAADERSKSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVGRFIPRTNR-ANSDSDVK-FTNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDRKAHLASQYMQRVNPHRNNYPNQVSVNTXXXXXXXXXXXXXXYAFAPNASTPRVY--TQSAAFMPPQNRWSNR-MHPSQLQFNGGNMRQLA--NAHFGNMEGSSVPIQNNTMGMQANQIRQVSMIPNQRPMLXXXXXXXXXXXXXXGVANTVKSAPQNSRPITGVQMPITSQASNISQQRPPNQPTRQITGQSVISGNQNVNRPINNGSNQLVSGNLEPLTISTLASAPIAEQKQMLGERLYPLVHRMYPELAGKITGMLLEIDNTELLHMLESEDSLTTKIEEAMNVLQSHK 2110
            S PMASLYVGDLH +VTEAM+YEKFS  G +LSIRVCRDMITR+SLGYAYVNFQ  ADAE ALD MNFD +KGR +RIMWSQRDPSLRKSG+GNIFIKNLDKSI  K L+DTF AFGNILSCK+  DE   SKGYGFVHFET+ AA  AI+ +NGML+ ++KVFVGRF  R  R A   +  K FTN YIKNFGED+DDEKL+E+F ++G   S +VM D++GKS+GFGFV F+  E A+ AV  +NGK    + +YVGRAQKK ER  EL+  FE+ + +R +RY QGVNLYVKNLDD IDD RL++EF  FG ITSAKVM D   RSKGFGFVCFS+PEEATKAVTEMNG+I  +KPLYVALAQRKE+R+AHL +QYMQR+   R   PN V     ++   P  PS    A  P A     Y  T   A + P  RW+ + + P   Q     MR  A     FG M     P Q   M M A ++   +M P  RP  +  A            A  V+S PQ  +   GV+ P   Q  N   Q    QP   + GQ                         EPLT S LA+AP  EQKQMLGERL+PL+  M+P LAGKITGMLLEIDN+ELLHMLES +SL +K++EA+ VLQ+H+
Sbjct:    7 SYPMASLYVGDLHQDVTEAMLYEKFSPAGAILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGRPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFVGRFKSRKEREAELGARAKEFTNVYIKNFGEDMDDEKLKEVFSKYGNSMSIRVMTDDSGKSRGFGFVSFERHEDAQKAVDEMNGKELNGKLIYVGRAQKKVERQTELKRKFEQMKQDRMTRY-QGVNLYVKNLDDGIDDERLRKEFSPFGTITSAKVMMD-GGRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEERQAHLTNQYMQRMASVR-AVPNPV-----LNPYQPAPPSGYFMAAIPQAQNRAAYYPTSQLAQLRPSPRWATQGVRPQHFQNMPATMRPSAPRPQTFGAMRP---PSQVPRM-MSAQRVAAQTMGP--RPATAAAAA----------AAAPVRSVPQ-YKYAAGVRNP--QQHMNTQPQVSMQQPAVHVQGQ-------------------------EPLTASMLAAAPPQEQKQMLGERLFPLIQNMHPTLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQ 616          

HSP 2 Score: 195.282 bits (495), Expect = 1.003e-52
Identity = 109/297 (36.70%), Postives = 171/297 (57.58%), Query Frame = 2
Query:  392 DPSLRKSGIGNIFIKNLDKSITQKELHDTFVAFGNILSCKIAADERS-KSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVGRFIPRTNRANSDSDVKFTNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDRKAHLASQYMQ 1279
            +PS     + ++++ +L + +T+  L++ F   G ILS ++  D  + +S GY +V+F+  A A  A+D +N  +IK + V     I  + R  S       N +IKN  + +D++ L + F  FG I S KV+ DENG SKG+GFV F+  E AE A++ +NG +  DR+++VGR + + ER            AE  +R  +  N+Y+KN  + +DD +LK+ F  +GN  S +VMTD + +S+GFGFV F   E+A KAV EMNGK    K +YV  AQ+K +R+  L  ++ Q
Sbjct:    2 NPSAPSYPMASLYVGDLHQDVTEAMLYEKFSPAGAILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGRPV----RIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFVGRFKSRKER-----------EAELGARAKEFTNVYIKNFGEDMDDEKLKEVFSKYGNSMSIRVMTDDSGKSRGFGFVSFERHEDAQKAVDEMNGKELNGKLIYVGRAQKKVERQTELKRKFEQ 282          
BLAST of cytoplasmic poly(A) binding protein vs. Ensembl Cavefish
Match: ENSAMXT00000035946.1 (polyadenylate-binding protein 1-like [Source:NCBI gene;Acc:103030422])

HSP 1 Score: 638.262 bits (1645), Expect = 0.000e+0
Identity = 359/665 (53.98%), Postives = 436/665 (65.56%), Query Frame = 2
Query:  143 SIPMASLYVGDLHPEVTEAMIYEKFSSCGPVLSIRVCRDMITRKSLGYAYVNFQNAADAESALDRMNFDTMKGRSIRIMWSQRDPSLRKSGIGNIFIKNLDKSITQKELHDTFVAFGNILSCKIAADERSKSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVGRFIPRTNR-ANSDSDVK-FTNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDRKAHLASQYMQRVNPHRNNYPNQVSVNTXXXXXXXXXXXXXXYAFAPNASTPRVYTQSA--AFMPPQNRWSNRMHPSQLQFNGGNMRQLANAHFGNM-----EGSSVPIQNNTMGMQANQIRQVSMIPNQRPMLXXXXXXXXXXXXXXGVANTVKSAPQNSRPITGVQMPITSQASNISQQRPPNQPTRQITGQSVISGNQNVNRPINNGSNQLVSGNLEPLTISTLASAPIAEQKQMLGERLYPLVHRMYPELAGKITGMLLEIDNTELLHMLESEDSLTTKIEEAMNVLQSHK 2110
            S PMASLYVGDLH +VTEAM+YEKFS  GP+LSIRVCRDM+TR+SLGYAYVNFQ  ADAE ALD MNFD +KGR +RIMWSQRDPSLRKSG+GNIFIKNLDKSI  K L+DTF AFGNILSCK+  DE   SKGYGFVHFET  AA  AI+ +NGML+ ++KVFVGRF  R  R A   +  K FTN YIKNFGED+DDEKL+++F ++G   S +VM DE+GKSKGFGFV F+  E A+ AV  +NGK    +Q+YVGRAQKK ER  EL+  FE+ + +R +RY QGVNLYVKNLDD +DD RL++EF  FG ITSAKVM +   RSKGFGFVCFS+PEEATKAVTEMNG+I  +KPLYVALAQRKE+R+AHL +QYMQR+   R   PN V     ++   P  PS    A  P A     Y  S+  A + P  RW+               + +   HF NM       +  P   +T+   A+Q+ +  M+ +QR M S       +          V++ PQ      GV+ P   Q      Q P  QP   + GQ                         EPLT S LA+AP  EQKQMLGERL+PL+  M+P LAGKITGMLLEIDN+ELLHMLES +SL +K++EA+ VLQ+H+
Sbjct:    7 SYPMASLYVGDLHQDVTEAMLYEKFSPAGPILSIRVCRDMMTRRSLGYAYVNFQQPADAERALDTMNFDVIKGRPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYGFVHFETHEAAERAIEKMNGMLLNDRKVFVGRFKSRKEREAEMGARAKEFTNVYIKNFGEDMDDEKLKDVFGKYGPALSIRVMTDESGKSKGFGFVSFERHEDAQRAVDEMNGKELNGKQVYVGRAQKKGERQTELKRKFEQMKQDRMTRY-QGVNLYVKNLDDGLDDERLRKEFSPFGTITSAKVMME-GGRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEERQAHLTNQYMQRMASVR-AVPNPV-----LNPYQPAPPSGYFMAAIPQAQNRAAYYPSSQLAQLRPSPRWAT--------------QSVRPQHFQNMPNAIRPAAPRPQTFSTIRPTASQLPR--MMTSQR-MASQPMGPRPTGAGAATGTAPVRAVPQYKY-GPGVRNP--QQHLGAQPQVPMQQPAVHVQGQ-------------------------EPLTASMLAAAPPQEQKQMLGERLFPLIQNMHPTLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQ 617          

HSP 2 Score: 192.971 bits (489), Expect = 6.770e-52
Identity = 108/297 (36.36%), Postives = 169/297 (56.90%), Query Frame = 2
Query:  392 DPSLRKSGIGNIFIKNLDKSITQKELHDTFVAFGNILSCKIAADERS-KSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVGRFIPRTNRANSDSDVKFTNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDRKAHLASQYMQ 1279
            +PS     + ++++ +L + +T+  L++ F   G ILS ++  D  + +S GY +V+F+  A A  A+D +N  +IK + V     I  + R  S       N +IKN  + +D++ L + F  FG I S KV+ DENG SKG+GFV F+  E AE A++ +NG +  DR+++VGR + + ER            AE  +R  +  N+Y+KN  + +DD +LK  F  +G   S +VMTD + +SKGFGFV F   E+A +AV EMNGK    K +YV  AQ+K +R+  L  ++ Q
Sbjct:    2 NPSAPSYPMASLYVGDLHQDVTEAMLYEKFSPAGPILSIRVCRDMMTRRSLGYAYVNFQQPADAERALDTMNFDVIKGRPV----RIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYGFVHFETHEAAERAIEKMNGMLLNDRKVFVGRFKSRKER-----------EAEMGARAKEFTNVYIKNFGEDMDDEKLKDVFGKYGPALSIRVMTDESGKSKGFGFVSFERHEDAQRAVDEMNGKELNGKQVYVGRAQKKGERQTELKRKFEQ 282          
BLAST of cytoplasmic poly(A) binding protein vs. Ensembl Cavefish
Match: pabpc4 (poly(A) binding protein, cytoplasmic 4 (inducible form) [Source:ZFIN;Acc:ZDB-GENE-030131-9663])

HSP 1 Score: 585.489 bits (1508), Expect = 0.000e+0
Identity = 343/682 (50.29%), Postives = 411/682 (60.26%), Query Frame = 2
Query:  122 VNNQINNSIPMASLYVGDLHPEVTEAMIYEKFSSCGPVLSIRVCRDMITRKSLGYAYVNFQNAADAESALDRMNFDTMKGRSIRIMWSQRDPSLRKSGIGNIFIKNLDKSITQKELHDTFVAFGNILSCKIAADERSKSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVGRFIPRTNR-ANSDSDVK-FTNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDRKAHLASQYMQRVNPHRNNYPNQVSVNTXXXXXXXXXXXXXXYAFAPNASTPRVYTQSAAFMPPQNRWSNR---MHPSQLQFNGGNMRQLANAHFGNMEGSSVPIQNNTMGMQANQIRQVSMIPNQRPMLXXXXXXXXXXXXXXGVANTVKSAPQNSRPITGVQMPITSQASNISQQRPPNQPTRQITGQSVISGNQNVNRPINNGSNQLVSGNLEPLTISTLASAPIAEQKQMLGERLYPLVHRMYPELAGKITGMLLEIDNTELLHMLESEDSLTTKIEEAMNVLQSHKNQNVIVTDMGQGLP 2152
            +N     S PMASLYVGDLHP++TEAM+YEKFS  GPVLSIRVCRDMITR+SLGYAYVNFQ  ADAE ALD MNFD +KG+ IRIMWSQRDPSLRKSG+GN+FIKNLDKSI  K L+DTF AFGNILSCK+  DE   SKGY FVHFET+ AA  AI+ +NGML+ ++KVFVGRF  R  R A   +  K FTN YIKNFGED+DDEKL+E+F ++G+  S KVM D  GKS+GFGFV ++  E A + VK   G   K                  L+S   K          +GVNLY+KNLDD+IDD +L++EF  FG+ITSAKVM +   RSKGFGFVCFS+PEEATKAVTEMNG+I GSKPLYVALAQRKE+RKAHL +QYMQR+   R                          A   NA   +    S  FMP   +  NR     P+QL     N R       G      +P      G +AN IR +       P  +             G        P   RP  GV  P         +  PP +        +V +    V +PI   +   V G  EPLT S LA+AP  EQKQMLGERL+PL+  M+P LAGKITGMLLEIDN+ELLHMLES +SL +K+EEA+ VLQ+H+ +      +G   P
Sbjct:    1 MNAAAAGSYPMASLYVGDLHPDITEAMLYEKFSPAGPVLSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVVKGKPIRIMWSQRDPSLRKSGVGNVFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYAFVHFETQDAADRAIEKMNGMLLNDRKVFVGRFKSRKEREAELGAKAKEFTNVYIKNFGEDMDDEKLKEIFDKYGKTLSVKVMTDPTGKSRGFGFVSYEKHEDA-NKVKKREGNPVKSL----------------LQSEIVK----------KGVNLYIKNLDDTIDDEKLRKEFSPFGSITSAKVMLE-EGRSKGFGFVCFSSPEEATKAVTEMNGRIVGSKPLYVALAQRKEERKAHLTNQYMQRIAGMR--------------------------AMPANAIINQFQPTSGYFMPAVPQAQNRTTYYAPNQLAQMRPNPRWQQQGGRGQGGFQGMPNSLRQPGPRAN-IRHLG------PSATAQGPRGIPGAQRVGGTGQ----PMGPRPALGVTTP---------RAMPPYK-----YATAVRNTQPQVVQPIAQPAVH-VQGQ-EPLTASMLAAAPPQEQKQMLGERLFPLIQAMHPSLAGKITGMLLEIDNSELLHMLESHESLRSKVEEAVAVLQAHQAKKDATQKVGVSAP 600          
BLAST of cytoplasmic poly(A) binding protein vs. Ensembl Cavefish
Match: ENSAMXT00000018970.2 (polyadenylate-binding protein 1-like [Source:NCBI gene;Acc:103030422])

HSP 1 Score: 545.043 bits (1403), Expect = 0.000e+0
Identity = 267/397 (67.25%), Postives = 312/397 (78.59%), Query Frame = 2
Query:  143 SIPMASLYVGDLHPEVTEAMIYEKFSSCGPVLSIRVCRDMITRKSLGYAYVNFQNAADAESALDRMNFDTMKGRSIRIMWSQRDPSLRKSGIGNIFIKNLDKSITQKELHDTFVAFGNILSCKIAADERSKSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVGRFIPRTNR-ANSDSDVK-FTNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDRKAHLASQYMQRV-------NPHRNNY 1306
            S PMASLYVGDLH +VTEAM+YEKFS  GP+LSIRVCRDM+TR+SLGYAYVNFQ  ADAE ALD MNFD +KGR +RIMWSQRDPSLRKSG+GNIFIKNLDKSI  K L+DTF AFGNILSCK+  DE   SKGYGFVHFET  AA  AI+ +NGML+ ++KVFVGRF  R  R A   +  K FTN YIKNFGED+DDEKL+++F ++G   S +VM DE+GKSKGFGFV F+  E A+ AV  +NGK    +Q+YVGRAQKK ER  EL+  FE+ + +R +RY QGVNLYVKNLDD +DD RL++EF  FG ITSAKVM +   RSKGFGFVCFS+PEEATKAVTEMNG+I  +KPLYVALAQRKE+R+AHL +QYMQR+       NP  N Y
Sbjct:    7 SYPMASLYVGDLHQDVTEAMLYEKFSPAGPILSIRVCRDMMTRRSLGYAYVNFQQPADAERALDTMNFDVIKGRPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYGFVHFETHEAAERAIEKMNGMLLNDRKVFVGRFKSRKEREAEMGARAKEFTNVYIKNFGEDMDDEKLKDVFGKYGPALSIRVMTDESGKSKGFGFVSFERHEDAQRAVDEMNGKELNGKQVYVGRAQKKGERQTELKRKFEQMKQDRMTRY-QGVNLYVKNLDDGLDDERLRKEFSPFGTITSAKVMME-GGRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEERQAHLTNQYMQRMASVRAVPNPVLNPY 400          

HSP 2 Score: 190.66 bits (483), Expect = 1.704e-51
Identity = 108/297 (36.36%), Postives = 169/297 (56.90%), Query Frame = 2
Query:  392 DPSLRKSGIGNIFIKNLDKSITQKELHDTFVAFGNILSCKIAADERS-KSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVGRFIPRTNRANSDSDVKFTNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDRKAHLASQYMQ 1279
            +PS     + ++++ +L + +T+  L++ F   G ILS ++  D  + +S GY +V+F+  A A  A+D +N  +IK + V     I  + R  S       N +IKN  + +D++ L + F  FG I S KV+ DENG SKG+GFV F+  E AE A++ +NG +  DR+++VGR + + ER            AE  +R  +  N+Y+KN  + +DD +LK  F  +G   S +VMTD + +SKGFGFV F   E+A +AV EMNGK    K +YV  AQ+K +R+  L  ++ Q
Sbjct:    2 NPSAPSYPMASLYVGDLHQDVTEAMLYEKFSPAGPILSIRVCRDMMTRRSLGYAYVNFQQPADAERALDTMNFDVIKGRPV----RIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYGFVHFETHEAAERAIEKMNGMLLNDRKVFVGRFKSRKER-----------EAEMGARAKEFTNVYIKNFGEDMDDEKLKDVFGKYGPALSIRVMTDESGKSKGFGFVSFERHEDAQRAVDEMNGKELNGKQVYVGRAQKKGERQTELKRKFEQ 282          

HSP 3 Score: 117.087 bits (292), Expect = 6.774e-27
Identity = 54/76 (71.05%), Postives = 66/76 (86.84%), Query Frame = 2
Query: 1883 EPLTISTLASAPIAEQKQMLGERLYPLVHRMYPELAGKITGMLLEIDNTELLHMLESEDSLTTKIEEAMNVLQSHK 2110
            EPLT S LA+AP  EQKQMLGERL+PL+  M+P LAGKITGMLLEIDN+ELLHMLES +SL +K++EA+ VLQ+H+
Sbjct:  496 EPLTASMLAAAPPQEQKQMLGERLFPLIQNMHPTLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQ 571          
BLAST of cytoplasmic poly(A) binding protein vs. Ensembl Cavefish
Match: pabpc4 (poly(A) binding protein, cytoplasmic 4 (inducible form) [Source:ZFIN;Acc:ZDB-GENE-030131-9663])

HSP 1 Score: 534.643 bits (1376), Expect = 0.000e+0
Identity = 319/695 (45.90%), Postives = 386/695 (55.54%), Query Frame = 2
Query:  122 VNNQINNSIPMASLYVGDLHPEVTEAMIYEKFSSCGPVLSIRVCRDMITRKSLGYAYVNFQNAADAESALDRMNFDTMKGRSIRIMWSQRDPSLRKSGIGNIFIKNLDKSITQKELHDTFVAFGNILSCKIAADERSKSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVGRFIPRTNR-ANSDSDVK-FTNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDRKAHLASQYMQRVNPHRNNYPNQVSVNTXXXXXXXXXXXXXXYAFAPNASTPRVYTQSAAFMPPQNRWSNR---MHPSQLQFNGGNMRQLANAHFGNMEGSSVPIQNNTMGMQANQIRQVSMIPNQRPMLXXXXXXXXXXXXXXGVANTVKSAPQNSRPITGV----QMPITSQASNISQQRP---------PNQPTRQITGQSVISGNQNVNRPINNGSNQLVSGNLEPLTISTLASAPIAEQKQMLGERLYPLVHRMYPELAGKITGMLLEIDNTELLHMLESEDSLTTKIEEAMNVLQSHKNQNVIVTDMGQGLP 2152
            +N     S PMASLYVGDLHP++TEAM+YEKFS  GPVLSIRVCRDMITR+SLGYAYVNFQ  ADAE ALD MNFD +KG+ IRIMWSQRDPSLRKSG+GN+FIKNLDKSI  K L+DTF AFGNILSCK+  DE   SKGY FVHFET+ AA  AI+ +NGML+ ++KVFVGRF  R  R A   +  K FTN YIKNFGED+DDEKL+E+F ++G+  S KVM D  GKS+GFGFV ++  E A                                                +GVNLY+KNLDD+IDD +L++EF  FG+ITSAKVM +   RSKGFGFVCFS+PEEATKAVTEMNG+I GSKPLYVALAQRKE+RKAHL +QYMQR+   R                          A   NA   +    S  FMP   +  NR     P+QL     N R       G      +P      G +AN IR +       P  +             G        P   RP  GV     MP    A+ +   +P           QP   + GQ  ++ +     P      Q++   L PL                        +  M+P LAGKITGMLLEIDN+ELLHMLES +SL +K+EEA+ VLQ+H+ +      +G   P
Sbjct:    1 MNAAAAGSYPMASLYVGDLHPDITEAMLYEKFSPAGPVLSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVVKGKPIRIMWSQRDPSLRKSGVGNVFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYAFVHFETQDAADRAIEKMNGMLLNDRKVFVGRFKSRKEREAELGAKAKEFTNVYIKNFGEDMDDEKLKEIFDKYGKTLSVKVMTDPTGKSRGFGFVSYEKHEDA-----------------------------------------------NKGVNLYIKNLDDTIDDEKLRKEFSPFGSITSAKVMLE-EGRSKGFGFVCFSSPEEATKAVTEMNGRIVGSKPLYVALAQRKEERKAHLTNQYMQRIAGMR--------------------------AMPANAIINQFQPTSGYFMPAVPQAQNRTTYYAPNQLAQMRPNPRWQQQGGRGQGGFQGMPNSLRQPGPRAN-IRHLG------PSATAQGPRGIPGAQRVGGTGQ----PMGPRPALGVTTPRAMPPYKYATAVRNTQPQVVQPIALQQAQPAVHVQGQEPLTASMLAAAPPQE-QKQMLGERLFPL------------------------IQAMHPSLAGKITGMLLEIDNSELLHMLESHESLRSKVEEAVAVLQAHQAKKDATQKVGVSAP 584          
BLAST of cytoplasmic poly(A) binding protein vs. Ensembl Sea Lamprey
Match: pabpc4 (poly(A) binding protein, cytoplasmic 4 (inducible form) [Source:ZFIN;Acc:ZDB-GENE-030131-9663])

HSP 1 Score: 536.954 bits (1382), Expect = 0.000e+0
Identity = 274/448 (61.16%), Postives = 326/448 (72.77%), Query Frame = 2
Query:  143 SIPMASLYVGDLHPEVTEAMIYEKFSSCGPVLSIRVCRDMITRKSLGYAYVNFQNAADAESALDRMNFDTMKGRSIRIMWSQRDPSLRKSGIGNIFIKNLDKSITQKELHDTFVAFGNILSCKIAADERSKSKGYGFVHFETEAAATNAIDAINGMLIKN---KKVFVGRFIPRTNRAN--SDSDVKFTNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDRKAHLASQYMQRVNPHRNNYPNQVSVNTXXXXXXXXXXXXXXYAFAPNASTPRVYTQSAAFMP-------PQNRW 1450
            S PMASLYVGDLHP+VTEAM+YEKFS  GPVLSIRVCRDMITR+SLGYAYVNFQ  ADAE ALD MNFD +KG+ IRIMWSQRDPSLRKSG+GN+FIKNLDKSI  K ++DTF AFGNILSCK+  DE + S+GYGFVHFET+ AA  AI+ +NGML+ +   ++ FVGRF  R  R         +FTN YIKNFG+D+D++KLRE F +FG+  S  VM DE GKS+GFGFV F+  E A+ AV  +NGK    R ++VGRAQKK ER  EL+  FE  + ER SRY QGVNLYVKNLDD+IDD +L++EF  +G ITS KVM++   RSKGFGFVCFS+PEEATKAVTEMNG+I GSKPLYVALAQRKE+RKAHL SQYMQR+   R   P+ V      +             F P  + P+  T++A + P       PQ RW
Sbjct:    7 SYPMASLYVGDLHPDVTEAMLYEKFSPAGPVLSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPIRIMWSQRDPSLRKSGVGNVFIKNLDKSIDNKAMYDTFSAFGNILSCKVVCDE-NGSRGYGFVHFETQEAADRAIEKMNGMLLNDRLARRRFVGRFKSRKEREQEMGARAKEFTNVYIKNFGDDMDEDKLREFFGKFGKALSVCVMSDECGKSRGFGFVSFEQHEDAQRAVNEMNGKELNGRTVFVGRAQKKGERQAELKRKFEMLKQERISRY-QGVNLYVKNLDDNIDDEQLRKEFAPYGTITSTKVMSE-EGRSKGFGFVCFSSPEEATKAVTEMNGRIVGSKPLYVALAQRKEERKAHLTSQYMQRIAGMRALPPSTVIGQYQPAAPSGY--------FMP--AMPQAQTRTAYYAPNQMTQIRPQQRW 441          
BLAST of cytoplasmic poly(A) binding protein vs. Ensembl Sea Lamprey
Match: pabpc4 (poly(A) binding protein, cytoplasmic 4 (inducible form) [Source:ZFIN;Acc:ZDB-GENE-030131-9663])

HSP 1 Score: 408.683 bits (1049), Expect = 6.499e-135
Identity = 253/539 (46.94%), Postives = 310/539 (57.51%), Query Frame = 2
Query:  548 GFVHFETEAAATNAIDAINGMLIKNKKVFVGRFIPRTNR-ANSDSDVK-FTNCYIKNFGEDLDDEKLREMFLEF-GEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDRKAHLASQYMQRVNPHRNNYPNQVSVNTXXXXXXXXXXXXXXYAFAPNASTPRV--YTQSA-AFMPPQNRWSNRMHPSQLQFNGGNMRQLANAHFGNMEGSSVPIQNNTMGMQANQIRQVSMIPNQRPMLXXXXXXXXXXXXXXGVANTVKSAPQNSRPITGVQMPITSQASNISQQRP--PNQPT--RQITGQSVISGNQNVNRPINNGSNQL---------VSGNLEPLTISTLASAPIAEQKQMLGERLYPLVHRMYPELAGKITGMLLEIDNTELLHMLESEDSLTTKIEEAMNVLQSH 2107
            GFVHFET+ AA  AI+ +NGML+ ++KVFVGRF  R  R A   +  + FTN YIKNFG+D+DDE+LRE F ++ G+  S KVM+DE GKSKGFGFV F+  E A+ AV  +N K    R +YVGRAQKK ER  EL+  FE  + ER S+Y QGVNLYVKNLDD+I+D RL +EF  FG ITSAKVM +   RS+GFGFVCFS+PEEATKAVTEMNG+I GSKPLYVALAQRKE+RK HL SQ+MQR+   R   P+ +     I    P   S    A  P  +  R   YT S  A M P  RW  ++ P               AH    +  + P            +RQ +  P Q                               R +    +P   +AS     RP  P Q    R + G       +N  +P   G   +         + G  EPLT S LA+AP  EQKQMLGERL+PL+H MYP LAGKITGMLLEIDN+ELLHMLES +SL  K+EEA+ VLQ+H
Sbjct:    1 GFVHFETQEAADKAIEKMNGMLLNDRKVFVGRFKSRKEREAEFGAKAREFTNVYIKNFGDDMDDERLREYFEQYVGKTLSVKVMMDEGGKSKGFGFVSFERHEDAQKAVDEMNTKELNGRAIYVGRAQKKAERQTELKRKFEMLKQERMSKY-QGVNLYVKNLDDNINDERLWKEFSPFGTITSAKVMME-EGRSRGFGFVCFSSPEEATKAVTEMNGRIIGSKPLYVALAQRKEERKMHLTSQFMQRLAGMRAVPPSAI-----IGQYQPAAASGYFMAAMPQQAQGRTAYYTPSPMAPMRPNPRWPLQVRPQ-------------GAHAAGFQAITGP------------MRQPAPRPTQ------------------------------MRTVNPASVPQVPRASQGMMPRPTFPTQAAGPRALPGYKYTGSVRNPQQPGVQGPGAMQQAPQSAVHIQGQ-EPLTASMLAAAPPHEQKQMLGERLFPLIHGMYPTLAGKITGMLLEIDNSELLHMLESPESLRAKVEEAVAVLQAH 476          

HSP 2 Score: 141.739 bits (356), Expect = 4.834e-36
Identity = 85/248 (34.27%), Postives = 133/248 (53.63%), Query Frame = 2
Query:  287 AYVNFQNAADAESALDRMNFDTMKGRSIRI--MWSQRDPSLRKSGIG-------NIFIKNLDKSITQKELHDTFVAF-GNILSCKIAADERSKSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVGRFIPRTNRANSDSDVKF-------------TNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHF 961
             +V+F+    A+ A+++MN   +  R + +    S+++   R++  G       N++IKN    +  + L + F  + G  LS K+  DE  KSKG+GFV FE    A  A+D +N   +  + ++VGR   +  R  ++   KF              N Y+KN  ++++DE+L + F  FG ITSAKVM++E G+S+GFGFVCF   E A  AV  +NG++   + LYV  AQ+K ER   L S F
Sbjct:    1 GFVHFETQEAADKAIEKMNGMLLNDRKVFVGRFKSRKE---REAEFGAKAREFTNVYIKNFGDDMDDERLREYFEQYVGKTLSVKVMMDEGGKSKGFGFVSFERHEDAQKAVDEMNTKELNGRAIYVGRAQKKAER-QTELKRKFEMLKQERMSKYQGVNLYVKNLDDNINDERLWKEFSPFGTITSAKVMMEE-GRSRGFGFVCFSSPEEATKAVTEMNGRIIGSKPLYVALAQRKEERKMHLTSQF 243          

HSP 3 Score: 85.8853 bits (211), Expect = 8.322e-18
Identity = 54/177 (30.51%), Postives = 93/177 (52.54%), Query Frame = 2
Query:  161 LYVGDLHPEVTEAMIYEKFSS-CGPVLSIRVCRDMITRKSLGYAYVNFQNAADAESALDRMNFDTMKGRSIRIMWSQ----RDPSLRKS-------------GIGNIFIKNLDKSITQKELHDTFVAFGNILSCKIAADERSKSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFV 637
            +Y+ +   ++ +  + E F    G  LS++V  D    KS G+ +V+F+   DA+ A+D MN   + GR+I +  +Q    R   L++              G+ N+++KNLD +I  + L   F  FG I S K+  +E  +S+G+GFV F +   AT A+  +NG +I +K ++V
Sbjct:   53 VYIKNFGDDMDDERLREYFEQYVGKTLSVKVMMDE-GGKSKGFGFVSFERHEDAQKAVDEMNTKELNGRAIYVGRAQKKAERQTELKRKFEMLKQERMSKYQGV-NLYVKNLDDNINDERLWKEFSPFGTITSAKVMMEE-GRSRGFGFVCFSSPEEATKAVTEMNGRIIGSKPLYV 226          
BLAST of cytoplasmic poly(A) binding protein vs. Ensembl Sea Lamprey
Match: sf3b4 (splicing factor 3b, subunit 4 [Source:ZFIN;Acc:ZDB-GENE-020419-22])

HSP 1 Score: 110.923 bits (276), Expect = 3.226e-26
Identity = 65/164 (39.63%), Postives = 98/164 (59.76%), Query Frame = 2
Query:  155 ASLYVGDLHPEVTEAMIYEKFSSCGPVLSIRVCRDMITRKSLGYAYVNFQNAADAESALDRMNFDTMKGRSIRI-MWSQRDPSLRKSGIGNIFIKNLDKSITQKELHDTFVAFGNIL-SCKIAAD-ERSKSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFV 637
            A++YVG L  +V+EA+++E F   GPV++  + +D IT++  GY +V F    DA+ A+  MN   + G+ IR+   S  + +L      NIFI NLD  I +K L+DTF AFG IL + K   D E   SKGY F++F +  A+  AI+A+NG  + N+ + V
Sbjct:   13 ATVYVGGLDDKVSEALLWELFLQAGPVVNTHMPKDRITQQHQGYGFVEFLGEEDADYAIKIMNMIKLYGKPIRVNKASAHNKNLDVG--ANIFIGNLDTEIDEKLLYDTFSAFGVILQTPKTMRDPETGNSKGYAFINFASFEASDAAIEAMNGQYLCNRPISV 174          

HSP 2 Score: 83.9593 bits (206), Expect = 2.302e-17
Identity = 56/192 (29.17%), Postives = 100/192 (52.08%), Query Frame = 2
Query:  425 IFIKNLDKSITQKELHDTFVAFGNILSCKIAADERSK-SKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVGRFIPRTNRA---NSDSDVKFTNCYIKNFGEDLDDEKLREMFLEFGEIT-SAKVMID-ENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAER 982
            +++  LD  +++  L + F+  G +++  +  D  ++  +GYGFV F  E  A  AI  +N + +  K +       R N+A   N + DV   N +I N   ++D++ L + F  FG I  + K M D E G SKG+ F+ F   E +++A++A+NG+   +R + V  A KK+ + +   S  E+  A +
Sbjct:   15 VYVGGLDDKVSEALLWELFLQAGPVVNTHMPKDRITQQHQGYGFVEFLGEEDADYAIKIMNMIKLYGKPI-------RVNKASAHNKNLDVG-ANIFIGNLDTEIDEKLLYDTFSAFGVILQTPKTMRDPETGNSKGYAFINFASFEASDAAIEAMNGQYLCNRPISVSYAFKKDSKGERHGSAAERLLAAQ 198          

HSP 3 Score: 80.8777 bits (198), Expect = 2.445e-16
Identity = 55/206 (26.70%), Postives = 95/206 (46.12%), Query Frame = 2
Query:  692 TNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDE-NGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNIT-SAKVMTDS-NNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKE---DRKAHLASQYMQRVNP 1291
               Y+    + + +  L E+FL+ G + +  +  D    + +G+GFV F   E A+ A+K +N      + + V +A   N+ LD                   G N+++ NLD  ID+  L   F  FG I  + K M D     SKG+ F+ F++ E +  A+  MNG+   ++P+ V+ A +K+   +R    A + +   NP
Sbjct:   13 ATVYVGGLDDKVSEALLWELFLQAGPVVNTHMPKDRITQQHQGYGFVEFLGEEDADYAIKIMNMIKLYGKPIRVNKASAHNKNLD------------------VGANIFIGNLDTEIDEKLLYDTFSAFGVILQTPKTMRDPETGNSKGYAFINFASFEASDAAIEAMNGQYLCNRPISVSYAFKKDSKGERHGSAAERLLAAQNP 200          

HSP 4 Score: 50.8322 bits (120), Expect = 7.874e-7
Identity = 24/78 (30.77%), Postives = 49/78 (62.82%), Query Frame = 2
Query:  155 ASLYVGDLHPEVTEAMIYEKFSSCGPVL-SIRVCRDMITRKSLGYAYVNFQNAADAESALDRMNFDTMKGRSIRIMWS 385
            A++++G+L  E+ E ++Y+ FS+ G +L + +  RD  T  S GYA++NF +   +++A++ MN   +  R I + ++
Sbjct:  100 ANIFIGNLDTEIDEKLLYDTFSAFGVILQTPKTMRDPETGNSKGYAFINFASFEASDAAIEAMNGQYLCNRPISVSYA 177          
BLAST of cytoplasmic poly(A) binding protein vs. Ensembl Sea Lamprey
Match: tia1l (cytotoxic granule-associated RNA binding protein 1, like [Source:ZFIN;Acc:ZDB-GENE-030131-2167])

HSP 1 Score: 94.7449 bits (234), Expect = 7.367e-22
Identity = 56/183 (30.60%), Postives = 92/183 (50.27%), Query Frame = 2
Query:  161 LYVGDLHPEVTEAMIYEKFSSCGPVLSIRVCRDMITRKSLGYAYVNFQNAADAESALDRMNFDTMKGRSIRIMWSQRDPS------------------LRKSGIGN--IFIKNLDKSITQKELHDTFVAFGNILSCKIAADERSKSKGYGFVHFETEAAATNAIDAINGMLIK--NKKVFVGR 643
            ++VGDL PE++   +   F+  G +   RV +D+ T KS GY +V+F    DAE+A+ +M    + GR IR  W+ R P                   L +S   N  ++   + + +T++ +  TF+ FG IL  ++  D     KGY F+ F T  +A +AI ++NG  I+  + K F G+
Sbjct:    5 VFVGDLSPEISTDDLRAAFAPFGKISDARVVKDLATGKSKGYGFVSFFQKLDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKGSQDTDPKHLSFEEVLNQSSPTNCTVYCGGITQGLTEQLMRQTFLLFGQILEIRVFPD-----KGYSFIRFATHESAAHAIVSVNGSTIEGFSVKCFWGK 182          

HSP 2 Score: 77.7962 bits (190), Expect = 4.083e-16
Identity = 47/173 (27.17%), Postives = 84/173 (48.55%), Query Frame = 2
Query:  695 NCYIKNFGEDLDDEKLREMFLEFGEITSAKVMID-ENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKK------NERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNG 1192
            + ++ +   ++  + LR  F  FG+I+ A+V+ D   GKSKG+GFV F     AE+A++ + G+    RQ+    A +K      ++  D     FE+   + S        +Y   +   + +  ++Q F++FG I   +V  D     KG+ F+ F+  E A  A+  +NG
Sbjct:    4 HVFVGDLSPEISTDDLRAAFAPFGKISDARVVKDLATGKSKGYGFVSFFQKLDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKGSQDTDPKHLSFEEVLNQSSPT---NCTVYCGGITQGLTEQLMRQTFLLFGQILEIRVFPD-----KGYSFIRFATHESAAHAIVSVNG 168          

HSP 3 Score: 77.0258 bits (188), Expect = 6.351e-16
Identity = 51/200 (25.50%), Postives = 93/200 (46.50%), Query Frame = 2
Query:  422 NIFIKNLDKSITQKELHDTFVAFGNILSCKIAAD-ERSKSKGYGFVHFETEAAATNAIDAINGMLIKNKKV---FVGRFIPRTNRANSDSDVKF------------TNC--YIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEK 967
            ++F+ +L   I+  +L   F  FG I   ++  D    KSKGYGFV F  +  A NAI  + G  +  +++   +  R  P   + + D+D K             TNC  Y     + L ++ +R+ FL FG+I   +V  D     KG+ F+ F   E+A  A+ ++NG   +   +     ++ ++ +++ +  F +
Sbjct:    4 HVFVGDLSPEISTDDLRAAFAPFGKISDARVVKDLATGKSKGYGFVSFFQKLDAENAIQQMGGQWLGGRQIRTNWATR-KPPAPKGSQDTDPKHLSFEEVLNQSSPTNCTVYCGGITQGLTEQLMRQTFLLFGQILEIRVFPD-----KGYSFIRFATHESAAHAIVSVNGSTIEGFSVKCFWGKEASDPVNQFQQQFSQ 197          

HSP 4 Score: 51.6026 bits (122), Expect = 2.559e-7
Identity = 26/79 (32.91%), Postives = 43/79 (54.43%), Query Frame = 2
Query: 1007 NLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTD-SNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRK 1240
            +++V +L   I    L+  F  FG I+ A+V+ D +  +SKG+GFV F    +A  A+ +M G+  G + +    A RK
Sbjct:    4 HVFVGDLSPEISTDDLRAAFAPFGKISDARVVKDLATGKSKGYGFVSFFQKLDAENAIQQMGGQWLGGRQIRTNWATRK 82          
BLAST of cytoplasmic poly(A) binding protein vs. Ensembl Sea Lamprey
Match: RBMS2 (RNA binding motif single stranded interacting protein 2 [Source:HGNC Symbol;Acc:HGNC:9909])

HSP 1 Score: 95.5153 bits (236), Expect = 5.291e-21
Identity = 62/222 (27.93%), Postives = 105/222 (47.30%), Query Frame = 2
Query:  422 NIFIKNLDKSITQKELHDTFVAFGNILSCKIAADERS-KSKGYGFVHFETEAAATNAIDAI--NGMLIKNKKVFVGRFIPRTNRANSDSDVKFTNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSI----DDTRLKQEF 1066
            N++I+ L    T ++L      +G I+S K   D+ + + KGYGFVHF++ AAA  A+ A+  NG+  +  K                 +   TN YI N    +D+++L  M   FG++ S +++ D NG S+G GF   + +E  E+ ++  NGK     Q+  G        L +     +K+R +  S+YTQ    + +  +  I    D T ++  F
Sbjct:   59 NLYIRGLPPGTTDQDLTKLCQPYGKIVSTKAILDKNTNQCKGYGFVHFDSPAAAQKAVTALKANGVQAQMAK---------------QQEQDPTNLYISNLPLSMDEQELEGMLKPFGQVISTRILRDANGTSRGVGFARMESTEKCEAVIQHFNGKFI---QIPPGVPAPSEPLLCKFADGGQKKR-QSQSKYTQNGRAWPREGETGIAVTYDPTAIQNGF 261          

HSP 2 Score: 80.1073 bits (196), Expect = 4.441e-16
Identity = 47/175 (26.86%), Postives = 80/175 (45.71%), Query Frame = 2
Query:  692 TNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDEN-GKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKP 1213
            TN YI+       D+ L ++   +G+I S K ++D+N  + KG+GFV F     A+ AV AL                    + + +++   KQ+ +  +      NLY+ NL  S+D+  L+     FG + S +++ D+N  S+G GF    + E+    +   NGK     P
Sbjct:   58 TNLYIRGLPPGTTDQDLTKLCQPYGKIVSTKAILDKNTNQCKGYGFVHFDSPAAAQKAVTAL--------------------KANGVQAQMAKQQEQDPT------NLYISNLPLSMDEQELEGMLKPFGQVISTRILRDANGTSRGVGFARMESTEKCEAVIQHFNGKFIQIPP 206          
BLAST of cytoplasmic poly(A) binding protein vs. Ensembl Yeast
Match: PAB1 (Poly(A) binding protein; part of the 3'-end RNA-processing complex, mediates interactions between the 5' cap structure and the 3' mRNA poly(A) tail, involved in control of poly(A) tail length, interacts with translation factor eIF-4G; stimulates, but is not required for the deadenylation activity of the Pan2p-Pan3p poly(A)-ribonuclease complex [Source:SGD;Acc:S000000967])

HSP 1 Score: 434.491 bits (1116), Expect = 9.046e-144
Identity = 212/378 (56.08%), Postives = 267/378 (70.63%), Query Frame = 2
Query:  155 ASLYVGDLHPEVTEAMIYEKFSSCGPVLSIRVCRDMITRKSLGYAYVNFQNAADAESALDRMNFDTMKGRSIRIMWSQRDPSLRKSGIGNIFIKNLDKSITQKELHDTFVAFGNILSCKIAADERSKSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVGRFIPRTNRANSDSDVK--FTNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDRKAHLASQYMQR 1282
            ASLYVGDL P V+EA +Y+ FS  G V SIRVCRD IT+ SLGYAYVNF +      A++++N+  +KGR  RIMWSQRDPSLRK G GNIFIKNL   I  K L+DTF  FG+ILS KIA DE  KSKG+GFVHFE E AA  AIDA+NGML+  ++++V   + R  R +   + K  +TN Y+KN   +  DE+ +E+F +FG I SA +  D +GK KGFGFV ++  E A  AV+ALN       +LYVGRAQKKNER+  L+  +E  R E+ ++Y QGVNL+VKNLDDS+DD +L++EF  +G ITSAKVM   N +SKGFGFVCFS PEEATKA+TE N +I   KPLYVA+AQRK+ R++ LA Q   R
Sbjct:   38 ASLYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQLNYTPIKGRLCRIMWSQRDPSLRKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLYVKNINSETTDEQFQELFAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKY-QGVNLFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQAR 414          
BLAST of cytoplasmic poly(A) binding protein vs. Ensembl Yeast
Match: PES4 (Poly(A) binding protein, suppressor of DNA polymerase epsilon mutation; PES4 has a paralog, MIP6, that arose from the whole genome duplication [Source:SGD;Acc:S000001919])

HSP 1 Score: 137.502 bits (345), Expect = 3.190e-34
Identity = 128/431 (29.70%), Postives = 196/431 (45.48%), Query Frame = 2
Query:  152 MASLYVGDLHPEVTEAMIYEKFSSCGPVLSIRVCRDMITRKSLGYAYVNFQNAADAESALDRMNFDTMKGRSIRIMWSQRDPSLRKSGIGNIFIKNL---DKSITQKELHDTFVAFGNILSCKIAADERSKSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVG-------RFIP--RTNRANSDS------------------DVKFTNCY--------IKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKG-FGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLK----QEFVVFGNITSAKVMTD--SNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDRKAHLASQYMQRVNPHRNNYP 1309
            +  L++GDLH  VTE  +   F      +S +VC D +T+KSLG+ Y+NF++  +AE A++ +N+  + G+ IRIM S R+ + RK+   N+F  NL   +  +T +  +DTF  +G ILSCK+  D R   K  GFV+FE E  A N I   N      KK+  G       R +P   T ++  D+                  D +  N Y        IKN       + +   F E G I S  + +    K K  + FV +K+S  +E A+K  N   F+ ++L V RAQ K ER   + S              +   L+++NL    +   LK    QE     NI   K+  D    N S   GF+ F N E+AT+    +N ++ G   +  +  ++    K H    Y  R N H +++P
Sbjct:   90 LVPLFIGDLHETVTEETLKGIFKKYPSFVSAKVCLDSVTKKSLGHGYLNFEDKEEAEKAMEELNYTKVNGKEIRIMPSLRNTTFRKNFGTNVFFSNLPLNNPLLTTRVFYDTFSRYGKILSCKL--DSR---KDIGFVYFEDEKTARNVIKMYNNTSFFGKKILCGIHFDKEVRSVPNFETQKSRLDAETIIEKEQSLNEKHSKGNDKESKNIYSSSQNSIFIKNLPTITTRDDILNFFSEVGPIKS--IYLSNATKVKYLWAFVTYKNSSDSEKAIKRYNNFYFRGKKLLVTRAQDKEERAKFIESQ-------------KISTLFLENLSAVCNKEFLKYLCHQE-----NIRPFKIQIDGYDENSSTYSGFIKFRNFEDATRIFNFLNNRLVGGSIVTTSWERQNNAPKYH--DGYGMR-NIHTSSHP 492          
BLAST of cytoplasmic poly(A) binding protein vs. Ensembl Yeast
Match: MIP6 (Putative RNA-binding protein; interacts with Mex67p, which is a component of the nuclear pore involved in nuclear mRNA export; MIP6 has a paralog, PES4, that arose from the whole genome duplication [Source:SGD;Acc:S000001057])

HSP 1 Score: 124.02 bits (310), Expect = 9.384e-30
Identity = 86/299 (28.76%), Postives = 137/299 (45.82%), Query Frame = 2
Query:  119 AVNNQINNSIPMASLYVGDLHPEVTEAMIYEKFSSCGPVLSIRVCRDMITRKSLGYAYVNFQNAADAESALDRMNFDTMKGRSIRIMWSQRDPSLRKSGIGNIFIKNL---DKSITQKELHDTFVAFGNILSCKIAADERSKSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVG-----------RFIPRTNRANSD--------------SDVKFTNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDE-NGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKK 928
            +V   I  +    SL++G+L   VTE M+ + F       S +VCRD +T+KSLGY Y+NF++  DAESA    N+    G+ ++IM S ++   RK+   N+F  NL   +  +T +  +   + +GN+LSC +      + K  GFV+F+ + +A N I   N       K+  G            F  R     SD               + +     +KN   D   E++ + F   G I S  V I E    +    FV +K+ E ++ A K LN  +FK+  ++VG  + K
Sbjct:   99 SVQKYITKTSKTNSLFIGNLKSTVTEEMLRKIFKRYQSFESAKVCRDFLTKKSLGYGYLNFKDKNDAESARKEFNYTVFFGQEVKIMPSMKNTLFRKNIGTNVFFSNLPLENPQLTTRSFYLIMIEYGNVLSCLL-----ERRKNIGFVYFDNDISARNVIKKYNNQEFFGNKIICGLHFDKEVRTRPEFTKRKKMIGSDIVIEDELLASNNLSDNARSKTILVKNLPSDTTQEEVLDYFSTIGPIKS--VFISEKQANTPHKAFVTYKNEEESKKAQKCLNKTIFKNHTIWVGPGKDK 390          

HSP 2 Score: 50.447 bits (119), Expect = 1.048e-6
Identity = 52/198 (26.26%), Postives = 84/198 (42.42%), Query Frame = 2
Query:  635 VGRFIPRTNRANSDSDVKFTNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMID-ENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGK-------ICG 1204
            V ++I +T++ NS         +I N    + +E LR++F  +    SAKV  D    KS G+G++ FKD   AESA K  N  +F  +++ +  + K         + F K           G N++  NL   +++ +L         I    V++    R K  GFV F N   A   + + N +       ICG
Sbjct:  100 VQKYITKTSKTNS--------LFIGNLKSTVTEEMLRKIFKRYQSFESAKVCRDFLTKKSLGYGYLNFKDKNDAESARKEFNYTVFFGQEVKIMPSMK--------NTLFRK---------NIGTNVFFSNL--PLENPQLTTRSFYLIMIEYGNVLSCLLERRKNIGFVYFDNDISARNVIKKYNNQEFFGNKIICG 270          
BLAST of cytoplasmic poly(A) binding protein vs. Ensembl Yeast
Match: PUB1 (Poly (A)+ RNA-binding protein; abundant mRNP-component protein that binds mRNA and is required for stability of many mRNAs; component of glucose deprivation induced stress granules, involved in P-body-dependent granule assembly; implicated in regulation of translation; carries Q/N-rich domain at C- terminus, identified as candidate prion; human homolog Tia1 is critical for normal synaptic plasticity; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004961])

HSP 1 Score: 88.1965 bits (217), Expect = 7.809e-19
Identity = 54/170 (31.76%), Postives = 87/170 (51.18%), Query Frame = 2
Query:  425 IFIKNLDKSITQKELHDTFVAFGNILSCKIAADERSKSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVGRFIPRTNRANSDSDVKFTNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMID-ENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKN 931
            +++ NLDK+IT+  L   F   G I + KI  D+ +K+  Y FV +     A  A+  +NG  I+N  V +           S SD  F N ++ +   ++DDE LR  F +F    S  VM D + G S+G+GFV F   + A++A+ ++ G+    R L +  A K++
Sbjct:   77 LYVGNLDKAITEDILKQYFQVGGPIANIKIMIDKNNKNVNYAFVEYHQSHDANIALQTLNGKQIENNIVKINWAF---QSQQSSSDDTF-NLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQNAMDSMQGQDLNGRPLRINWAAKRD 242          

HSP 2 Score: 83.9593 bits (206), Expect = 2.006e-17
Identity = 50/183 (27.32%), Postives = 93/183 (50.82%), Query Frame = 2
Query:  698 CYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTD-SNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKE 1243
             Y+ N  + + ++ L++ F   G I + K+MID+N K+  + FV +  S  A  A++ LNGK  ++  + +  A             F+ Q++     +    NL+V +L+ ++DD  L+  F  F +  S  VM D     S+G+GFV F++ ++A  A+  M G+    +PL +  A +++
Sbjct:   77 LYVGNLDKAITEDILKQYFQVGGPIANIKIMIDKNNKNVNYAFVEYHQSHDANIALQTLNGKQIENNIVKINWA-------------FQSQQSSSDDTF----NLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQNAMDSMQGQDLNGRPLRINWAAKRD 242          

HSP 3 Score: 82.0333 bits (201), Expect = 8.099e-17
Identity = 44/150 (29.33%), Postives = 82/150 (54.67%), Query Frame = 2
Query:  161 LYVGDLHPEVTEAMIYEKFSSCGPVLSIRVCRDMITRKSLGYAYVNFQNAADAESALDRMNFDTMKGRSIRIMWSQRDPSLRKSGIGNIFIKNLDKSITQKELHDTFVAFGNILSCKIAAD-ERSKSKGYGFVHFETEAAATNAIDAING 607
            LYVG+L   +TE ++ + F   GP+ +I++  D    K++ YA+V +  + DA  AL  +N   ++   ++I W+ +          N+F+ +L+ ++  + L + F  F + LS  +  D +   S+GYGFV F ++  A NA+D++ G
Sbjct:   77 LYVGNLDKAITEDILKQYFQVGGPIANIKIMIDK-NNKNVNYAFVEYHQSHDANIALQTLNGKQIENNIVKINWAFQSQQSSSDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQNAMDSMQG 225          

HSP 4 Score: 56.225 bits (134), Expect = 1.208e-8
Identity = 28/77 (36.36%), Postives = 42/77 (54.55%), Query Frame = 2
Query:  161 LYVGDLHPEVTEAMIYEKFSSCGPVLSIRVCRDMITRKSLGYAYVNFQNAADAESALDRMNFDTMKGRSIRIMWSQR 391
            L+VGDL+  V +  +   F      LS  V  DM T  S GY +V+F +  DA++A+D M    + GR +RI W+ +
Sbjct:  164 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQNAMDSMQGQDLNGRPLRINWAAK 240          

HSP 5 Score: 51.6026 bits (122), Expect = 3.347e-7
Identity = 28/69 (40.58%), Postives = 39/69 (56.52%), Query Frame = 2
Query:  989 RYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGK 1195
            R T    LYV NLD +I +  LKQ F V G I + K+M D NN++  + FV +    +A  A+  +NGK
Sbjct:   70 RETSDRVLYVGNLDKAITEDILKQYFQVGGPIANIKIMIDKNNKNVNYAFVEYHQSHDANIALQTLNGK 138          
BLAST of cytoplasmic poly(A) binding protein vs. Ensembl Yeast
Match: GBP2 (Poly(A+) RNA-binding protein; key surveillance factor for the selective export of spliced mRNAs from the nucleus to the cytoplasm; preference for intron-containing genes; similar to Npl3p; also binds single-stranded telomeric repeat sequence in vitro; relocalizes to the cytosol in response to hypoxia; GBP2 has a paralog, HRB1, that arose from the whole genome duplication [Source:SGD;Acc:S000000517])

HSP 1 Score: 85.5001 bits (210), Expect = 5.024e-18
Identity = 77/307 (25.08%), Postives = 131/307 (42.67%), Query Frame = 2
Query:  425 IFIKNLDKSITQKELHDTFVAFGNILSCKIAADERSKSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFV----------GRFIPRTNRANSDSDVKFTNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYV--GRAQKK--NERLDELRSHFEKQRA--------------ERSSRYTQGVN--------LYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQR 1237
            IF++NL    T ++L + F   G ++   I    +   +G G V F    +  +AI   +G L  ++K+ V            F  +  R   D+  +    +I N    ++ + L++MF E G +  A V +D NG S+GFG V +   +    A+   NG   + R L V  GR  K+  N+R ++ R   E  R               E ++++T+GVN        +Y  NL  S   + L   F   G I +A++    N +  G   V + N  +A   + ++N    G   L ++ A+R
Sbjct:  124 IFVRNLTFDCTPEDLKELFGTVGEVVEADIIT-SKGHHRGMGTVEFTKNESVQDAISKFDGALFMDRKLMVRQDNPPPEAAKEFSKKATREEIDNGFE---VFIINLPYSMNWQSLKDMFKECGHVLRADVELDFNGFSRGFGSVIYPTEDEMIRAIDTFNGMEVEGRVLEVREGRFNKRKNNDRYNQRREDLEDTRGTEPGLAQDAAVHIDETAAKFTEGVNPGGDRNCFIYCSNLPFSTARSDLFDLFGPIGKINNAELKPQENGQPTGVAVVEYENLVDADFCIQKLNNYNYGGCSLQISYARR 426          

HSP 2 Score: 58.5362 bits (140), Expect = 2.134e-9
Identity = 76/310 (24.52%), Postives = 124/310 (40.00%), Query Frame = 2
Query:  158 SLYVGDLHPEVTEAMIYEKFSSCGPVLSIRVCRDMITRKS--LGYAYVNFQNAADAESALDRMNFDTMKGRSIRIMWSQRDP----------SLRKSGIGN---IFIKNLDKSITQKELHDTFVAFGNILSCKIAADERSKSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFV--GRFIPRTN--RAN------------------------SDSDVKFT---------NCYI--KNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQK 925
            S++V +L  + T   + E F + G V+      D+IT K    G   V F      + A+ +  FD       ++M  Q +P             +  I N   +FI NL  S+  + L D F   G++L   +  D    S+G+G V + TE     AID  NGM ++ + + V  GRF  R N  R N                         ++  KFT         NC+I   N         L ++F   G+I +A++   ENG+  G   V +++   A+  ++ LN   +    L +  A++
Sbjct:  123 SIFVRNLTFDCTPEDLKELFGTVGEVVEA----DIITSKGHHRGMGTVEFTKNESVQDAISK--FDGALFMDRKLMVRQDNPPPEAAKEFSKKATREEIDNGFEVFIINLPYSMNWQSLKDMFKECGHVLRADVELDFNGFSRGFGSVIYPTEDEMIRAIDTFNGMEVEGRVLEVREGRFNKRKNNDRYNQRREDLEDTRGTEPGLAQDAAVHIDETAAKFTEGVNPGGDRNCFIYCSNLPFSTARSDLFDLFGPIGKINNAELKPQENGQPTGVAVVEYENLVDADFCIQKLNNYNYGGCSLQISYARR 426          
BLAST of cytoplasmic poly(A) binding protein vs. Ensembl Nematostella
Match: EDO33206 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSV8])

HSP 1 Score: 525.013 bits (1351), Expect = 2.194e-178
Identity = 250/382 (65.45%), Postives = 299/382 (78.27%), Query Frame = 2
Query:  149 PMASLYVGDLHPEVTEAMIYEKFSSCGPVLSIRVCRDMITRKSLGYAYVNFQNAADAESALDRMNFDTMKGRSIRIMWSQRDPSLRKSGIGNIFIKNLDKSITQKELHDTFVAFGNILSCKIAADERSKSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVGRFIPRTNRAN--SDSDVKFTNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDRKAHLASQYMQRVN 1288
            P+ASLYVGDL P+VTEAM+YEKFS+ G VLSIRVCRD++TR+SLGYAYVNFQ    AE ALD MNFD +KGR  RIMW QRDPSLRKSG+GNIFIKNLDKSI  K L+DTF AFGNILSCKIA DE    KGYGFVHFETE AA  AI  ++GML+ +KKVFVGR++ +  R         KFTN Y+KNFG+D+DDE+++E+  E G+I S KVM D  GKSKGFGFV F+  E AE AV  LNGK    R+L+ GRA+K+ ER  E+++  EK+R ER +R+ QGVNLY+KNLDD IDD RL++EF  +G I+SAKVM D    SKGFGFVCFS+PEEATKAVTEMNG+I  SKPLYVALAQR+E+RKA LA+Q+M R++
Sbjct:   11 PIASLYVGDLAPDVTEAMLYEKFSTAGSVLSIRVCRDLVTRRSLGYAYVNFQQPGHAEKALDTMNFDPIKGRPCRIMWQQRDPSLRKSGVGNIFIKNLDKSIDNKSLYDTFSAFGNILSCKIAQDELGNPKGYGFVHFETEDAALEAIARVDGMLLNDKKVFVGRWMSKKERIEKMGTQPKKFTNVYVKNFGDDMDDEQMKEICAEAGKIVSLKVMTDPEGKSKGFGFVSFETPEEAEEAVNVLNGKEIGGRRLWAGRAKKRAERAAEVKAEIEKKRQERINRF-QGVNLYIKNLDDPIDDERLREEFSPYGTISSAKVMKDDKGNSKGFGFVCFSSPEEATKAVTEMNGRILISKPLYVALAQRREERKAQLAAQHMHRIS 391          

HSP 2 Score: 248.44 bits (633), Expect = 1.142e-72
Identity = 184/594 (30.98%), Postives = 286/594 (48.15%), Query Frame = 2
Query:  416 IGNIFIKNLDKSITQKELHDTFVAFGNILSCKIAADERSK-SKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVGRFIPRTNRANSDSDVKFTNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDR----KAHLASQYMQR------VNPHRNNYPNQV------------SVNTXXXXXXXXXXXXXXYAFAPNASTPRVYTQSAAFMPPQNRWSNRMHPSQLQFNGGNMRQLANAHFGNMEGSSVPIQNNTMGMQANQIRQVSMIPNQRPMLXXXXXXXXXXXXXXGVANTVKSA--PQNSRPITGVQMPITSQASNISQQRPPNQPTRQITGQSVISGNQNVNRPINNG----SNQLVSGNLEPLTISTLASAPIAEQKQMLGERLYPLVHRMYPELAGKITGMLLEIDNTELLHMLESEDSLTTKIEEAMNVLQSHK 2110
            I ++++ +L   +T+  L++ F   G++LS ++  D  ++ S GY +V+F+    A  A+D +N   IK +       I    R  S       N +IKN  + +D++ L + F  FG I S K+  DE G  KG+GFV F+  + A  A+  ++G +  D++++VGR   K ER++++ +  +K        +T   N+YVKN  D +DD ++K+     G I S KVMTD   +SKGFGFV F  PEEA +AV  +NGK  G + L+   A+++ +R    KA +  +  +R      VN +  N  + +               +          +   + F    S+P   T++   M  +   S  ++ +  Q       QLA  H   + G  +         Q  +      +P  RP            +   GV N    A  PQ   P    +MP+  Q + +    P  QP +          +Q V  P   G      Q + G  EPL  S LA+A   EQKQMLGERL+PL+   +P++AGKITGMLLEIDN ELLHMLES D+L  K++EA++VL++H+
Sbjct:   12 IASLYVGDLAPDVTEAMLYEKFSTAGSVLSIRVCRDLVTRRSLGYAYVNFQQPGHAEKALDTMNFDPIKGRPCR----IMWQQRDPSLRKSGVGNIFIKNLDKSIDNKSLYDTFSAFGNILSCKIAQDELGNPKGYGFVHFETEDAALEAIARVDGMLLNDKKVFVGRWMSKKERIEKMGTQPKK--------FT---NVYVKNFGDDMDDEQMKEICAEAGKIVSLKVMTDPEGKSKGFGFVSFETPEEAEEAVNVLNGKEIGGRRLWAGRAKKRAERAAEVKAEIEKKRQERINRFQGVNLYIKNLDDPIDDERLREEFSPYGTISSAKVMKDDKGNSKGFGFV-CFSSPEEATKAVTEMNGRILISKPLYVALAQRREERKAQLAAQHMHRISGLRM--------HQGQRPFFTPQMPQVRPRWGMPPQQQQQQMRPTGVQNMGGQAGMPQGG-PAGMPRMPV--QQARMGGVPPQRQPYKF---------SQTVRNPPPAGQMPEGGQGIPGGQEPLNPSVLAAATPQEQKQMLGERLFPLIQTNHPDMAGKITGMLLEIDNAELLHMLESRDALQMKVDEAVSVLRAHQ 569          

HSP 3 Score: 82.4185 bits (202), Expect = 2.836e-16
Identity = 56/217 (25.81%), Postives = 97/217 (44.70%), Query Frame = 2
Query:  659 NRANSDSDVKFTNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMID-ENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDRKAHLASQYMQRVNPHRNNY 1306
            N +   ++    + Y+ +   D+ +  L E F   G + S +V  D    +S G+ +V F+    AE A+  +N    K R   +   Q+                 + S R +   N+++KNLD SID+  L   F  FGNI S K+  D     KG+GFV F   + A +A+  ++G +   K ++V     K++R   + +Q  +  N +  N+
Sbjct:    2 NPSTGAANYPIASLYVGDLAPDVTEAMLYEKFSTAGSVLSIRVCRDLVTRRSLGYAYVNFQQPGHAEKALDTMNFDPIKGRPCRIMWQQR-----------------DPSLRKSGVGNIFIKNLDKSIDNKSLYDTFSAFGNILSCKIAQDELGNPKGYGFVHFETEDAALEAIARVDGMLLNDKKVFVGRWMSKKERIEKMGTQPKKFTNVYVKNF 201          
BLAST of cytoplasmic poly(A) binding protein vs. Ensembl Nematostella
Match: EDO42417 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1S3])

HSP 1 Score: 109.768 bits (273), Expect = 9.896e-26
Identity = 62/164 (37.80%), Postives = 100/164 (60.98%), Query Frame = 2
Query:  155 ASLYVGDLHPEVTEAMIYEKFSSCGPVLSIRVCRDMITRKSLGYAYVNFQNAADAESALDRMNFDTMKGRSIRIMWSQRDPSLRKSGIG-NIFIKNLDKSITQKELHDTFVAFGNIL-SCKIAAD-ERSKSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFV 637
            A++YVG L  +V+EA+I+E F   GPV+++ + +D IT+   GY +V F    DA+ A+  MN   + G+ IR+  ++     +   +G N+FI NLD  + +K L+DTF AFG IL + KI  D +   SKG+ F++F +  A+  AI+A+NG  + N+ + V
Sbjct:   13 ATIYVGGLDEKVSEALIWELFLQSGPVVNVHMPKDRITQLHQGYGFVEFLGEEDADYAIKVMNMIKVYGKPIRV--NKASAHNKNLDVGANLFIGNLDTEVDEKLLYDTFSAFGVILQTPKIMRDSDTGNSKGFAFINFASFDASDAAIEAMNGQYLCNRPITV 174          

HSP 2 Score: 84.7297 bits (208), Expect = 1.898e-17
Identity = 57/204 (27.94%), Postives = 98/204 (48.04%), Query Frame = 2
Query:  698 CYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGK-SKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNIT-SAKVMTDSNN-RSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKE---DRKAHLASQYMQRVNP 1291
             Y+    E + +  + E+FL+ G + +  +  D   +  +G+GFV F   E A+ A+K +N      + + V +A   N+ LD                   G NL++ NLD  +D+  L   F  FG I  + K+M DS+   SKGF F+ F++ + +  A+  MNG+   ++P+ V+ A +KE   +R    A + +   NP
Sbjct:   15 IYVGGLDEKVSEALIWELFLQSGPVVNVHMPKDRITQLHQGYGFVEFLGEEDADYAIKVMNMIKVYGKPIRVNKASAHNKNLDV------------------GANLFIGNLDTEVDEKLLYDTFSAFGVILQTPKIMRDSDTGNSKGFAFINFASFDASDAAIEAMNGQYLCNRPITVSYAFKKESKGERHGSAAERLLAAQNP 200          

HSP 3 Score: 82.0333 bits (201), Expect = 1.360e-16
Identity = 55/192 (28.65%), Postives = 101/192 (52.60%), Query Frame = 2
Query:  425 IFIKNLDKSITQKELHDTFVAFGNILSCKIAADERSK-SKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVGRFIPRTNRA---NSDSDVKFTNCYIKNFGEDLDDEKLREMFLEFGEIT-SAKVMID-ENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAER 982
            I++  LD+ +++  + + F+  G +++  +  D  ++  +GYGFV F  E  A  AI  +N + +  K +       R N+A   N + DV   N +I N   ++D++ L + F  FG I  + K+M D + G SKGF F+ F   + +++A++A+NG+   +R + V  A KK  + +   S  E+  A +
Sbjct:   15 IYVGGLDEKVSEALIWELFLQSGPVVNVHMPKDRITQLHQGYGFVEFLGEEDADYAIKVMNMIKVYGKPI-------RVNKASAHNKNLDVG-ANLFIGNLDTEVDEKLLYDTFSAFGVILQTPKIMRDSDTGNSKGFAFINFASFDASDAAIEAMNGQYLCNRPITVSYAFKKESKGERHGSAAERLLAAQ 198          

HSP 4 Score: 52.373 bits (124), Expect = 4.433e-7
Identity = 25/78 (32.05%), Postives = 50/78 (64.10%), Query Frame = 2
Query:  155 ASLYVGDLHPEVTEAMIYEKFSSCGPVL-SIRVCRDMITRKSLGYAYVNFQNAADAESALDRMNFDTMKGRSIRIMWS 385
            A+L++G+L  EV E ++Y+ FS+ G +L + ++ RD  T  S G+A++NF +   +++A++ MN   +  R I + ++
Sbjct:  100 ANLFIGNLDTEVDEKLLYDTFSAFGVILQTPKIMRDSDTGNSKGFAFINFASFDASDAAIEAMNGQYLCNRPITVSYA 177          
BLAST of cytoplasmic poly(A) binding protein vs. Ensembl Nematostella
Match: EDO29565 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T3A0])

HSP 1 Score: 97.0561 bits (240), Expect = 6.009e-24
Identity = 58/119 (48.74%), Postives = 75/119 (63.03%), Query Frame = 2
Query:  149 PMASLYVGDLHPEVTEAMIYEKFSSCGPVLSIRVCRDMITRKSLGYAYVNFQNAADAESALDRMNFDTMKGRSIRIMWSQRDPSLRKSGIGNIFIKNLDKSITQKELHDTFVAFGNILS 505
            P+ASLYVGDL P+VTEAM+YEKFS+ G VLSIRVCRD++TR+SLGYA    +    AE A + +  +  K R  RI         R  G+ N++IKNLD  I  + L + F  +G I S
Sbjct:   11 PIASLYVGDLAPDVTEAMLYEKFSTAGSVLSIRVCRDLVTRRSLGYALWAGRAKKRAERAAE-VKAEIEKKRQERIN--------RFQGV-NLYIKNLDDPIDDERLREEFSPYGTISS 119          

HSP 2 Score: 74.7146 bits (182), Expect = 3.820e-16
Identity = 35/63 (55.56%), Postives = 49/63 (77.78%), Query Frame = 2
Query:  902 LYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITS 1090
            L+ GRA+K+ ER  E+++  EK+R ER +R+ QGVNLY+KNLDD IDD RL++EF  +G I+S
Sbjct:   58 LWAGRAKKRAERAAEVKAEIEKKRQERINRF-QGVNLYIKNLDDPIDDERLREEFSPYGTISS 119          
BLAST of cytoplasmic poly(A) binding protein vs. Ensembl Nematostella
Match: EDO32492 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUY1])

HSP 1 Score: 93.2041 bits (230), Expect = 2.505e-21
Identity = 67/248 (27.02%), Postives = 117/248 (47.18%), Query Frame = 2
Query:  164 YVGDLHPEVTEAMIYEKFSSCGPVLSIRVCRDMITRKSLGYAYVNFQNAADAESALDRMNFDTMKGRSIRIMWSQRDPSLRKSGIGN---IFIKNLDKSITQKELHDTFVAFGNILSCKIAAD-ERSKSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVGRFIPRTN---RANSDSDVKF-------------------TNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFV 829
            YVG+L P+ T+ +I   F+    V+  ++   +  +    Y +V F+  ADA+ A  RM+  T+  + +++ W+   P +++    N   IF+ +L +++    L  TF  FG I   ++  D  ++KSKG+GFV F     A  AI  ++ + I  K+V       +TN   R N+ +  K+                   T  Y+ N   D+ D +L++MF ++G I   KV  D     KG+ F+
Sbjct:    1 YVGNLDPKCTQELICSIFNKIAKVVRCKMINSVSYKGP--YCFVEFETHADAQEAKFRMDQRTVMDKKLKVNWATNHPGMKRGDTNNHFHIFVGDLAENVDNALLRKTFEPFGEISEVRVVKDPAKNKSKGFGFVSFVRREDAAKAIAEMDSVTIGGKQV-------KTNWAARKNNPTQSKYVCVKNLLWDDVFHQSSQLNTTVYVGNLPPDVKDYELQQMFSQYGSILETKVFAD-----KGYAFI 234          

HSP 2 Score: 66.2402 bits (160), Expect = 3.894e-12
Identity = 42/151 (27.81%), Postives = 69/151 (45.70%), Query Frame = 2
Query:  161 LYVGDLHPEVTEAMIYEKFSSCGPVLSIRVCRDMITRKSLGYAYVNFQNAADAESALDRMNFDTMKGRSIRIMWSQR-----------------DPSLRKSGIGN--IFIKNLDKSITQKELHDTFVAFGNILSCKIAADERSKSKGYGFV 556
            ++VGDL   V  A++ + F   G +  +RV +D    KS G+ +V+F    DA  A+  M+  T+ G+ ++  W+ R                 D    +S   N  +++ NL   +   EL   F  +G+IL  K+ AD     KGY F+
Sbjct:   89 IFVGDLAENVDNALLRKTFEPFGEISEVRVVKDPAKNKSKGFGFVSFVRREDAAKAIAEMDSVTIGGKQVKTNWAARKNNPTQSKYVCVKNLLWDDVFHQSSQLNTTVYVGNLPPDVKDYELQQMFSQYGSILETKVFAD-----KGYAFI 234          

HSP 3 Score: 64.3142 bits (155), Expect = 1.679e-11
Identity = 48/181 (26.52%), Postives = 88/181 (48.62%), Query Frame = 2
Query:  701 YIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTD-SNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRK 1240
            Y+ N       E +  +F +  ++   K MI+       + FV F+    A+ A   ++ +   D++L V  A           +H   +R + ++ +    +++V +L +++D+  L++ F  FG I+  +V+ D + N+SKGFGFV F   E+A KA+ EM+    G K +    A RK
Sbjct:    1 YVGNLDPKCTQELICSIFNKIAKVVRCK-MINSVSYKGPYCFVEFETHADAQEAKFRMDQRTVMDKKLKVNWAT----------NHPGMKRGDTNNHF----HIFVGDLAENVDNALLRKTFEPFGEISEVRVVKDPAKNKSKGFGFVSFVRREDAAKAIAEMDSVTIGGKQVKTNWAARK 166          
BLAST of cytoplasmic poly(A) binding protein vs. Ensembl Nematostella
Match: EDO42673 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S105])

HSP 1 Score: 92.0485 bits (227), Expect = 2.475e-20
Identity = 67/309 (21.68%), Postives = 133/309 (43.04%), Query Frame = 2
Query:  158 SLYVGDLHPEVTEAMIYEKFSSCGPVLSIRVCRDMITRKSLGYAYVNFQNAADAESALDRMNFDTMKGRSIRIMWSQRDPSLRKSGIGNIFIKNLDKSITQKELHDTFVAFGNILSCKIAADERSK-SKGYGFVHFETEAAATNAIDAINGMLIKNKKV---------------------------------------FVGRFIP---------RTNRANSDSDVKFTNC--YIKNFGEDLDDEKLREMFLEFGEITSAKVMID-ENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKK 928
            +L V  +  ++T+      F +   + + ++ R   +  S G+ +V++    DA+ A+D++N  T+  + +++ +S+  P    +   N+++ N+ K + + E    F A+GNI++C++  D+ +   KG GFV ++ +A A  AI +++G       +                                       F  RF P         +    N +       C  Y+ N G D + E +  +F + G +    +M D +  + KGF FV     E A++A++ LNG M+ ++ L V    K+
Sbjct:    6 TLIVNYIPQDMTDQTFRMMFEAVASLNNCKIVRHKPSGWSYGFGFVDYNTTEDAQKAIDKLNGFTIGNKVLKVAFSR--PGGDNTKGANLYVCNIPKQLPEAEFRKAFEAYGNIVNCRLLRDKSTGLPKGCGFVLYDKKAEAQAAISSLSGTFFPGSTMGLQIRYADDNSAKVRPPNNVPNFGQQMGGPGPIRPPANRFQARFNPMGGGPLPQQKMTHMNGNKSQAPPGCTLYVYNIGYDANQEGITALFAQCGIVNKVDIMWDWQRQQCKGFCFVTMATQEEAQNAIQTLNGFMYTNKPLQVSLYSKR 312          

HSP 2 Score: 85.5001 bits (210), Expect = 3.820e-18
Identity = 76/312 (24.36%), Postives = 134/312 (42.95%), Query Frame = 2
Query:  425 IFIKNLDKSITQKELHDTFVAFGNILSCKIAADERSK-SKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVGRFIPRTNRANSDSDVKFTNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDEN-GKSKGFGFVCFKDSETAESAVKALNGKMFKDRQ--LYVGRAQKKNERL-----------------------DELRSHF--------EKQRAER----SSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTD-SNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRK 1240
            + +  + + +T +     F A  ++ +CKI   + S  S G+GFV + T   A  AID +NG  I NK + V       +R   D + K  N Y+ N  + L + + R+ F  +G I + +++ D++ G  KG GFV +     A++A+ +L+G  F      L +  A   + ++                       +  ++ F         +Q+        S+   G  LYV N+    +   +   F   G +    +M D    + KGF FV  +  EEA  A+  +NG +  +KPL V+L  ++
Sbjct:    7 LIVNYIPQDMTDQTFRMMFEAVASLNNCKIVRHKPSGWSYGFGFVDYNTTEDAQKAIDKLNGFTIGNKVLKVA-----FSRPGGD-NTKGANLYVCNIPKQLPEAEFRKAFEAYGNIVNCRLLRDKSTGLPKGCGFVLYDKKAEAQAAISSLSGTFFPGSTMGLQIRYADDNSAKVRPPNNVPNFGQQMGGPGPIRPPANRFQARFNPMGGGPLPQQKMTHMNGNKSQAPPGCTLYVYNIGYDANQEGITALFAQCGIVNKVDIMWDWQRQQCKGFCFVTMATQEEAQNAIQTLNGFMYTNKPLQVSLYSKR 312          
BLAST of cytoplasmic poly(A) binding protein vs. Ensembl Medaka
Match: pabpc1a (poly(A) binding protein cytoplasmic 1 [Source:NCBI gene;Acc:101163762])

HSP 1 Score: 644.04 bits (1660), Expect = 0.000e+0
Identity = 358/675 (53.04%), Postives = 436/675 (64.59%), Query Frame = 2
Query:  143 SIPMASLYVGDLHPEVTEAMIYEKFSSCGPVLSIRVCRDMITRKSLGYAYVNFQNAADAESALDRMNFDTMKGRSIRIMWSQRDPSLRKSGIGNIFIKNLDKSITQKELHDTFVAFGNILSCKIAADERSKSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVGRFIPRTNR-ANSDSDVK-FTNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDRKAHLASQYMQRVNPHRNNYPNQVSVNTXXXXXXXXXXXXXXYAFAPN-----ASTPRVYTQSAAF-------MPPQNRWSNRMHPSQLQFNGGNMRQLANAHFGNMEGSSVPIQNNTMGMQANQIRQVSMIPNQRPMLXXXXXXXXXXXXXX-----GVANTVKSAPQNSRPITGVQMPITSQASNISQQRPPNQPTRQITGQSVISGNQNVNRPINNGSNQLVSGNLEPLTISTLASAPIAEQKQMLGERLYPLVHRMYPELAGKITGMLLEIDNTELLHMLESEDSLTTKIEEAMNVLQSHK 2110
            S PMASLYVGDLHP+VTEAM+YEKFS  GP+LSIRVCRDMITR+SLGYAYVNFQ  ADAE ALD MNFD +KGR +RIMWSQRDPSLRKSG+GNIFIKNLDKSI  K L+DTF AFGNILSCK+  DE + SKGYGFVHFET  AA  AI+ +NGML+ ++KVFVGRF  R  R A   +  + FTN YIKNFGED+DDEKL+E+F  +G   S +VM D+ GKSKGFGFV F+  E A+ AV  +NGK    RQ+YVGRAQKK ER +EL+  FE+ + +R +RY QGVNLYVKNLDD +DD RL++EF  FG ITSAKVM +   RSKGFGFVCFS+PEEATKAVTEMNG+I  +KPLYVALAQRKE+R+AHL +QYMQR+   R   PN V               + PY  AP      A+ P+   ++A +       + P  RW+ +    Q              HF N++ +  P          N IR  +    Q P +  +  +    +             V++ PQ  +   GV+ P    AS   QQ P  QP   + GQ                         EPLT S LA+AP  EQKQMLGERL+PL+  M+P LAGKITGMLLEIDN+ELLHMLES +SL +K++EA+ VLQ+H+
Sbjct:    7 SYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGRPLRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDE-NGSKGYGFVHFETHEAAERAIEKMNGMLLNDRKVFVGRFKSRKEREAELGARAREFTNVYIKNFGEDMDDEKLKELFGNYGPALSVRVMTDDTGKSKGFGFVSFERHEDAQKAVDDMNGKELNGRQVYVGRAQKKGERQNELKRKFEQMKQDRMTRY-QGVNLYVKNLDDGLDDERLRKEFSPFGTITSAKVMME-GGRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEERQAHLTNQYMQRMATVR-AVPNPV---------------LNPYQPAPPSGYFMAAIPQAQNRAAYYSANQLAQLRPSPRWATQGVRPQ--------------HFQNIQNAMRPSAPRPQTF--NAIRASTATNTQVPRMMASQRMPTQALSQRPAAASATTAPVRAMPQ-YKYAPGVRNPQQHMASQ--QQVPMPQPAVHVQGQ-------------------------EPLTASMLAAAPPQEQKQMLGERLFPLIQNMHPSLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQ 618          

HSP 2 Score: 187.578 bits (475), Expect = 4.364e-50
Identity = 106/297 (35.69%), Postives = 168/297 (56.57%), Query Frame = 2
Query:  392 DPSLRKSGIGNIFIKNLDKSITQKELHDTFVAFGNILSCKIAADERS-KSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVGRFIPRTNRANSDSDVKFTNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDRKAHLASQYMQ 1279
            +PS     + ++++ +L   +T+  L++ F   G ILS ++  D  + +S GY +V+F+  A A  A+D +N  +IK + +     I  + R  S       N +IKN  + +D++ L + F  FG I S KV+ DENG SKG+GFV F+  E AE A++ +NG +  DR+++VGR + + ER            AE  +R  +  N+Y+KN  + +DD +LK+ F  +G   S +VMTD   +SKGFGFV F   E+A KAV +MNGK    + +YV  AQ+K +R+  L  ++ Q
Sbjct:    2 NPSAPSYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGRPL----RIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYGFVHFETHEAAERAIEKMNGMLLNDRKVFVGRFKSRKER-----------EAELGARAREFTNVYIKNFGEDMDDEKLKELFGNYGPALSVRVMTDDTGKSKGFGFVSFERHEDAQKAVDDMNGKELNGRQVYVGRAQKKGERQNELKRKFEQ 282          
BLAST of cytoplasmic poly(A) binding protein vs. Ensembl Medaka
Match: pabpc1b (polyadenylate-binding protein 1-like [Source:NCBI gene;Acc:101169122])

HSP 1 Score: 634.795 bits (1636), Expect = 0.000e+0
Identity = 351/679 (51.69%), Postives = 440/679 (64.80%), Query Frame = 2
Query:  143 SIPMASLYVGDLHPEVTEAMIYEKFSSCGPVLSIRVCRDMITRKSLGYAYVNFQNAADAESALDRMNFDTMKGRSIRIMWSQRDPSLRKSGIGNIFIKNLDKSITQKELHDTFVAFGNILSCKIAADERSKSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVGRFIPRTNR-ANSDSDVK-FTNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDRKAHLASQYMQ-----------RVNPHRNNYPNQVSVNTXXXXXXXXXXXXXXYAFAPNASTPRVYTQSAAFMP---PQNRWSNRMHPSQLQFNGGNMRQLANAHFGNMEGSSVPIQNNTMGMQANQIRQVSMIPNQRPMLXXXXXXXXXXXXXXGVANT---VKSAPQNSRPITGVQMPITSQASNISQQRPPNQPTRQITGQSVISGNQNVNRPINNGSNQLVSGNLEPLTISTLASAPIAEQKQMLGERLYPLVHRMYPELAGKITGMLLEIDNTELLHMLESEDSLTTKIEEAMNVLQSHKNQNV 2122
            S P+ASLYVGDLH +VTEAM+YEKFS  G ++SIRVCRDMITR+SLGYAYVNFQ  ADAE ALD MNFD +KG+ +RIMWSQRDPSLRKSG+GNIFIKNLDKSI  K L+DTF AFGNILSCK+  DE + S+GYGFVHFET  AA  AI+ +NGML+ ++KVFVGRF  R  R A   +  + FTN YIKNFGED+DDEKL+E+F +FG  TS +VM DE+G  +GFGFV F++ E A+ AV  +NGK    R ++VGRAQKK ER  EL+  FE+ + +R++RY QGVNLYVKNLDD IDD RL++EF  FG+ITSAKVM +   RSKGFGFVCFS+PEEATKAVTEMNG+I  +KPLYVALAQRKE+R+AHL +QYMQ            +NP++   P+   +  +                 P A +   Y  +A  M    P  RW+               + +   HF NM G   P +        + +R  S +P   PM++     + S+   + VA     V+  PQ  +  TGV+ P   Q    +Q +   QP   I GQ                         EPLT S LA+AP+ EQKQMLGERL+PL+  M+P LAGKITGMLLEIDN+ELLHMLES +SL +K++EA+ VLQ+H+ + V
Sbjct:    7 SYPIASLYVGDLHQDVTEAMLYEKFSPAGAIVSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGQPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDE-NGSRGYGFVHFETHDAAERAIEKMNGMLLNDRKVFVGRFKSRKEREAELGARAREFTNVYIKNFGEDMDDEKLKEIFSKFGNATSVRVMTDESGGGRGFGFVSFENHEDAQKAVDEMNGKELNGRIMFVGRAQKKMERQMELKRRFEQMKQDRTTRY-QGVNLYVKNLDDGIDDERLRKEFSPFGSITSAKVMME-GGRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEERQAHLITQYMQRVANARAAANPVMNPYQPAPPSGFIMTAI-----------------PQAQSRSAYYPTAGQMAQLRPGPRWTT--------------QSVRPQHFQNMPGVMRPPRPRPQNF--STVRASSQVP---PMMNTQRVAAQSSGPRHPVATAATHVRGGPQ-YKYSTGVRNP---QQHVATQPQVTLQPAVHIQGQ-------------------------EPLTASMLAAAPLQEQKQMLGERLFPLIQNMHPSLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQAKEV 617          
BLAST of cytoplasmic poly(A) binding protein vs. Ensembl Medaka
Match: pabpc4 (poly(A) binding protein cytoplasmic 4 [Source:NCBI gene;Acc:101159058])

HSP 1 Score: 633.254 bits (1632), Expect = 0.000e+0
Identity = 356/678 (52.51%), Postives = 425/678 (62.68%), Query Frame = 2
Query:  128 NQINNSIPMASLYVGDLHPEVTEAMIYEKFSSCGPVLSIRVCRDMITRKSLGYAYVNFQNAADAESALDRMNFDTMKGRSIRIMWSQRDPSLRKSGIGNIFIKNLDKSITQKELHDTFVAFGNILSCKIAADERSKSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVGRFIPRTNR-ANSDSDVK-FTNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDRKAHLASQYMQRVNPHRNNYP----NQVSVNTXXXXXXXXXXXXXXYAFAPNASTPRVYTQSAAFMPPQNRWSNRMH---------PSQLQFNG--GNMRQLANAHFGNMEGSSVPIQNNTMGMQANQIRQVSMIPNQRPMLXXXXXXXXXXXXXXGVANTVKSAPQNSRPITGVQMPITSQASNISQQRPPNQPTRQITGQSVISGNQNVNRPINNGSNQLVSGNLEPLTISTLASAPIAEQKQMLGERLYPLVHRMYPELAGKITGMLLEIDNTELLHMLESEDSLTTKIEEAMNVLQSHK 2110
            N    S PMASLYVGDLHP++TEAM+YEKFS  GPVLSIRVCRDMITR+SLGYAYVNF   ADAE ALD MNFD +KG+ IRIMWSQRDPSLRKSG+GN+FIKNLDKSI  K L+DTF AFGNILSCK+  DE   SKGY FVHFET+ AA  AI+ +NGML+ ++KVFVGRF  R  R A   +  K FTN YIKNFG++++DE+L+EMF ++G+  S KVM D +GKS+GFGFV F+  E A  AV+ +NG     + ++VGRAQKK ER  EL+  FE  + ER SRY QGVNLY+KNLDD+IDD +L++EF  FG+ITSAKVM + + RSKGFGFVCFS+PEEATKAVTEMNG+I GSKPLYVALAQRKE+RKAHL +QYMQR+   R   P    NQ    +                +APN           A M P  RW  +           PS L+  G  GNMR     H     GS  P  +     Q+   R    +P  R M                  +  K A     P   V  PI  Q +         QP   I GQ                         EPLT S LA+AP  EQKQMLGERL+PL+  M+  LAGKITGMLLEIDN+ELLHMLES +SL +K+EEA+ VLQ+H+
Sbjct:    2 NTATGSYPMASLYVGDLHPDITEAMLYEKFSPAGPVLSIRVCRDMITRRSLGYAYVNFSQPADAERALDTMNFDVVKGKPIRIMWSQRDPSLRKSGVGNVFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYAFVHFETQDAADRAIEKMNGMLLNDRKVFVGRFKSRKEREAELGAKAKEFTNVYIKNFGDEMEDEQLKEMFEKYGKTLSVKVMTDSSGKSRGFGFVSFEKHEDANKAVEEINGTELNGKTVFVGRAQKKMERQAELKRKFELLKQERISRY-QGVNLYIKNLDDTIDDEKLRKEFSPFGSITSAKVMLE-DGRSKGFGFVCFSSPEEATKAVTEMNGRIVGSKPLYVALAQRKEERKAHLTNQYMQRIAGMRAMPPNAIINQFQPTSGYFMPAVPQAQNRTTYYAPN---------QLAQMRPNPRWQQQGGRGQGGFQGMPSSLRQPGPRGNMR-----HMSPSGGSQGPRASG----QSMAPRPSMGVPGPRTM------------------SPYKYATSVRNPNPQVVQPIALQQA---------QPAVHIQGQ-------------------------EPLTASMLAAAPPQEQKQMLGERLFPLIQAMHANLAGKITGMLLEIDNSELLHMLESHESLQSKVEEAVAVLQAHQ 606          
BLAST of cytoplasmic poly(A) binding protein vs. Ensembl Medaka
Match: pabpc1l (embryonic polyadenylate-binding protein [Source:NCBI gene;Acc:101167536])

HSP 1 Score: 516.924 bits (1330), Expect = 6.162e-175
Identity = 248/381 (65.09%), Postives = 303/381 (79.53%), Query Frame = 2
Query:  149 PMASLYVGDLHPEVTEAMIYEKFSSCGPVLSIRVCRDMITRKSLGYAYVNFQNAADAESALDRMNFDTMKGRSIRIMWSQRDPSLRKSGIGNIFIKNLDKSITQKELHDTFVAFGNILSCKIAADERSKSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVGRFIPRTNRAN--SDSDVKFTNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDRKAHLASQYMQRV 1285
            P+ASLYVGDLHP+VTEAM+Y+KFS  GP++SIRVCRD+ITR+SLGYAY+NFQ  ADAE ALD MN+D +KGR IRIMWSQRDP+LRKSG+GNIFIKN+D SI  K L+DTF AFGNILSCK+  DER  SKGYGFVHFET+ AA  AI+ +NGML+ ++KVFVG F  R  R        +KFTN YIKNFG++L DEKL+E F  FG+  S +VM DE G+S+GFGFV +   E A+ AV  +NGK    + +YVGRAQK+ ER  EL+  F++ + +R  RY QGVNLYVKNLDDSIDD RL++EF  +G ITSAKVMT++  +SKGFGFVCFS+PEEATKAVTEMNG+I  +KPLYVALAQR+E+RKA L ++YMQR+
Sbjct:    9 PLASLYVGDLHPDVTEAMLYQKFSPAGPIVSIRVCRDIITRRSLGYAYINFQQPADAECALDTMNYDVIKGRPIRIMWSQRDPALRKSGVGNIFIKNIDDSIDNKALYDTFSAFGNILSCKVVCDERG-SKGYGFVHFETQEAANRAIETMNGMLLNDRKVFVGHFKSRKEREVEFGTKVMKFTNIYIKNFGDNLTDEKLKEAFSAFGKTLSVRVMRDEKGRSRGFGFVNYAHHEDAQKAVDEMNGKEMNGKIIYVGRAQKRLERQGELKRKFDQLKQDRIQRY-QGVNLYVKNLDDSIDDERLRKEFSPYGTITSAKVMTEA-GQSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRREERKAILTNKYMQRM 386          

HSP 2 Score: 110.538 bits (275), Expect = 9.213e-25
Identity = 51/79 (64.56%), Postives = 66/79 (83.54%), Query Frame = 2
Query: 1883 EPLTISTLASAPIAEQKQMLGERLYPLVHRMYPELAGKITGMLLEIDNTELLHMLESEDSLTTKIEEAMNVLQSHKNQN 2119
            EPLT S LA+AP  +QKQ+LG+RLYPL+    P LAGKITGMLLEIDN+ELLHMLES +SL +K++EA+ VLQ+H+ ++
Sbjct:  491 EPLTASMLAAAPPMDQKQLLGDRLYPLILAQQPNLAGKITGMLLEIDNSELLHMLESPESLKSKVDEAIAVLQAHQAKD 569          

HSP 3 Score: 90.8929 bits (224), Expect = 1.419e-18
Identity = 60/213 (28.17%), Postives = 105/213 (49.30%), Query Frame = 2
Query:  689 FTNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDE-NGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGV-NLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDRKAHLASQYMQRVNPHRNNYPNQVS 1321
              + Y+ +   D+ +  L + F   G I S +V  D    +S G+ ++ F+    AE A+  +N  + K R + +  +Q+                A R S    GV N+++KN+DDSID+  L   F  FGNI S KV+ D    SKG+GFV F   E A +A+  MNG +   + ++V   + +++R+    ++ M+  N +  N+ + ++
Sbjct:   10 LASLYVGDLHPDVTEAMLYQKFSPAGPIVSIRVCRDIITRRSLGYAYINFQQPADAECALDTMNYDVIKGRPIRIMWSQRDP--------------ALRKS----GVGNIFIKNIDDSIDNKALYDTFSAFGNILSCKVVCDERG-SKGYGFVHFETQEAANRAIETMNGMLLNDRKVFVGHFKSRKEREVEFGTKVMKFTNIYIKNFGDNLT 203          
BLAST of cytoplasmic poly(A) binding protein vs. Ensembl Medaka
Match: pabpc1l (embryonic polyadenylate-binding protein [Source:NCBI gene;Acc:101167536])

HSP 1 Score: 517.309 bits (1331), Expect = 1.637e-174
Identity = 248/381 (65.09%), Postives = 303/381 (79.53%), Query Frame = 2
Query:  149 PMASLYVGDLHPEVTEAMIYEKFSSCGPVLSIRVCRDMITRKSLGYAYVNFQNAADAESALDRMNFDTMKGRSIRIMWSQRDPSLRKSGIGNIFIKNLDKSITQKELHDTFVAFGNILSCKIAADERSKSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVGRFIPRTNRAN--SDSDVKFTNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDRKAHLASQYMQRV 1285
            P+ASLYVGDLHP+VTEAM+Y+KFS  GP++SIRVCRD+ITR+SLGYAY+NFQ  ADAE ALD MN+D +KGR IRIMWSQRDP+LRKSG+GNIFIKN+D SI  K L+DTF AFGNILSCK+  DER  SKGYGFVHFET+ AA  AI+ +NGML+ ++KVFVG F  R  R        +KFTN YIKNFG++L DEKL+E F  FG+  S +VM DE G+S+GFGFV +   E A+ AV  +NGK    + +YVGRAQK+ ER  EL+  F++ + +R  RY QGVNLYVKNLDDSIDD RL++EF  +G ITSAKVMT++  +SKGFGFVCFS+PEEATKAVTEMNG+I  +KPLYVALAQR+E+RKA L ++YMQR+
Sbjct:    9 PLASLYVGDLHPDVTEAMLYQKFSPAGPIVSIRVCRDIITRRSLGYAYINFQQPADAECALDTMNYDVIKGRPIRIMWSQRDPALRKSGVGNIFIKNIDDSIDNKALYDTFSAFGNILSCKVVCDERG-SKGYGFVHFETQEAANRAIETMNGMLLNDRKVFVGHFKSRKEREVEFGTKVMKFTNIYIKNFGDNLTDEKLKEAFSAFGKTLSVRVMRDEKGRSRGFGFVNYAHHEDAQKAVDEMNGKEMNGKIIYVGRAQKRLERQGELKRKFDQLKQDRIQRY-QGVNLYVKNLDDSIDDERLRKEFSPYGTITSAKVMTEA-GQSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRREERKAILTNKYMQRM 386          

HSP 2 Score: 110.923 bits (276), Expect = 9.313e-25
Identity = 51/79 (64.56%), Postives = 66/79 (83.54%), Query Frame = 2
Query: 1883 EPLTISTLASAPIAEQKQMLGERLYPLVHRMYPELAGKITGMLLEIDNTELLHMLESEDSLTTKIEEAMNVLQSHKNQN 2119
            EPLT S LA+AP  +QKQ+LG+RLYPL+    P LAGKITGMLLEIDN+ELLHMLES +SL +K++EA+ VLQ+H+ ++
Sbjct:  536 EPLTASMLAAAPPMDQKQLLGDRLYPLILAQQPNLAGKITGMLLEIDNSELLHMLESPESLKSKVDEAIAVLQAHQAKD 614          

HSP 3 Score: 90.5077 bits (223), Expect = 2.116e-18
Identity = 60/213 (28.17%), Postives = 105/213 (49.30%), Query Frame = 2
Query:  689 FTNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDE-NGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGV-NLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDRKAHLASQYMQRVNPHRNNYPNQVS 1321
              + Y+ +   D+ +  L + F   G I S +V  D    +S G+ ++ F+    AE A+  +N  + K R + +  +Q+                A R S    GV N+++KN+DDSID+  L   F  FGNI S KV+ D    SKG+GFV F   E A +A+  MNG +   + ++V   + +++R+    ++ M+  N +  N+ + ++
Sbjct:   10 LASLYVGDLHPDVTEAMLYQKFSPAGPIVSIRVCRDIITRRSLGYAYINFQQPADAECALDTMNYDVIKGRPIRIMWSQRDP--------------ALRKS----GVGNIFIKNIDDSIDNKALYDTFSAFGNILSCKVVCDERG-SKGYGFVHFETQEAANRAIETMNGMLLNDRKVFVGHFKSRKEREVEFGTKVMKFTNIYIKNFGDNLT 203          
BLAST of cytoplasmic poly(A) binding protein vs. Planmine SMEST
Match: SMESG000004978.1 (SMESG000004978.1)

HSP 1 Score: 1372.07 bits (3550), Expect = 0.000e+0
Identity = 691/691 (100.00%), Postives = 691/691 (100.00%), Query Frame = 2
Query:  113 MTAVNNQINNSIPMASLYVGDLHPEVTEAMIYEKFSSCGPVLSIRVCRDMITRKSLGYAYVNFQNAADAESALDRMNFDTMKGRSIRIMWSQRDPSLRKSGIGNIFIKNLDKSITQKELHDTFVAFGNILSCKIAADERSKSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVGRFIPRTNRANSDSDVKFTNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDRKAHLASQYMQRVNPHRNNYPNQVSVNTXXXXXXXXXXXXXXYAFAPNASTPRVYTQSAAFMPPQNRWSNRMHPSQLQFNGGNMRQLANAHFGNMEGSSVPIQNNTMGMQANQIRQVSMIPNQRPMLXXXXXXXXXXXXXXGVANTVKSAPQNSRPITGVQMPITSQASNISQQRPPNQPTRQITGQSVISGNQNVNRPINNGSNQLVSGNLEPLTISTLASAPIAEQKQMLGERLYPLVHRMYPELAGKITGMLLEIDNTELLHMLESEDSLTTKIEEAMNVLQSHKNQNVIVTDMGQGLPKQQTGSKVAAN 2185
            MTAVNNQINNSIPMASLYVGDLHPEVTEAMIYEKFSSCGPVLSIRVCRDMITRKSLGYAYVNFQNAADAESALDRMNFDTMKGRSIRIMWSQRDPSLRKSGIGNIFIKNLDKSITQKELHDTFVAFGNILSCKIAADERSKSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVGRFIPRTNRANSDSDVKFTNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDRKAHLASQYMQRVNPHRNNYPNQVSVNTLISGGPPGGPSILPYAFAPNASTPRVYTQSAAFMPPQNRWSNRMHPSQLQFNGGNMRQLANAHFGNMEGSSVPIQNNTMGMQANQIRQVSMIPNQRPMLSNNANVSASNVMMNGVANTVKSAPQNSRPITGVQMPITSQASNISQQRPPNQPTRQITGQSVISGNQNVNRPINNGSNQLVSGNLEPLTISTLASAPIAEQKQMLGERLYPLVHRMYPELAGKITGMLLEIDNTELLHMLESEDSLTTKIEEAMNVLQSHKNQNVIVTDMGQGLPKQQTGSKVAAN
Sbjct:    1 MTAVNNQINNSIPMASLYVGDLHPEVTEAMIYEKFSSCGPVLSIRVCRDMITRKSLGYAYVNFQNAADAESALDRMNFDTMKGRSIRIMWSQRDPSLRKSGIGNIFIKNLDKSITQKELHDTFVAFGNILSCKIAADERSKSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVGRFIPRTNRANSDSDVKFTNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDRKAHLASQYMQRVNPHRNNYPNQVSVNTLISGGPPGGPSILPYAFAPNASTPRVYTQSAAFMPPQNRWSNRMHPSQLQFNGGNMRQLANAHFGNMEGSSVPIQNNTMGMQANQIRQVSMIPNQRPMLSNNANVSASNVMMNGVANTVKSAPQNSRPITGVQMPITSQASNISQQRPPNQPTRQITGQSVISGNQNVNRPINNGSNQLVSGNLEPLTISTLASAPIAEQKQMLGERLYPLVHRMYPELAGKITGMLLEIDNTELLHMLESEDSLTTKIEEAMNVLQSHKNQNVIVTDMGQGLPKQQTGSKVAAN 691          
BLAST of cytoplasmic poly(A) binding protein vs. Planmine SMEST
Match: SMESG000058745.1 (SMESG000058745.1)

HSP 1 Score: 569.311 bits (1466), Expect = 0.000e+0
Identity = 327/668 (48.95%), Postives = 421/668 (63.02%), Query Frame = 2
Query:  137 NNSIPMASLYVGDLHPEVTEAMIYEKFSSCGPVLSIRVCRDMITRKSLGYAYVNFQNAADAESALDRMNFDTMKGRSIRIMWSQRDPSLRKSGIGNIFIKNLDKSITQKELHDTFVAFGNILSCKIAADERSKSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVGRFIPRTNRANSDSDVKFTNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTD-SNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDRKAHLASQYMQRVN-PHRNNYPNQVSVNTXXXXXXXXXXXXXXYAFAPNASTPRVYTQSAAFMPPQNRWSNRMHPSQLQFNGGNMRQLANAHFGNMEGSSVPIQNNTM--GMQANQIRQVSMIPNQRPMLXXXXXXXXXXXXXXGVANTVKSAPQNSRPITG-VQMPIT-SQASNISQQRPPNQPTRQITGQSVISGNQNVNRPINNGSNQL----VSGNLEPLTISTLASAPIAEQKQMLGERLYPLVHRMYPELAGKITGMLLEIDNTELLHMLESEDSLTTKIEEAMNVLQSHK 2110
            N +IP ASLYVGDLHP+VTEA++YEKF + G VLSIRVCRD++TRKSLGYAYVN+Q + +A+SA+D +NF+ + GR  RIMWSQRDP+ R+SG+GNIFIKNLD SIT KE++DTF  FG I SCK+  DE   SKG+ FV+F  E  A  AI AING +I+ K V+V +FIPRT R+  + D  FTNCYIKNFG  L D+ LR++F + GEI SAKVM+D+ G SKGFGFV FK+ E A  AV  LNG++ +D+ +YVGRA KK ER  ELR+ +EK R ER  ++  GVNLY+KNL + I+D RL+ EF VFGNITSAKVM +  NN SKGFGFVCFS P+EAT+AV+EMNGKI   KPLYVALAQ+KEDR AHL SQ+ QR + P     P  V+                   F  N++  R +      +  QNRW   M   Q +  G                  +P   N M  GM  NQ R+  M+    PM++ N                     +N+RPITG VQ+  T  Q + ++  R  N     I  Q  I  NQ +  P     +Q+    +   ++  T S +A+A   E KQ+LGE++YPLV +   ++AGKITGM LE+DN ELL+M+E+E+SL  KI+EAM VL +HK
Sbjct:    3 NPTIPCASLYVGDLHPDVTEAILYEKFQTHGNVLSIRVCRDLVTRKSLGYAYVNYQVSTEAKSAMDNLNFEDIHGRPCRIMWSQRDPAARRSGVGNIFIKNLDPSITVKEINDTFANFGEISSCKVQTDENGVSKGFAFVNFNHEGDAEKAIQAINGKMIREKIVYVAKFIPRTQRSTPNKD--FTNCYIKNFGIHLHDKSLRDLFEQCGEIVSAKVMVDKEGNSKGFGFVSFKEHEDAIKAVNTLNGRVIEDKTIYVGRAMKKAERQRELRARYEKTRQERLQQHKSGVNLYIKNLGNEINDERLRNEFAVFGNITSAKVMLNKENNTSKGFGFVCFSAPDEATRAVSEMNGKIVEGKPLYVALAQKKEDRVAHLRSQFQQRGHQPQPVFNPGMVN-------------------FMMNSNVQRPFMARPGNI-LQNRWPQTMPYIQPRNIG------------------MPANQNIMMTGMPQNQQRRNIMVD---PMMNQN---------------------RNARPITGNVQLNQTRPQYNMVANGRQGN----NIMYQYPIQDNQPMLNP-----DQMKMPDIESQIDLTTTSKIANADSMEAKQLLGEKIYPLVSKYAGDMAGKITGMFLELDNAELLYMIENENSLKMKIDEAMLVLNAHK 597          
BLAST of cytoplasmic poly(A) binding protein vs. Planmine SMEST
Match: SMESG000062663.1 (SMESG000062663.1)

HSP 1 Score: 363.229 bits (931), Expect = 2.644e-118
Identity = 181/388 (46.65%), Postives = 261/388 (67.27%), Query Frame = 2
Query:  137 NNSIPMASLYVGDLHPEVTEAMIYEKFSSCGPVLSIRVCRDMITRKSLGYAYVNFQNAADAESALDRMNFDTMKGRSIRIMWSQRDPSLRKSGIGNIFIKNLDKSITQKELHDTFVAFGNILSCKIAADERSKSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVGRFIPRTNRANSDSDVKFTNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTD-SNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDRKAHLASQYMQRVNPHR 1297
            N ++  ASLYVGDL+ +VTE+ +++ F + G ++SI VCRD+I   SLGYAY+NF N++DA++A+D++N + +KG   R+ WSQRD S+RKS +GNI IKNL +++T KEL + F  FG I SC +  DE   SKG  FV+F     A  AI++ING  I+++ V+VG+FIP+     +     FTN Y+KNFG  L+++ L E+F  FGEI S KVM  E G SKGFGFVCFK+   A  +++ LN     D+ +YVG A +K + ++E     E +  ++  +  + VN++VKNLD+SI+D +LK EF VFGN+TSAKVM D SN  SKGFGFVCFSN  EA +A+ EMN K+   K +YVA+A ++E+   H+ S++ +    ++
Sbjct:    3 NKNLNAASLYVGDLNKDVTESNLFDVFKNFGKIISIHVCRDLIKNVSLGYAYINFTNSSDAKAAIDKVNLENIKGTPCRVTWSQRDSSVRKSNVGNIIIKNLPQTVTVKELREKFECFGEITSCSMKTDENGLSKGCAFVNFSEAGYADKAIESINGQKIQDEVVYVGKFIPKDQLKKT-----FTNVYVKNFGIHLNNQSLEELFSPFGEIISVKVMATEKGISKGFGFVCFKNHSDALKSIEKLNETTIIDKVIYVGLAVEKPKSVEEKLRTVESKSKDK-PQLVESVNVFVKNLDESINDEKLKAEFSVFGNVTSAKVMVDKSNGVSKGFGFVCFSNSNEAAQAILEMNYKVLCDKQIYVAVAYKRENSDNHVHSKFQKSFRKYK 384          

HSP 2 Score: 73.559 bits (179), Expect = 1.509e-13
Identity = 56/202 (27.72%), Postives = 94/202 (46.53%), Query Frame = 2
Query:  701 YIKNFGEDLDDEKLREMFLEFGEITSAKVMIDE-NGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDRKAHLASQYMQRVNPHRNN 1303
            Y+ +  +D+ +  L ++F  FG+I S  V  D     S G+ ++ F +S  A++A+  +N +  K     V  +Q+                 + S R +   N+ +KNL  ++    L+++F  FG ITS  + TD N  SKG  FV FS    A KA+  +NG+    + +YV     K+  K    + Y++    H NN
Sbjct:   12 YVGDLNKDVTESNLFDVFKNFGKIISIHVCRDLIKNVSLGYAYINFTNSSDAKAAIDKVNLENIKGTPCRVTWSQR-----------------DSSVRKSNVGNIIIKNLPQTVTVKELREKFECFGEITSCSMKTDENGLSKGCAFVNFSEAGYADKAIESINGQKIQDEVVYVGKFIPKDQLKKTFTNVYVKNFGIHLNN 196          
BLAST of cytoplasmic poly(A) binding protein vs. Planmine SMEST
Match: SMESG000058799.1 (SMESG000058799.1)

HSP 1 Score: 305.834 bits (782), Expect = 8.222e-90
Identity = 155/363 (42.70%), Postives = 232/363 (63.91%), Query Frame = 2
Query:  155 ASLYVGDLHPEVTEAMIYEKFSSCGPVLSIRVCRDMITRKSLGYAYVNFQNAADAESALDRMNFDTMKGRSIRIMWSQRDPSLRKSGIGNIFIKNLDKSITQKELHDTFVAFGNILSCKIAADERSKSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVGRFIPRTNRANSDSDVKFTNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNR-SKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRK 1240
            + +++ +LHP+V E  +Y+ F S G +LSIR+ R+  T+KSLG AY+ F   +DA++A+D++NF  +     RI WS+ +  +RKS IGN+FIKNLD S+  K++++ F  FG I+SCK+  +E  +S G+GFV +++E  A  AI  +NG LI NK V+VG+F+ + +RA  D   K TNCY+KN    +D+EKLRE+F  FGEI S+ V +D  G SKG GFV FK  + A  A+  +NG+M  D+++ V  AQ                +  + ++     N+Y+  LD  +D+T L +EF +FG+ITSAKVM D  N+ S G+GFVC+SNP+EA  AVT+MNGK    K ++V +  ++
Sbjct:  579 SEIFLENLHPDVDEEFLYKLFHSYGEILSIRLMRNSETQKSLGVAYITFVRRSDAKTAMDKVNFKKIYRNECRIKWSESNKVIRKSEIGNVFIKNLDLSLNTKDIYEIFKRFGEIISCKLRTNEIGESLGFGFVRYDSEPTAELAIRKMNGKLIGNKVVYVGKFLSKQHRACVDE--KSTNCYVKNLETSIDNEKLRELFAGFGEIVSSIVQVDSKGISKGRGFVAFKKHDEALRAITTMNGEMINDQRIEVSIAQ---------------HQMAKGNKNALNCNVYINRLDSIVDETMLLKEFSIFGSITSAKVMRDEENKFSLGYGFVCYSNPQEAQLAVTKMNGKNLEGKKIFVNICGKR 924          

HSP 2 Score: 78.9518 bits (193), Expect = 1.034e-14
Identity = 55/184 (29.89%), Postives = 97/184 (52.72%), Query Frame = 2
Query:  701 YIKNFGEDLDDEKLREMFLEFGEITSAKVMID-ENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDR 1249
            +++N   D+D+E L ++F  +GEI S ++M + E  KS G  ++ F     A++A+  +N K     ++Y      +NE         +   + +  R ++  N+++KNLD S++   + + F  FG I S K+ T+    S GFGFV + +   A  A+ +MNGK+ G+K +YV     K+ R
Sbjct:  582 FLENLHPDVDEEFLYKLFHSYGEILSIRLMRNSETQKSLGVAYITFVRRSDAKTAMDKVNFK-----KIY------RNE------CRIKWSESNKVIRKSEIGNVFIKNLDLSLNTKDIYEIFKRFGEIISCKLRTNEIGESLGFGFVRYDSEPTAELAIRKMNGKLIGNKVVYVGKFLSKQHR 748          

HSP 3 Score: 52.7582 bits (125), Expect = 1.234e-6
Identity = 26/52 (50.00%), Postives = 33/52 (63.46%), Query Frame = 2
Query: 1931 KQMLGERLYPLVHRMYPELAGKITGMLLEIDNTELLHMLESEDSLTTKIEEA 2086
            KQ+ GE LY  V +    L+GKI GM LE+DN EL  +LE E+ L  KI+ A
Sbjct:  962 KQIFGELLYKKVEKYAGNLSGKIVGMFLELDNRELTTLLEDENELIKKIQMA 1013          
BLAST of cytoplasmic poly(A) binding protein vs. Planmine SMEST
Match: SMESG000058799.1 (SMESG000058799.1)

HSP 1 Score: 305.834 bits (782), Expect = 8.807e-90
Identity = 155/363 (42.70%), Postives = 232/363 (63.91%), Query Frame = 2
Query:  155 ASLYVGDLHPEVTEAMIYEKFSSCGPVLSIRVCRDMITRKSLGYAYVNFQNAADAESALDRMNFDTMKGRSIRIMWSQRDPSLRKSGIGNIFIKNLDKSITQKELHDTFVAFGNILSCKIAADERSKSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVGRFIPRTNRANSDSDVKFTNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNR-SKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRK 1240
            + +++ +LHP+V E  +Y+ F S G +LSIR+ R+  T+KSLG AY+ F   +DA++A+D++NF  +     RI WS+ +  +RKS IGN+FIKNLD S+  K++++ F  FG I+SCK+  +E  +S G+GFV +++E  A  AI  +NG LI NK V+VG+F+ + +RA  D   K TNCY+KN    +D+EKLRE+F  FGEI S+ V +D  G SKG GFV FK  + A  A+  +NG+M  D+++ V  AQ                +  + ++     N+Y+  LD  +D+T L +EF +FG+ITSAKVM D  N+ S G+GFVC+SNP+EA  AVT+MNGK    K ++V +  ++
Sbjct:  579 SEIFLENLHPDVDEEFLYKLFHSYGEILSIRLMRNSETQKSLGVAYITFVRRSDAKTAMDKVNFKKIYRNECRIKWSESNKVIRKSEIGNVFIKNLDLSLNTKDIYEIFKRFGEIISCKLRTNEIGESLGFGFVRYDSEPTAELAIRKMNGKLIGNKVVYVGKFLSKQHRACVDE--KSTNCYVKNLETSIDNEKLRELFAGFGEIVSSIVQVDSKGISKGRGFVAFKKHDEALRAITTMNGEMINDQRIEVSIAQ---------------HQMAKGNKNALNCNVYINRLDSIVDETMLLKEFSIFGSITSAKVMRDEENKFSLGYGFVCYSNPQEAQLAVTKMNGKNLEGKKIFVNICGKR 924          

HSP 2 Score: 78.9518 bits (193), Expect = 1.035e-14
Identity = 55/184 (29.89%), Postives = 97/184 (52.72%), Query Frame = 2
Query:  701 YIKNFGEDLDDEKLREMFLEFGEITSAKVMID-ENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDR 1249
            +++N   D+D+E L ++F  +GEI S ++M + E  KS G  ++ F     A++A+  +N K     ++Y      +NE         +   + +  R ++  N+++KNLD S++   + + F  FG I S K+ T+    S GFGFV + +   A  A+ +MNGK+ G+K +YV     K+ R
Sbjct:  582 FLENLHPDVDEEFLYKLFHSYGEILSIRLMRNSETQKSLGVAYITFVRRSDAKTAMDKVNFK-----KIY------RNE------CRIKWSESNKVIRKSEIGNVFIKNLDLSLNTKDIYEIFKRFGEIISCKLRTNEIGESLGFGFVRYDSEPTAELAIRKMNGKLIGNKVVYVGKFLSKQHR 748          

HSP 3 Score: 52.7582 bits (125), Expect = 1.245e-6
Identity = 26/52 (50.00%), Postives = 33/52 (63.46%), Query Frame = 2
Query: 1931 KQMLGERLYPLVHRMYPELAGKITGMLLEIDNTELLHMLESEDSLTTKIEEA 2086
            KQ+ GE LY  V +    L+GKI GM LE+DN EL  +LE E+ L  KI+ A
Sbjct:  964 KQIFGELLYKKVEKYAGNLSGKIVGMFLELDNRELTTLLEDENELIKKIQMA 1015          
The following BLAST results are available for this feature:
BLAST of cytoplasmic poly(A) binding protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PABPC13.853e-5354.01poly(A) binding protein cytoplasmic 1 [Source:HGNC... [more]
PABPC10.000e+050.15poly(A) binding protein cytoplasmic 1 [Source:HGNC... [more]
PABPC10.000e+052.13poly(A) binding protein cytoplasmic 1 [Source:HGNC... [more]
PABPC41.648e-2568.81poly(A) binding protein cytoplasmic 4 [Source:HGNC... [more]
PABPC41.558e-2568.81poly(A) binding protein cytoplasmic 4 [Source:HGNC... [more]
back to top
BLAST of cytoplasmic poly(A) binding protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pab-17.079e-17263.45Polyadenylate-binding protein [Source:UniProtKB/T... [more]
pab-17.079e-17263.45Polyadenylate-binding protein [Source:UniProtKB/T... [more]
pab-17.079e-17263.45Polyadenylate-binding protein [Source:UniProtKB/T... [more]
pab-17.079e-17263.45Polyadenylate-binding protein [Source:UniProtKB/T... [more]
pab-17.079e-17263.45Polyadenylate-binding protein [Source:UniProtKB/T... [more]
back to top
BLAST of cytoplasmic poly(A) binding protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pAbp4.693e-17665.45gene:FBgn0265297 transcript:FBtr0086738[more]
pAbp4.693e-17665.45gene:FBgn0265297 transcript:FBtr0086736[more]
pAbp4.693e-17665.45gene:FBgn0265297 transcript:FBtr0086740[more]
CG46121.349e-5046.32gene:FBgn0035016 transcript:FBtr0306137[more]
CG46121.349e-5046.32gene:FBgn0035016 transcript:FBtr0072346[more]
back to top
BLAST of cytoplasmic poly(A) binding protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pabpc1a4.438e-5254.52poly(A) binding protein, cytoplasmic 1a [Source:ZF... [more]
pabpc1a4.438e-5254.52poly(A) binding protein, cytoplasmic 1a [Source:ZF... [more]
pabpc1b1.492e-5253.95poly A binding protein, cytoplasmic 1 b [Source:ZF... [more]
pabpc40.000e+052.12poly(A) binding protein, cytoplasmic 4 (inducible ... [more]
pabpc40.000e+052.12poly(A) binding protein, cytoplasmic 4 (inducible ... [more]
back to top
BLAST of cytoplasmic poly(A) binding protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tmem1015.875e-5354.26transmembrane protein 101 [Source:Xenbase;Acc:XB-G... [more]
tmem1015.025e-5354.29transmembrane protein 101 [Source:Xenbase;Acc:XB-G... [more]
tmem1017.639e-5154.90transmembrane protein 101 [Source:Xenbase;Acc:XB-G... [more]
tmem1011.752e-5054.04transmembrane protein 101 [Source:Xenbase;Acc:XB-G... [more]
pabpc40.000e+052.73poly(A) binding protein cytoplasmic 4 [Source:NCBI... [more]
back to top
BLAST of cytoplasmic poly(A) binding protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pabpc11.305e-5354.15poly(A) binding protein, cytoplasmic 1 [Source:MGI... [more]
Pabpc20.000e+050.52poly(A) binding protein, cytoplasmic 2 [Source:MGI... [more]
Pabpc49.824e-2668.56poly(A) binding protein, cytoplasmic 4 [Source:MGI... [more]
Pabpc41.096e-2568.56poly(A) binding protein, cytoplasmic 4 [Source:MGI... [more]
Pabpc41.098e-2568.56poly(A) binding protein, cytoplasmic 4 [Source:MGI... [more]
back to top
BLAST of cytoplasmic poly(A) binding protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P29341|PABP1_MOUSE9.126e-5354.15Polyadenylate-binding protein 1 OS=Mus musculus OX... [more]
sp|Q9EPH8|PABP1_RAT1.129e-5253.77Polyadenylate-binding protein 1 OS=Rattus norvegic... [more]
sp|F1QB54|PABPA_DANRE3.350e-5154.52Polyadenylate-binding protein 1A OS=Danio rerio OX... [more]
sp|P11940|PABP1_HUMAN1.850e-5254.01Polyadenylate-binding protein 1 OS=Homo sapiens OX... [more]
sp|P61286|PABP1_BOVIN1.850e-5254.01Polyadenylate-binding protein 1 OS=Bos taurus OX=9... [more]
back to top
BLAST of cytoplasmic poly(A) binding protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
E2FB123.737e-34100.00Cytoplasmic poly(A) binding protein (Fragment) OS=... [more]
A0A267DA930.000e+056.54Polyadenylate-binding protein OS=Macrostomum ligna... [more]
A0A1I8I3V70.000e+056.54Polyadenylate-binding protein OS=Macrostomum ligna... [more]
A0A267DL860.000e+056.25Polyadenylate-binding protein OS=Macrostomum ligna... [more]
A0A1I8HLB80.000e+055.23Polyadenylate-binding protein OS=Macrostomum ligna... [more]
back to top
BLAST of cytoplasmic poly(A) binding protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pabpc1b1.003e-5255.20poly(A) binding protein cytoplasmic 1 [Source:NCBI... [more]
ENSAMXT00000035946.16.770e-5253.98polyadenylate-binding protein 1-like [Source:NCBI ... [more]
pabpc40.000e+050.29poly(A) binding protein, cytoplasmic 4 (inducible ... [more]
ENSAMXT00000018970.21.704e-5167.25polyadenylate-binding protein 1-like [Source:NCBI ... [more]
pabpc40.000e+045.90poly(A) binding protein, cytoplasmic 4 (inducible ... [more]
back to top
BLAST of cytoplasmic poly(A) binding protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pabpc40.000e+061.16poly(A) binding protein, cytoplasmic 4 (inducible ... [more]
pabpc46.499e-13546.94poly(A) binding protein, cytoplasmic 4 (inducible ... [more]
sf3b43.226e-2639.63splicing factor 3b, subunit 4 [Source:ZFIN;Acc:ZDB... [more]
tia1l7.367e-2230.60cytotoxic granule-associated RNA binding protein 1... [more]
RBMS25.291e-2127.93RNA binding motif single stranded interacting prot... [more]
back to top
BLAST of cytoplasmic poly(A) binding protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
PAB19.046e-14456.08Poly(A) binding protein; part of the 3'-end RNA-pr... [more]
PES43.190e-3429.70Poly(A) binding protein, suppressor of DNA polymer... [more]
MIP69.384e-3028.76Putative RNA-binding protein; interacts with Mex67... [more]
PUB17.809e-1931.76Poly (A)+ RNA-binding protein; abundant mRNP-compo... [more]
GBP25.024e-1825.08Poly(A+) RNA-binding protein; key surveillance fac... [more]
back to top
BLAST of cytoplasmic poly(A) binding protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO332062.194e-17865.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO424179.896e-2637.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO295656.009e-2448.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO324922.505e-2127.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO426732.475e-2021.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of cytoplasmic poly(A) binding protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pabpc1a4.364e-5053.04poly(A) binding protein cytoplasmic 1 [Source:NCBI... [more]
pabpc1b0.000e+051.69polyadenylate-binding protein 1-like [Source:NCBI ... [more]
pabpc40.000e+052.51poly(A) binding protein cytoplasmic 4 [Source:NCBI... [more]
pabpc1l6.162e-17565.09embryonic polyadenylate-binding protein [Source:NC... [more]
pabpc1l1.637e-17465.09embryonic polyadenylate-binding protein [Source:NC... [more]
back to top
BLAST of cytoplasmic poly(A) binding protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000004978.10.000e+0100.00SMESG000004978.1[more]
SMESG000058745.10.000e+048.95SMESG000058745.1[more]
SMESG000062663.12.644e-11846.65SMESG000062663.1[more]
SMESG000058799.18.222e-9042.70SMESG000058799.1[more]
SMESG000058799.18.807e-9042.70SMESG000058799.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30024486
GenBankADG08184.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024486 ID=SMED30024486|Name=cytoplasmic poly(A) binding protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2452bp
GTTTGTTTAATCGTGTCATCGGATATCCATATATAAGTTTCACTTTATTT
TAATAACGTACTTTCACTTAATAATTCAAAAATATATTTAAAAAAAGTAT
AAAAAGAGTAAAATGACTGCAGTTAACAATCAAATAAATAATTCTATTCC
GATGGCAAGTTTATATGTTGGCGATCTTCACCCAGAAGTTACAGAAGCTA
TGATATATGAGAAATTCTCATCTTGTGGTCCTGTTTTATCCATTAGAGTT
TGTAGAGATATGATCACAAGGAAATCATTGGGATATGCATATGTCAATTT
TCAAAATGCTGCAGATGCTGAATCAGCACTAGATCGAATGAATTTCGATA
CTATGAAAGGTCGTTCAATTAGAATAATGTGGTCACAACGTGATCCATCT
TTGCGAAAGTCAGGAATAGGAAACATTTTCATTAAAAATTTAGATAAGTC
AATTACACAAAAAGAATTACATGATACTTTTGTCGCCTTTGGTAACATTT
TATCTTGCAAAATTGCAGCGGATGAGCGTAGTAAATCTAAAGGATATGGT
TTCGTACATTTTGAAACTGAGGCTGCTGCAACTAACGCAATAGATGCTAT
TAACGGGATGCTTATAAAAAATAAAAAAGTATTTGTGGGACGTTTTATTC
CAAGAACAAATCGAGCTAATAGCGATAGCGATGTTAAATTTACGAATTGT
TACATAAAAAATTTTGGTGAAGACCTCGATGATGAAAAATTAAGAGAAAT
GTTTTTAGAATTTGGTGAAATAACTAGCGCTAAGGTAATGATTGATGAAA
ATGGAAAATCTAAGGGATTCGGATTTGTATGCTTTAAAGATTCTGAAACT
GCTGAGTCTGCTGTGAAAGCTTTAAACGGCAAGATGTTTAAAGATCGTCA
GTTGTATGTTGGTAGAGCTCAGAAAAAAAATGAACGATTAGATGAATTGC
GTTCTCATTTTGAAAAACAAAGAGCAGAACGTAGTTCTCGATACACTCAA
GGTGTAAATCTTTATGTAAAAAATCTTGATGATTCTATCGATGATACAAG
ATTGAAGCAAGAATTTGTAGTTTTTGGTAATATAACAAGCGCGAAAGTCA
TGACTGATTCAAATAATCGGTCAAAGGGATTTGGATTTGTATGCTTTTCA
AACCCAGAAGAAGCCACCAAAGCTGTTACGGAAATGAATGGGAAAATTTG
TGGAAGTAAACCACTTTATGTAGCCCTTGCTCAAAGAAAAGAAGACCGTA
AAGCGCATCTTGCGTCTCAATATATGCAAAGAGTTAATCCTCATCGTAAC
AATTATCCCAATCAAGTCTCAGTTAATACCCTTATATCTGGTGGACCTCC
TGGGGGACCCTCCATTTTGCCATATGCTTTTGCACCAAATGCTTCTACTC
CACGTGTCTATACTCAAAGTGCGGCATTTATGCCACCTCAAAATCGTTGG
TCTAATCGAATGCACCCGAGTCAGTTACAATTCAACGGTGGCAATATGAG
GCAATTGGCAAATGCTCACTTCGGAAATATGGAAGGCTCATCGGTGCCCA
TTCAGAATAACACAATGGGAATGCAAGCAAATCAAATTAGACAGGTATCA
ATGATCCCTAATCAACGACCAATGCTAAGTAACAATGCCAATGTTTCGGC
ATCTAACGTAATGATGAATGGTGTGGCAAATACTGTTAAATCTGCTCCTC
AAAATAGCCGTCCAATTACTGGTGTTCAAATGCCAATCACGTCGCAAGCT
AGTAATATTAGCCAACAAAGACCTCCTAATCAACCAACTAGACAAATTAC
AGGTCAATCTGTAATTTCTGGAAATCAAAATGTCAATAGACCGATTAACA
ATGGCTCCAATCAACTGGTTTCAGGAAACTTAGAGCCCCTGACAATTTCA
ACTCTGGCATCTGCTCCAATTGCTGAACAAAAGCAAATGCTTGGAGAACG
ATTATACCCATTAGTGCATAGAATGTATCCAGAATTAGCCGGAAAAATTA
CTGGAATGCTTCTTGAAATTGATAACACCGAATTGCTTCATATGCTGGAA
TCTGAGGATTCTTTGACTACAAAAATAGAAGAAGCCATGAATGTTCTGCA
GTCTCATAAAAATCAAAATGTTATAGTCACTGATATGGGACAAGGGCTTC
CTAAACAGCAAACTGGCAGTAAAGTCGCTGCTAATTAATTTCGTTTGTTT
TTTTATTTTTCAAATTGATAGTATTATATCTGAGGTCGTTTTATCGATCG
CGTCTTTATATTTCAAAAATTCTAAAAAAAATAGTTAAAATTTTGTTAAT
GTTGGATTATTACTATTATTATTATTTTGATTTTGTCGGTTGAGTTATTA
ATATTTGTTATTGTTTTTATCAAAATTAATTTGTTTTTTTCGAGCGGTGT
ATTGATGGAAGAGATTCCAGCTCTATAAGGAAGATTTTGTTTAAGATAGT
GG
back to top

protein sequence of SMED30024486-orf-1

>SMED30024486-orf-1 ID=SMED30024486-orf-1|Name=SMED30024486-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=692bp
MTAVNNQINNSIPMASLYVGDLHPEVTEAMIYEKFSSCGPVLSIRVCRDM
ITRKSLGYAYVNFQNAADAESALDRMNFDTMKGRSIRIMWSQRDPSLRKS
GIGNIFIKNLDKSITQKELHDTFVAFGNILSCKIAADERSKSKGYGFVHF
ETEAAATNAIDAINGMLIKNKKVFVGRFIPRTNRANSDSDVKFTNCYIKN
FGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESA
VKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNL
YVKNLDDSIDDTRLKQEFVVFGNITSAKVMTDSNNRSKGFGFVCFSNPEE
ATKAVTEMNGKICGSKPLYVALAQRKEDRKAHLASQYMQRVNPHRNNYPN
QVSVNTLISGGPPGGPSILPYAFAPNASTPRVYTQSAAFMPPQNRWSNRM
HPSQLQFNGGNMRQLANAHFGNMEGSSVPIQNNTMGMQANQIRQVSMIPN
QRPMLSNNANVSASNVMMNGVANTVKSAPQNSRPITGVQMPITSQASNIS
QQRPPNQPTRQITGQSVISGNQNVNRPINNGSNQLVSGNLEPLTISTLAS
APIAEQKQMLGERLYPLVHRMYPELAGKITGMLLEIDNTELLHMLESEDS
LTTKIEEAMNVLQSHKNQNVIVTDMGQGLPKQQTGSKVAAN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000074oocyte
PLANA:0000208testis
PLANA:0000221spermatocyte
PLANA:0000222spermatid
PLANA:0000231vitelline gland
PLANA:0000239oogonial cell
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR006515PABP_1234
IPR035979RBD_domain_sf
IPR036053PABP-dom
IPR000504RRM_dom
IPR003954RRM_dom_euk
IPR012677Nucleotide-bd_a/b_plait_sf
IPR002004PABP_HYD
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0003676nucleic acid binding
GO:0000166nucleotide binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 648..668
NoneNo IPR availableCOILSCoilCoilcoord: 269..289
NoneNo IPR availableGENE3DG3DSA:1.10.1900.10coord: 588..676
e-value: 4.4E-36
score: 124.7
NoneNo IPR availablePANTHERPTHR24012RNA BINDING PROTEINcoord: 11..672
NoneNo IPR availablePANTHERPTHR24012:SF409POLYADENYLATE-BINDING PROTEIN 1coord: 11..672
NoneNo IPR availableCDDcd12380RRM3_I_PABPscoord: 193..272
e-value: 9.34135E-43
score: 146.95
NoneNo IPR availableCDDcd12378RRM1_I_PABPscoord: 16..95
e-value: 1.0969E-50
score: 168.481
NoneNo IPR availableCDDcd12379RRM2_I_PABPscoord: 101..177
e-value: 8.15456E-45
score: 152.32
NoneNo IPR availableCDDcd12381RRM4_I_PABPscoord: 297..375
e-value: 2.64389E-52
score: 173.189
IPR000504RNA recognition motif domainSMARTSM00360rrm1_1coord: 195..267
e-value: 8.9E-26
score: 101.6
coord: 104..176
e-value: 1.7E-22
score: 90.7
coord: 16..89
e-value: 6.1E-21
score: 85.6
coord: 299..371
e-value: 3.0E-24
score: 96.6
IPR000504RNA recognition motif domainPFAMPF00076RRM_1coord: 105..173
e-value: 1.0E-19
score: 70.1
coord: 300..368
e-value: 2.6E-18
score: 65.6
coord: 197..264
e-value: 2.3E-21
score: 75.4
coord: 17..87
e-value: 2.2E-19
score: 69.0
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 194..271
score: 19.638
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 103..180
score: 17.643
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 15..93
score: 16.995
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 298..375
score: 18.137
IPR002004Polyadenylate-binding protein/Hyperplastic disc proteinSMARTSM00517poly_2coord: 602..665
e-value: 1.6E-35
score: 134.0
IPR002004Polyadenylate-binding protein/Hyperplastic disc proteinPFAMPF00658PABPcoord: 596..662
e-value: 1.5E-28
score: 98.8
IPR002004Polyadenylate-binding protein/Hyperplastic disc proteinPROSITEPS51309PABCcoord: 590..667
score: 22.108
IPR003954RNA recognition motif domain, eukaryoteSMARTSM00361rrm2_1coord: 299..371
e-value: 3.2
score: 9.0
coord: 195..267
e-value: 0.6
score: 16.4
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 184..281
e-value: 3.0E-26
score: 93.9
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 3..96
e-value: 2.0E-24
score: 88.4
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 97..183
e-value: 7.5E-22
score: 79.4
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 282..385
e-value: 5.7E-27
score: 96.0
IPR006515Polyadenylate binding protein, human types 1, 2, 3, 4TIGRFAMTIGR01628TIGR01628coord: 15..663
e-value: 2.0E-221
score: 735.2
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 194..379
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 14..183
IPR036053PABC (PABP) domainSUPERFAMILYSSF63570PABC (PABP) domaincoord: 550..668