SMED30024482

Overview
NameSMED30024482
Smed IDSMED30024482
Length (bp)511
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30024482 (SMED30024482) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30024482 (SMED30024482) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024482

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30024482SMESG000046205.1 dd_Smed_v6_26877_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30024482 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.008805:18727..19237 -2555
v31.006765:17816..18326 -2519
Homology
BLAST of SMED30024482 vs. Ensembl Human
Match: ATOH1 (atonal bHLH transcription factor 1 [Source:HGNC Symbol;Acc:HGNC:797])

HSP 1 Score: 76.6406 bits (187), Expect = 1.935e-16
Identity = 35/57 (61.40%), Postives = 45/57 (78.95%), Query Frame = -2
Query:    7 KRTAANDRERKRMYCLNRAFDQLRDVVPYSSNQKKMSKFETLLMAQTYIETLVEMLE 177
            +R AAN RER+RM+ LN AFDQLR+V+P  +N KK+SK+ETL MAQ YI  L E+L+
Sbjct:  160 RRLAANARERRRMHGLNHAFDQLRNVIPSFNNDKKLSKYETLQMAQIYINALSELLQ 216          
BLAST of SMED30024482 vs. Ensembl Human
Match: FERD3L (Fer3 like bHLH transcription factor [Source:HGNC Symbol;Acc:HGNC:16660])

HSP 1 Score: 62.3882 bits (150), Expect = 4.067e-12
Identity = 31/58 (53.45%), Postives = 42/58 (72.41%), Query Frame = -2
Query:    4 KRTAANDRERKRMYCLNRAFDQLRDVVPYSSNQKKMSKFETLLMAQTYIETLVEMLEN 177
            +R AAN RERKRM+ LN AFDQLR  VP  + +K++S+ ETL +A  YI  + E+LE+
Sbjct:  102 QRQAANIRERKRMFNLNEAFDQLRRKVPTFAYEKRLSRIETLRLAIVYISFMTELLES 159          
BLAST of SMED30024482 vs. Ensembl Human
Match: BHLHA15 (basic helix-loop-helix family member a15 [Source:HGNC Symbol;Acc:HGNC:22265])

HSP 1 Score: 60.4622 bits (145), Expect = 2.647e-11
Identity = 26/56 (46.43%), Postives = 40/56 (71.43%), Query Frame = -2
Query:   10 KRTAANDRERKRMYCLNRAFDQLRDVVPYSSNQKKMSKFETLLMAQTYIETLVEML 177
            +R  +N+RER+RM+ LN AF  LR+V+P+    KK+SK ETL +A+ YI++L   +
Sbjct:   76 RRLESNERERQRMHKLNNAFQALREVIPHVRADKKLSKIETLTLAKNYIKSLTATI 131          
BLAST of SMED30024482 vs. Ensembl Human
Match: BHLHA15 (basic helix-loop-helix family member a15 [Source:HGNC Symbol;Acc:HGNC:22265])

HSP 1 Score: 60.4622 bits (145), Expect = 2.647e-11
Identity = 26/56 (46.43%), Postives = 40/56 (71.43%), Query Frame = -2
Query:   10 KRTAANDRERKRMYCLNRAFDQLRDVVPYSSNQKKMSKFETLLMAQTYIETLVEML 177
            +R  +N+RER+RM+ LN AF  LR+V+P+    KK+SK ETL +A+ YI++L   +
Sbjct:   76 RRLESNERERQRMHKLNNAFQALREVIPHVRADKKLSKIETLTLAKNYIKSLTATI 131          
BLAST of SMED30024482 vs. Ensembl Human
Match: NEUROD1 (neuronal differentiation 1 [Source:HGNC Symbol;Acc:HGNC:7762])

HSP 1 Score: 59.6918 bits (143), Expect = 1.890e-10
Identity = 30/57 (52.63%), Postives = 38/57 (66.67%), Query Frame = -2
Query:   10 IKRTAANDRERKRMYCLNRAFDQLRDVVPYSSNQKKMSKFETLLMAQTYIETLVEML 180
            ++R  AN RER RM+ LN A D LR VVP  S  +K+SK ETL +A+ YI  L E+L
Sbjct:  101 LRRMKANARERNRMHGLNAALDNLRKVVPCYSKTQKLSKIETLRLAKNYIWALSEIL 157          
BLAST of SMED30024482 vs. Ensembl Celegans
Match: lin-32 (pep chromosome:WBcel235:X:2229208:2230122:-1 gene:WBGene00003018.1 transcript:T14F9.5.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lin-32)

HSP 1 Score: 69.707 bits (169), Expect = 1.313e-15
Identity = 33/58 (56.90%), Postives = 47/58 (81.03%), Query Frame = -2
Query:    7 IKRTAANDRERKRMYCLNRAFDQLRDVVPYSSNQKKMSKFETLLMAQTYIETLVEMLE 180
            ++R+AAN+RER+RM  LN A+D+LR+V+P   + KK+SKFETL MAQ YIE L ++L+
Sbjct:   72 MRRSAANERERRRMNTLNVAYDELREVLPEIDSGKKLSKFETLQMAQKYIECLSQILK 129          
BLAST of SMED30024482 vs. Ensembl Celegans
Match: cnd-1 (Neurogenic differentiation factor 1 [Source:UniProtKB/Swiss-Prot;Acc:P46581])

HSP 1 Score: 64.3142 bits (155), Expect = 5.257e-13
Identity = 31/71 (43.66%), Postives = 47/71 (66.20%), Query Frame = -2
Query:    7 SNNQPTQLTKSNPIKRTAANDRERKRMYCLNRAFDQLRDVVPYSSNQKKMSKFETLLMAQTYIETLVEMLE 219
            SN  P +++K   ++R  AN RER RM+ LN A D LR+ +P ++  +K+SK ETL +A+ YI+ L  ML+
Sbjct:    7 SNFAPAEISKRK-VRRVKANGRERARMHGLNNALDMLREYIPITTQHQKLSKIETLRLARNYIDALQRMLQ 76          
BLAST of SMED30024482 vs. Ensembl Celegans
Match: ngn-1 (NeuroGeNin [Source:UniProtKB/TrEMBL;Acc:Q95XG7])

HSP 1 Score: 55.0694 bits (131), Expect = 1.141e-9
Identity = 26/62 (41.94%), Postives = 39/62 (62.90%), Query Frame = -2
Query:   22 PTQLTKSNPIKRTAANDRERKRMYCLNRAFDQLRDVVPYSSNQKKMSKFETLLMAQTYIETL 207
            P  + ++  ++R  AN RER+RM  LN A + LR ++P   ++ KM+K ETL  AQ YI +L
Sbjct:   53 PATIERAKTVRRDKANARERRRMNSLNDALEHLRGILPALPDEPKMTKIETLRKAQEYIASL 114          
BLAST of SMED30024482 vs. Ensembl Celegans
Match: hlh-32 (Helix Loop Helix [Source:UniProtKB/TrEMBL;Acc:Q7YWS9])

HSP 1 Score: 52.7582 bits (125), Expect = 2.221e-9
Identity = 27/60 (45.00%), Postives = 38/60 (63.33%), Query Frame = -2
Query:   31 TQLTKSNPIKRTAANDRERKRMYCLNRAFDQLRDVVPYSSNQ--KKMSKFETLLMAQTYI 204
            + LT + P  R + N RER RM+ LN A D LR V+PY+     +K+SK  TLL+A+ +I
Sbjct:    6 SDLTFAEPGVRLSINLRERCRMHDLNEALDDLRAVIPYAHGGSVRKLSKIATLLLAKNHI 65          
BLAST of SMED30024482 vs. Ensembl Celegans
Match: hlh-17 (Helix Loop Helix [Source:UniProtKB/TrEMBL;Acc:O45489])

HSP 1 Score: 50.0618 bits (118), Expect = 1.957e-8
Identity = 25/55 (45.45%), Postives = 35/55 (63.64%), Query Frame = -2
Query:   31 SNPIKRTAANDRERKRMYCLNRAFDQLRDVVPYSSNQ--KKMSKFETLLMAQTYI 189
            + P  R + N RER RM+ LN A D LR V+PY+     +K+SK  TLL+A+ +I
Sbjct:   11 AEPGVRLSINLRERCRMHDLNEALDDLRAVIPYAHGGSVRKLSKIATLLLAKNHI 65          
BLAST of SMED30024482 vs. Ensembl Fly
Match: cato (gene:FBgn0024249 transcript:FBtr0087183)

HSP 1 Score: 70.8626 bits (172), Expect = 2.024e-15
Identity = 35/58 (60.34%), Postives = 44/58 (75.86%), Query Frame = -2
Query:    4 KRTAANDRERKRMYCLNRAFDQLRDVVPYSSNQKKMSKFETLLMAQTYIETLVEMLEN 177
            +R AAN RERKRM  LN AF++LR+VVP  S  +K+SKFETL MAQ+YI  L ++L N
Sbjct:  104 RRQAANARERKRMNGLNAAFERLREVVPAPSIDQKLSKFETLQMAQSYILALCDLLNN 161          
BLAST of SMED30024482 vs. Ensembl Fly
Match: amos (gene:FBgn0003270 transcript:FBtr0081081)

HSP 1 Score: 68.9366 bits (167), Expect = 1.273e-14
Identity = 33/56 (58.93%), Postives = 42/56 (75.00%), Query Frame = -2
Query:   10 KRTAANDRERKRMYCLNRAFDQLRDVVPYSSNQKKMSKFETLLMAQTYIETLVEML 177
            +R AAN RER+RM  LN AFD+LRDVVP   + +++SK+ETL MAQ YI  LV +L
Sbjct:  139 RRLAANARERRRMNSLNDAFDKLRDVVPSLGHDRRLSKYETLQMAQAYIGDLVTLL 194          
BLAST of SMED30024482 vs. Ensembl Fly
Match: ato (gene:FBgn0010433 transcript:FBtr0081828)

HSP 1 Score: 63.929 bits (154), Expect = 2.317e-12
Identity = 31/56 (55.36%), Postives = 41/56 (73.21%), Query Frame = -2
Query:   10 KRTAANDRERKRMYCLNRAFDQLRDVVPYSSNQKKMSKFETLLMAQTYIETLVEML 177
            +R AAN RER+RM  LN+AFD+LR  +P   N +++SK ETL MAQTYI  L ++L
Sbjct:  256 RRLAANARERRRMQNLNQAFDRLRQYLPCLGNDRQLSKHETLQMAQTYISALGDLL 311          
BLAST of SMED30024482 vs. Ensembl Fly
Match: Fer3 (gene:FBgn0037937 transcript:FBtr0082435)

HSP 1 Score: 60.8474 bits (146), Expect = 1.330e-11
Identity = 29/58 (50.00%), Postives = 41/58 (70.69%), Query Frame = -2
Query:    4 KRTAANDRERKRMYCLNRAFDQLRDVVPYSSNQKKMSKFETLLMAQTYIETLVEMLEN 177
            +R AAN RER+RM+ LN AFD+LR  VP  + +K++S+ ETL +A TYI  + E+L  
Sbjct:   87 QRRAANIRERRRMFNLNEAFDKLRRKVPTFAYEKRLSRIETLRLAITYIGFMAELLSG 144          
BLAST of SMED30024482 vs. Ensembl Fly
Match: dimm (gene:FBgn0023091 transcript:FBtr0333354)

HSP 1 Score: 58.151 bits (139), Expect = 3.418e-10
Identity = 24/57 (42.11%), Postives = 40/57 (70.18%), Query Frame = -2
Query:   10 IKRTAANDRERKRMYCLNRAFDQLRDVVPYSSNQKKMSKFETLLMAQTYIETLVEML 180
            ++R  +N+RER RM+ LN AF  LR+V+P+   ++++SK ETL +A+ YI  L  ++
Sbjct:  156 MRRLESNERERMRMHSLNDAFQSLREVIPHVEMERRLSKIETLTLAKNYIINLTHII 212          
BLAST of SMED30024482 vs. Ensembl Zebrafish
Match: atoh1b (atonal bHLH transcription factor 1b [Source:ZFIN;Acc:ZDB-GENE-041201-1])

HSP 1 Score: 79.337 bits (194), Expect = 2.255e-18
Identity = 39/79 (49.37%), Postives = 55/79 (69.62%), Query Frame = -2
Query:    4 NYCNSNNQP-TQLTKSNP--IKRTAANDRERKRMYCLNRAFDQLRDVVPYSSNQKKMSKFETLLMAQTYIETLVEMLEN 231
            ++  S  +P ++ + S P   +R AAN RER+RM+ LNRAFD+LR V+P   N+KK+SK++TL MAQ YI  L E+LE 
Sbjct:   73 HHAGSKARPGSKASVSGPQRHRRVAANARERRRMHGLNRAFDKLRSVIPSLENEKKLSKYDTLQMAQIYITELSELLEG 151          
BLAST of SMED30024482 vs. Ensembl Zebrafish
Match: AL807792.2 (pep chromosome:GRCz11:CHR_ALT_CTG8_2_5:29594098:29599935:1 gene:ENSDARG00000110597.1 transcript:ENSDART00000185012.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:AL807792.2)

HSP 1 Score: 73.9442 bits (180), Expect = 7.341e-16
Identity = 33/58 (56.90%), Postives = 43/58 (74.14%), Query Frame = -2
Query:    4 KRTAANDRERKRMYCLNRAFDQLRDVVPYSSNQKKMSKFETLLMAQTYIETLVEMLEN 177
            +R AAN RER+RM+ LN AFD+LR V+P   N KK+SK+ETL MAQ YI  L ++L+ 
Sbjct:  119 RRMAANARERRRMHGLNHAFDELRSVIPAFDNDKKLSKYETLQMAQIYINALSDLLQG 176          
BLAST of SMED30024482 vs. Ensembl Zebrafish
Match: AL807792.3 (pep chromosome:GRCz11:CHR_ALT_CTG8_1_14:29595591:29601428:1 gene:ENSDARG00000111472.1 transcript:ENSDART00000192184.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:AL807792.3)

HSP 1 Score: 73.9442 bits (180), Expect = 7.341e-16
Identity = 33/58 (56.90%), Postives = 43/58 (74.14%), Query Frame = -2
Query:    4 KRTAANDRERKRMYCLNRAFDQLRDVVPYSSNQKKMSKFETLLMAQTYIETLVEMLEN 177
            +R AAN RER+RM+ LN AFD+LR V+P   N KK+SK+ETL MAQ YI  L ++L+ 
Sbjct:  119 RRMAANARERRRMHGLNHAFDELRSVIPAFDNDKKLSKYETLQMAQIYINALSDLLQG 176          
BLAST of SMED30024482 vs. Ensembl Zebrafish
Match: atoh1a (atonal bHLH transcription factor 1a [Source:ZFIN;Acc:ZDB-GENE-990415-17])

HSP 1 Score: 73.9442 bits (180), Expect = 8.635e-16
Identity = 33/58 (56.90%), Postives = 43/58 (74.14%), Query Frame = -2
Query:    4 KRTAANDRERKRMYCLNRAFDQLRDVVPYSSNQKKMSKFETLLMAQTYIETLVEMLEN 177
            +R AAN RER+RM+ LN AFD+LR V+P   N KK+SK+ETL MAQ YI  L ++L+ 
Sbjct:  119 RRMAANARERRRMHGLNHAFDELRSVIPAFDNDKKLSKYETLQMAQIYINALSDLLQG 176          
BLAST of SMED30024482 vs. Ensembl Zebrafish
Match: ferd3l (Fer3-like bHLH transcription factor [Source:ZFIN;Acc:ZDB-GENE-081104-461])

HSP 1 Score: 62.003 bits (149), Expect = 5.006e-13
Identity = 31/70 (44.29%), Postives = 47/70 (67.14%), Query Frame = -2
Query:    7 NNQPTQLTKSNPIKRTAANDRERKRMYCLNRAFDQLRDVVPYSSNQKKMSKFETLLMAQTYIETLVEMLE 216
            N +P +    + ++R AAN RERKRM+ LN AFD+LR  VP  + +K++S+ ETL +A  YI  + ++LE
Sbjct:   12 NMKPKRKRVISTVQRQAANIRERKRMFSLNEAFDRLRRRVPTFAYEKRLSRIETLRLAIVYIAFMTDILE 81          
BLAST of SMED30024482 vs. Ensembl Xenopus
Match: ATOH1 (atonal bHLH transcription factor 1 [Source:NCBI gene;Acc:100488309])

HSP 1 Score: 74.7146 bits (182), Expect = 3.650e-16
Identity = 34/57 (59.65%), Postives = 45/57 (78.95%), Query Frame = -2
Query:    7 KRTAANDRERKRMYCLNRAFDQLRDVVPYSSNQKKMSKFETLLMAQTYIETLVEMLE 177
            +R AAN RER+RM+ LN AFDQLR+V+P  +N KK+SK+ETL MAQ YI  L ++L+
Sbjct:  108 RRLAANARERRRMHGLNHAFDQLRNVIPSFNNDKKLSKYETLQMAQIYINALSDLLQ 164          
BLAST of SMED30024482 vs. Ensembl Xenopus
Match: st6gal1 (ST6 beta-galactosamide alpha-2,6-sialyltranferase 1 [Source:Xenbase;Acc:XB-GENE-983202])

HSP 1 Score: 71.2478 bits (173), Expect = 4.905e-16
Identity = 43/92 (46.74%), Postives = 53/92 (57.61%), Query Frame = -2
Query:    7 NLVESENVSFDIVGEMANYCNSNNQPTQLTKSNPIKRTAANDRERKRMYCLNRAFDQLRDVVPYSSNQKKMSKFETLLMAQTYIETLVEMLE 282
            +L  S   S DI+G   N C        L +S    R AAN RERKRM  LN AFD+LR V+P + N+KK+SK ETL MA+ YI  L   L+
Sbjct:   13 HLSLSHRKSHDIIGYSQNIC-------ALRQSKKSCRLAANARERKRMLSLNLAFDRLRSVIPTTQNKKKLSKSETLQMAKIYILMLSTELQ 97          
BLAST of SMED30024482 vs. Ensembl Xenopus
Match: znf423 (zinc finger protein 423 [Source:Xenbase;Acc:XB-GENE-490169])

HSP 1 Score: 62.7734 bits (151), Expect = 2.709e-12
Identity = 31/79 (39.24%), Postives = 48/79 (60.76%), Query Frame = -2
Query:    4 EMANYCNSNNQPTQLTKSNPIKRTAANDRERKRMYCLNRAFDQLRDVVPYSSNQKKMSKFETLLMAQTYIETLVEMLEN 240
            E+    +   + T   K +  +R  +N+RER+RM+ LN AF  LR+V+P+   +KK+SK ETL +A+ YI TL   + N
Sbjct:   46 ELVKLTSKKKRETANGKEHSTRRLESNERERQRMHKLNNAFQALREVIPHVRAEKKLSKIETLTLAKNYINTLTATILN 124          
BLAST of SMED30024482 vs. Ensembl Xenopus
Match: ferd3l (Fer3-like bHLH transcription factor [Source:NCBI gene;Acc:100124312])

HSP 1 Score: 61.6178 bits (148), Expect = 3.091e-12
Identity = 31/58 (53.45%), Postives = 41/58 (70.69%), Query Frame = -2
Query:    4 KRTAANDRERKRMYCLNRAFDQLRDVVPYSSNQKKMSKFETLLMAQTYIETLVEMLEN 177
            +R AAN RERKRM+ LN AFD LR  VP  + +K++S+ ETL +A  YI  + EML+N
Sbjct:   66 QRQAANIRERKRMFNLNEAFDLLRKKVPTFAYEKRLSRIETLRLAIVYISFMTEMLKN 123          
BLAST of SMED30024482 vs. Ensembl Xenopus
Match: ppil6 (peptidylprolyl isomerase like 6 [Source:Xenbase;Acc:XB-GENE-979458])

HSP 1 Score: 61.6178 bits (148), Expect = 4.297e-12
Identity = 37/77 (48.05%), Postives = 45/77 (58.44%), Query Frame = -2
Query:   10 EMANYCNSNNQPTQLTKSNPIKRTAANDRERKRMYCLNRAFDQLRDVVPYSSNQKKMSKFETLLMAQTYIETLVEML 240
            E  + C     P +L  S   +R AAN RER+RM  LN AFD LR VVP     KK+SK+ETL MA +YI  L  +L
Sbjct:   15 ECQSPCPLRCMPVRLEGST-KRRMAANARERRRMQGLNTAFDSLRKVVPQWGEDKKLSKYETLQMALSYIMALNRIL 90          
BLAST of SMED30024482 vs. Ensembl Mouse
Match: Atoh1 (atonal bHLH transcription factor 1 [Source:MGI Symbol;Acc:MGI:104654])

HSP 1 Score: 76.6406 bits (187), Expect = 1.266e-16
Identity = 35/57 (61.40%), Postives = 45/57 (78.95%), Query Frame = -2
Query:    7 KRTAANDRERKRMYCLNRAFDQLRDVVPYSSNQKKMSKFETLLMAQTYIETLVEMLE 177
            +R AAN RER+RM+ LN AFDQLR+V+P  +N KK+SK+ETL MAQ YI  L E+L+
Sbjct:  157 RRLAANARERRRMHGLNHAFDQLRNVIPSFNNDKKLSKYETLQMAQIYINALSELLQ 213          
BLAST of SMED30024482 vs. Ensembl Mouse
Match: Ferd3l (Fer3 like bHLH transcription factor [Source:MGI Symbol;Acc:MGI:2150010])

HSP 1 Score: 61.2326 bits (147), Expect = 8.104e-12
Identity = 30/58 (51.72%), Postives = 42/58 (72.41%), Query Frame = -2
Query:    4 KRTAANDRERKRMYCLNRAFDQLRDVVPYSSNQKKMSKFETLLMAQTYIETLVEMLEN 177
            +R AAN RERKRM+ LN AFDQLR  VP  + +K++S+ ETL +A  YI  + E+L++
Sbjct:  104 QRQAANIRERKRMFNLNEAFDQLRRKVPTFAYEKRLSRIETLRLAIVYISFMTELLQS 161          
BLAST of SMED30024482 vs. Ensembl Mouse
Match: Bhlha15 (basic helix-loop-helix family, member a15 [Source:MGI Symbol;Acc:MGI:891976])

HSP 1 Score: 60.4622 bits (145), Expect = 2.694e-11
Identity = 26/53 (49.06%), Postives = 39/53 (73.58%), Query Frame = -2
Query:   19 KRTAANDRERKRMYCLNRAFDQLRDVVPYSSNQKKMSKFETLLMAQTYIETLV 177
            +R  +N+RER+RM+ LN AF  LR+V+P+    KK+SK ETL +A+ YI++L 
Sbjct:   73 RRLESNERERQRMHKLNNAFQALREVIPHVRADKKLSKIETLTLAKNYIKSLT 125          
BLAST of SMED30024482 vs. Ensembl Mouse
Match: Neurod1 (neurogenic differentiation 1 [Source:MGI Symbol;Acc:MGI:1339708])

HSP 1 Score: 59.6918 bits (143), Expect = 1.227e-10
Identity = 30/57 (52.63%), Postives = 38/57 (66.67%), Query Frame = -2
Query:   10 IKRTAANDRERKRMYCLNRAFDQLRDVVPYSSNQKKMSKFETLLMAQTYIETLVEML 180
            ++R  AN RER RM+ LN A D LR VVP  S  +K+SK ETL +A+ YI  L E+L
Sbjct:  101 LRRMKANARERNRMHGLNAALDNLRKVVPCYSKTQKLSKIETLRLAKNYIWALSEIL 157          
BLAST of SMED30024482 vs. Ensembl Mouse
Match: Neurod4 (neurogenic differentiation 4 [Source:MGI Symbol;Acc:MGI:108055])

HSP 1 Score: 58.9214 bits (141), Expect = 2.424e-10
Identity = 30/57 (52.63%), Postives = 38/57 (66.67%), Query Frame = -2
Query:    7 KRTAANDRERKRMYCLNRAFDQLRDVVPYSSNQKKMSKFETLLMAQTYIETLVEMLE 177
            +R  AN RER RM+ LN A D LR V+P  S  +K+SK ETL +A+ YI  L E+LE
Sbjct:   88 RRVKANARERTRMHGLNDALDNLRRVMPCYSKTQKLSKIETLRLARNYIWALSEVLE 144          
BLAST of SMED30024482 vs. UniProt/SwissProt
Match: sp|P48985|ATOH1_MOUSE (Protein atonal homolog 1 OS=Mus musculus OX=10090 GN=Atoh1 PE=1 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 8.856e-16
Identity = 35/57 (61.40%), Postives = 45/57 (78.95%), Query Frame = -2
Query:    7 KRTAANDRERKRMYCLNRAFDQLRDVVPYSSNQKKMSKFETLLMAQTYIETLVEMLE 177
            +R AAN RER+RM+ LN AFDQLR+V+P  +N KK+SK+ETL MAQ YI  L E+L+
Sbjct:  157 RRLAANARERRRMHGLNHAFDQLRNVIPSFNNDKKLSKYETLQMAQIYINALSELLQ 213          
BLAST of SMED30024482 vs. UniProt/SwissProt
Match: sp|Q92858|ATOH1_HUMAN (Protein atonal homolog 1 OS=Homo sapiens OX=9606 GN=ATOH1 PE=2 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 9.293e-16
Identity = 35/57 (61.40%), Postives = 45/57 (78.95%), Query Frame = -2
Query:    7 KRTAANDRERKRMYCLNRAFDQLRDVVPYSSNQKKMSKFETLLMAQTYIETLVEMLE 177
            +R AAN RER+RM+ LN AFDQLR+V+P  +N KK+SK+ETL MAQ YI  L E+L+
Sbjct:  160 RRLAANARERRRMHGLNHAFDQLRNVIPSFNNDKKLSKYETLQMAQIYINALSELLQ 216          
BLAST of SMED30024482 vs. UniProt/SwissProt
Match: sp|Q5IS79|ATOH1_PANTR (Protein atonal homolog 1 OS=Pan troglodytes OX=9598 GN=ATOH1 PE=2 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 9.784e-16
Identity = 35/57 (61.40%), Postives = 45/57 (78.95%), Query Frame = -2
Query:    7 KRTAANDRERKRMYCLNRAFDQLRDVVPYSSNQKKMSKFETLLMAQTYIETLVEMLE 177
            +R AAN RER+RM+ LN AFDQLR+V+P  +N KK+SK+ETL MAQ YI  L E+L+
Sbjct:  162 RRLAANARERRRMHGLNHAFDQLRNVIPSFNNDKKLSKYETLQMAQIYINALSELLQ 218          
BLAST of SMED30024482 vs. UniProt/SwissProt
Match: sp|Q10574|LIN32_CAEEL (Protein lin-32 OS=Caenorhabditis elegans OX=6239 GN=lin-32 PE=1 SV=2)

HSP 1 Score: 69.707 bits (169), Expect = 1.670e-14
Identity = 33/58 (56.90%), Postives = 47/58 (81.03%), Query Frame = -2
Query:    7 IKRTAANDRERKRMYCLNRAFDQLRDVVPYSSNQKKMSKFETLLMAQTYIETLVEMLE 180
            ++R+AAN+RER+RM  LN A+D+LR+V+P   + KK+SKFETL MAQ YIE L ++L+
Sbjct:   72 MRRSAANERERRRMNTLNVAYDELREVLPEIDSGKKLSKFETLQMAQKYIECLSQILK 129          
BLAST of SMED30024482 vs. UniProt/SwissProt
Match: sp|Q9Y0A7|AMOS_DROME (Basic helix-loop-helix transcription factor amos OS=Drosophila melanogaster OX=7227 GN=amos PE=1 SV=2)

HSP 1 Score: 68.9366 bits (167), Expect = 1.276e-13
Identity = 33/56 (58.93%), Postives = 42/56 (75.00%), Query Frame = -2
Query:   10 KRTAANDRERKRMYCLNRAFDQLRDVVPYSSNQKKMSKFETLLMAQTYIETLVEML 177
            +R AAN RER+RM  LN AFD+LRDVVP   + +++SK+ETL MAQ YI  LV +L
Sbjct:  139 RRLAANARERRRMNSLNDAFDKLRDVVPSLGHDRRLSKYETLQMAQAYIGDLVTLL 194          
BLAST of SMED30024482 vs. TrEMBL
Match: H6V051 (Atonal OS=Schmidtea polychroa OX=50054 PE=2 SV=1)

HSP 1 Score: 155.606 bits (392), Expect = 2.514e-46
Identity = 74/79 (93.67%), Postives = 77/79 (97.47%), Query Frame = -2
Query:    4 EMANYCNSNNQPTQLTKSNPIKRTAANDRERKRMYCLNRAFDQLRDVVPYSSNQKKMSKFETLLMAQTYIETLVEMLEN 240
            +MANYCNSN QP Q++KSNPIKRTAANDRERKRMYCLNRAFDQLRDVVPYSSNQKKMSKFETLLMAQTYIETLVEMLEN
Sbjct:    8 KMANYCNSNKQPCQVSKSNPIKRTAANDRERKRMYCLNRAFDQLRDVVPYSSNQKKMSKFETLLMAQTYIETLVEMLEN 86          
BLAST of SMED30024482 vs. TrEMBL
Match: Q8JHA1 (BHLH transcription factor ath1 (Fragment) OS=Serinus canaria OX=9135 PE=2 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 8.713e-16
Identity = 35/57 (61.40%), Postives = 45/57 (78.95%), Query Frame = -2
Query:    7 KRTAANDRERKRMYCLNRAFDQLRDVVPYSSNQKKMSKFETLLMAQTYIETLVEMLE 177
            +R AAN RER+RM+ LN AFDQLR+V+P  +N KK+SK+ETL MAQ YI  L E+L+
Sbjct:    8 RRLAANARERRRMHGLNHAFDQLRNVIPSFNNDKKLSKYETLQMAQIYISALAELLQ 64          
BLAST of SMED30024482 vs. TrEMBL
Match: A0A140H4V5 (Atonal-like protein 1 (Fragment) OS=Scyliorhinus torazame OX=75743 GN=Atoh1c PE=2 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 1.423e-15
Identity = 40/82 (48.78%), Postives = 54/82 (65.85%), Query Frame = -2
Query:    4 IVGEMANYCNSNNQPTQLTKSNPIKRTAANDRERKRMYCLNRAFDQLRDVVPYSSNQKKMSKFETLLMAQTYIETLVEMLEN 249
            + G       ++ QPT+  K    +R AAN RER+RM+ LN AFD+LR V+P   N+KK+SK+ETL MAQ YI  L E+L+N
Sbjct:   25 LCGVKGQATPASRQPTEPPK---YRRLAANARERRRMHGLNHAFDELRSVIPAFDNEKKLSKYETLQMAQIYIAELTELLQN 103          
BLAST of SMED30024482 vs. TrEMBL
Match: T1INY9 (BHLH domain-containing protein OS=Strigamia maritima OX=126957 PE=4 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 2.409e-15
Identity = 39/72 (54.17%), Postives = 53/72 (73.61%), Query Frame = -2
Query:    7 NNQPTQLTKSNPIK--RTAANDRERKRMYCLNRAFDQLRDVVPYSSNQKKMSKFETLLMAQTYIETLVEMLE 216
            N +P +L  +N ++  R AAN RER+RM  LN AFD+LRDVVP   N +K+SK+ETL MAQ+YI  L+E+L+
Sbjct:   80 NQRPDKLPTANVMRKRRLAANARERRRMNSLNVAFDKLRDVVPSLGNDRKLSKYETLQMAQSYIAALLELLD 151          
BLAST of SMED30024482 vs. TrEMBL
Match: A0A0N5APG9 (BHLH domain-containing protein OS=Syphacia muris OX=451379 PE=4 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 2.624e-15
Identity = 37/59 (62.71%), Postives = 47/59 (79.66%), Query Frame = -2
Query:    4 IKRTAANDRERKRMYCLNRAFDQLRDVVPYSSNQKKMSKFETLLMAQTYIETLVEMLEN 180
            ++R AAN RERKRM CLN AFDQLR V+P  ++ K++SKFETL MAQ YI+ L +ML+N
Sbjct:   36 MRRQAANARERKRMNCLNEAFDQLRTVLPEMNSGKRLSKFETLQMAQHYIDCLAQMLKN 94          
BLAST of SMED30024482 vs. Ensembl Cavefish
Match: atoh1b (atonal bHLH transcription factor 1b [Source:ZFIN;Acc:ZDB-GENE-041201-1])

HSP 1 Score: 77.0258 bits (188), Expect = 2.263e-17
Identity = 35/58 (60.34%), Postives = 45/58 (77.59%), Query Frame = -2
Query:    4 KRTAANDRERKRMYCLNRAFDQLRDVVPYSSNQKKMSKFETLLMAQTYIETLVEMLEN 177
            +R AAN RER+RM+ LNRAFD+LR V+P   N+KK+SK++TL MAQ YI  L E+LE 
Sbjct:  103 RRVAANARERRRMHGLNRAFDKLRSVIPSLENEKKLSKYDTLQMAQIYIAELSELLEG 160          
BLAST of SMED30024482 vs. Ensembl Cavefish
Match: atoh1a (atonal bHLH transcription factor 1a [Source:ZFIN;Acc:ZDB-GENE-990415-17])

HSP 1 Score: 74.3294 bits (181), Expect = 2.924e-17
Identity = 33/56 (58.93%), Postives = 42/56 (75.00%), Query Frame = -2
Query:   10 KRTAANDRERKRMYCLNRAFDQLRDVVPYSSNQKKMSKFETLLMAQTYIETLVEML 177
            +R AAN RER+RM+ LN AFD+LR V+P   N KK+SK+ETL MAQ YI  L ++L
Sbjct:   23 RRIAANARERRRMHGLNHAFDELRSVIPALDNDKKLSKYETLQMAQIYISALADLL 78          
BLAST of SMED30024482 vs. Ensembl Cavefish
Match: atoh1c (atonal bHLH transcription factor 1c [Source:ZFIN;Acc:ZDB-GENE-090805-1])

HSP 1 Score: 68.5514 bits (166), Expect = 3.920e-15
Identity = 33/58 (56.90%), Postives = 42/58 (72.41%), Query Frame = -2
Query:    4 KRTAANDRERKRMYCLNRAFDQLRDVVPYSSNQKKMSKFETLLMAQTYIETLVEMLEN 177
            +R AAN RER+RM  LN AFD+LR V+P   + +K+SK ETL MAQ YI TL E+L+ 
Sbjct:   14 RRLAANARERRRMLGLNVAFDRLRSVIPNVESARKLSKSETLQMAQIYISTLSELLQG 71          
BLAST of SMED30024482 vs. Ensembl Cavefish
Match: ferd3l (Fer3-like bHLH transcription factor [Source:ZFIN;Acc:ZDB-GENE-081104-461])

HSP 1 Score: 60.4622 bits (145), Expect = 1.275e-12
Identity = 28/56 (50.00%), Postives = 40/56 (71.43%), Query Frame = -2
Query:   13 IKRTAANDRERKRMYCLNRAFDQLRDVVPYSSNQKKMSKFETLLMAQTYIETLVEM 180
            ++R AAN RERKRM+ LN AFD+LR  VP  + +K++S+ ETL +A  YI  + E+
Sbjct:   15 VQRQAANIRERKRMFSLNEAFDELRKKVPTFAYEKRLSRIETLRLAIVYISFMTEL 70          
BLAST of SMED30024482 vs. Ensembl Cavefish
Match: neurod4 (neuronal differentiation 4 [Source:ZFIN;Acc:ZDB-GENE-030730-1])

HSP 1 Score: 61.6178 bits (148), Expect = 2.079e-11
Identity = 31/58 (53.45%), Postives = 39/58 (67.24%), Query Frame = -2
Query:    4 KRTAANDRERKRMYCLNRAFDQLRDVVPYSSNQKKMSKFETLLMAQTYIETLVEMLEN 177
            +R  AN RER RM+ LN A D LR V+P  S  +K+SK ETL +A+ YI  L E+LEN
Sbjct:   87 RRVKANARERTRMHGLNDALDNLRQVMPCYSKTQKLSKIETLRLARNYIWALSEVLEN 144          
BLAST of SMED30024482 vs. Ensembl Sea Lamprey
Match: neurod1 (neuronal differentiation 1 [Source:NCBI gene;Acc:30169])

HSP 1 Score: 59.3066 bits (142), Expect = 1.953e-11
Identity = 30/57 (52.63%), Postives = 38/57 (66.67%), Query Frame = -2
Query:   10 IKRTAANDRERKRMYCLNRAFDQLRDVVPYSSNQKKMSKFETLLMAQTYIETLVEML 180
            ++R  AN RER RM+ LN A D LR VVP  S  +K+SK ETL +A+ YI  L E+L
Sbjct:   23 MRRVKANARERNRMHGLNAALDNLRKVVPCYSKTQKLSKIETLRLAKNYIWALSEIL 79          
BLAST of SMED30024482 vs. Ensembl Sea Lamprey
Match: si:dkey-34f9.3 (si:dkey-34f9.3 [Source:ZFIN;Acc:ZDB-GENE-081104-410])

HSP 1 Score: 54.6842 bits (130), Expect = 1.463e-10
Identity = 27/57 (47.37%), Postives = 40/57 (70.18%), Query Frame = -2
Query:   10 IKRTAANDRERKRMYCLNRAFDQLRDVVPYSSNQKKMSKFETLLMAQTYIETLVEML 180
            ++RTAAN RER+RM  +N AF++LR  VP    +K++SK +TL +A  YI  L ++L
Sbjct:   33 VQRTAANVRERRRMLSINSAFEELRCHVPTFPYEKRLSKIDTLRLAIAYIALLRDIL 89          
BLAST of SMED30024482 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006843.1 (pep scaffold:Pmarinus_7.0:GL488467:178:1220:1 gene:ENSPMAG00000006182.1 transcript:ENSPMAT00000006843.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.0694 bits (131), Expect = 3.124e-10
Identity = 27/57 (47.37%), Postives = 35/57 (61.40%), Query Frame = -2
Query:    7 KRTAANDRERKRMYCLNRAFDQLRDVVPYSSNQKKMSKFETLLMAQTYIETLVEMLE 177
            +R  ANDRER RM+ LN A D LR V+P   +  +++K ETL  A  YI  L E L+
Sbjct:   44 RRMKANDRERNRMHNLNDALDALRGVLPTLPDDARLTKIETLRFAYNYIWVLTETLQ 100          
BLAST of SMED30024482 vs. Ensembl Sea Lamprey
Match: tcf21 (transcription factor 21 [Source:NCBI gene;Acc:558148])

HSP 1 Score: 52.373 bits (124), Expect = 3.192e-9
Identity = 24/58 (41.38%), Postives = 38/58 (65.52%), Query Frame = -2
Query:    4 KRTAANDRERKRMYCLNRAFDQLRDVVPYSSNQKKMSKFETLLMAQTYIETLVEMLEN 177
            +R AAN RER RM  L++AF +L+  +P+     K+SK +TL +A +YI  L ++L +
Sbjct:   97 QRNAANARERARMRVLSKAFSRLKTTLPWVPADTKLSKLDTLRLASSYIGHLRQILAD 154          
BLAST of SMED30024482 vs. Ensembl Sea Lamprey
Match: scxa (scleraxis bHLH transcription factor a [Source:ZFIN;Acc:ZDB-GENE-060503-414])

HSP 1 Score: 51.6026 bits (122), Expect = 3.350e-9
Identity = 26/56 (46.43%), Postives = 34/56 (60.71%), Query Frame = -2
Query:   10 KRTAANDRERKRMYCLNRAFDQLRDVVPYSSNQKKMSKFETLLMAQTYIETLVEML 177
            +R AAN RER R   +N AF  LR ++P     +K+SK ETLL+A +YI  L   L
Sbjct:   37 QRRAANARERDRTQSVNSAFTALRTLIPTEPADRKLSKLETLLLASSYIAHLGNTL 92          
BLAST of SMED30024482 vs. Ensembl Nematostella
Match: EDO43849 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXI0])

HSP 1 Score: 54.6842 bits (130), Expect = 6.887e-11
Identity = 27/57 (47.37%), Postives = 38/57 (66.67%), Query Frame = -2
Query:   10 IKRTAANDRERKRMYCLNRAFDQLRDVVPYSSNQKKMSKFETLLMAQTYIETLVEML 180
            ++R AAN RERKRM  +N AF+ LR  +P    +K++SK +TL +A  YI  L EM+
Sbjct:    2 VQRHAANLRERKRMQSINEAFEGLRKHIPTLPYEKRLSKVDTLRLAIGYIGFLTEMI 58          
BLAST of SMED30024482 vs. Ensembl Nematostella
Match: NVATO2 (Atonal-related protein 2; Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJ22])

HSP 1 Score: 57.7658 bits (138), Expect = 1.071e-10
Identity = 28/69 (40.58%), Postives = 44/69 (63.77%), Query Frame = -2
Query:   10 PTQLTKSNP---IKRTAANDRERKRMYCLNRAFDQLRDVVPYSSNQKKMSKFETLLMAQTYIETLVEML 207
            P+   K+ P   I+R  ANDRER+RM  LNRA D L+  +P   ++++++K E L +A  YI++L + L
Sbjct:  129 PSPCVKAEPMKRIRRLRANDRERRRMKSLNRALDSLKKCIPVPQSKRRVTKLEILRIACNYIKSLSDTL 197          
BLAST of SMED30024482 vs. Ensembl Nematostella
Match: EDO42924 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZZ0])

HSP 1 Score: 53.1434 bits (126), Expect = 2.393e-10
Identity = 25/56 (44.64%), Postives = 37/56 (66.07%), Query Frame = -2
Query:   10 KRTAANDRERKRMYCLNRAFDQLRDVVPYSSNQKKMSKFETLLMAQTYIETLVEML 177
            +R AAN RER R + +N AF+ LR ++P   + +K+SK ETL +A +YI  L  +L
Sbjct:    2 QRQAANARERNRTHSVNAAFNALRLLIPTEPSDRKLSKIETLRLASSYIAHLSTIL 57          
BLAST of SMED30024482 vs. Ensembl Nematostella
Match: EDO43666 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYA7])

HSP 1 Score: 51.9878 bits (123), Expect = 7.829e-10
Identity = 25/58 (43.10%), Postives = 37/58 (63.79%), Query Frame = -2
Query:    4 KRTAANDRERKRMYCLNRAFDQLRDVVPYSSNQKKMSKFETLLMAQTYIETLVEMLEN 177
            +R  AN RER R+  LN   D+LR ++P    +KK SK ET+ +A  YIE + E+++N
Sbjct:    8 QRRLANTRERHRVQVLNAYIDRLRHLIPLFPGEKKPSKTETVHLAALYIEHMTEIIQN 65          
BLAST of SMED30024482 vs. Ensembl Nematostella
Match: EDO30831 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZM2])

HSP 1 Score: 53.1434 bits (126), Expect = 1.486e-9
Identity = 38/108 (35.19%), Postives = 56/108 (51.85%), Query Frame = -2
Query:    4 AVCFNWTINLVESENVSFDIVGEMANYCNSNNQPTQLTKSNPIKR---TAANDRERKRMYCLNRAFDQLRDVVP-YSSN---QKKMSKFETLLMAQTYIETLVEMLEN 306
            A  F W++         F+   E+   C   ++ T+LT    ++R      N RER+R   LN AFD LR V+P Y S    ++K+++ ETL +A  YI  L EMLE+
Sbjct:   20 ATEFPWSL---------FEKAAEITEDCPRESKRTKLTVPPTVRRFRQLRRNARERERQGRLNSAFDVLRGVIPDYLSGKGPERKLTQIETLRLATHYIMALSEMLED 118          
BLAST of SMED30024482 vs. Ensembl Medaka
Match: atoh1a (atonal bHLH transcription factor 1 [Source:NCBI gene;Acc:101170025])

HSP 1 Score: 78.5666 bits (192), Expect = 1.984e-17
Identity = 35/58 (60.34%), Postives = 43/58 (74.14%), Query Frame = -2
Query:    4 KRTAANDRERKRMYCLNRAFDQLRDVVPYSSNQKKMSKFETLLMAQTYIETLVEMLEN 177
            +R AAN RER+RM+ LN AFD+LR V+P   N KK+SK+ETL MAQ YI  L E+LE 
Sbjct:  153 RRVAANARERRRMHGLNHAFDELRSVIPAFDNDKKLSKYETLQMAQIYINALAELLEG 210          
BLAST of SMED30024482 vs. Ensembl Medaka
Match: atoh1b (neurogenin-2 [Source:NCBI gene;Acc:101175327])

HSP 1 Score: 74.3294 bits (181), Expect = 1.836e-16
Identity = 33/58 (56.90%), Postives = 44/58 (75.86%), Query Frame = -2
Query:    4 KRTAANDRERKRMYCLNRAFDQLRDVVPYSSNQKKMSKFETLLMAQTYIETLVEMLEN 177
            +R AAN RER+RM+ LN+AFD+LR V+P   N+KK+SK++TL MAQ YI  L E+L  
Sbjct:   91 RRVAANARERRRMHGLNKAFDELRSVIPSLENEKKLSKYDTLQMAQIYITELSELLSG 148          
BLAST of SMED30024482 vs. Ensembl Medaka
Match: atoh7 (atonal bHLH transcription factor 7 [Source:NCBI gene;Acc:101155052])

HSP 1 Score: 63.5438 bits (153), Expect = 4.876e-13
Identity = 33/58 (56.90%), Postives = 40/58 (68.97%), Query Frame = -2
Query:    4 KRTAANDRERKRMYCLNRAFDQLRDVVPYSSNQKKMSKFETLLMAQTYIETLVEMLEN 177
            +R AAN RERKRM  LN AFD+LR VVP     KK+SK+ETL MA +YI  L  +L +
Sbjct:   32 RRMAANARERKRMQGLNTAFDRLRKVVPQWGQDKKLSKYETLQMALSYIMALSRILTD 89          
BLAST of SMED30024482 vs. Ensembl Medaka
Match: ferd3l (Fer3 like bHLH transcription factor [Source:NCBI gene;Acc:101167882])

HSP 1 Score: 60.8474 bits (146), Expect = 1.006e-12
Identity = 28/58 (48.28%), Postives = 42/58 (72.41%), Query Frame = -2
Query:    7 IKRTAANDRERKRMYCLNRAFDQLRDVVPYSSNQKKMSKFETLLMAQTYIETLVEMLE 180
            ++R AAN RER+RM+ LN AFD+LR  VP  + +K++S+ ETL +A  YI  + ++LE
Sbjct:   14 VQRQAANVRERRRMFSLNEAFDELRRKVPTFAYEKRLSRIETLRLAIVYISFMTDLLE 71          
BLAST of SMED30024482 vs. Ensembl Medaka
Match: bhlha15 (class A basic helix-loop-helix protein 15 [Source:NCBI gene;Acc:105356519])

HSP 1 Score: 62.7734 bits (151), Expect = 2.561e-12
Identity = 28/62 (45.16%), Postives = 42/62 (67.74%), Query Frame = -2
Query:   10 TKSNPIKRTAANDRERKRMYCLNRAFDQLRDVVPYSSNQKKMSKFETLLMAQTYIETLVEML 195
            TK   I+R  +N+RER+RM+ LN AF  LR+ +P+    KK+SK ETL +A+ YI+ L  ++
Sbjct:   74 TKERSIRRLESNERERQRMHKLNNAFQALREAIPHVKTDKKLSKIETLTLAKNYIKALTTII 135          
BLAST of SMED30024482 vs. Planmine SMEST
Match: SMESG000046205.1 (SMESG000046205.1)

HSP 1 Score: 162.155 bits (409), Expect = 1.464e-52
Identity = 78/78 (100.00%), Postives = 78/78 (100.00%), Query Frame = -2
Query:    4 MANYCNSNNQPTQLTKSNPIKRTAANDRERKRMYCLNRAFDQLRDVVPYSSNQKKMSKFETLLMAQTYIETLVEMLEN 237
            MANYCNSNNQPTQLTKSNPIKRTAANDRERKRMYCLNRAFDQLRDVVPYSSNQKKMSKFETLLMAQTYIETLVEMLEN
Sbjct:    1 MANYCNSNNQPTQLTKSNPIKRTAANDRERKRMYCLNRAFDQLRDVVPYSSNQKKMSKFETLLMAQTYIETLVEMLEN 78          
BLAST of SMED30024482 vs. Planmine SMEST
Match: SMESG000029000.1 (SMESG000029000.1)

HSP 1 Score: 63.5438 bits (153), Expect = 1.515e-12
Identity = 35/74 (47.30%), Postives = 48/74 (64.86%), Query Frame = -2
Query:   10 NYCNSNNQPTQLTKSNPIKRTAANDRERKRMYCLNRAFDQLRDVVPYSSNQKKMSKFETLLMAQTYIETLVEML 231
            N  N +N+P +   S   +R AAN RER+RMY LN AFD LR  VP  + +K++S+ ETL +A TYI  + E+L
Sbjct:  120 NSPNPSNKPKRKRISTVAQRRAANIRERRRMYSLNEAFDSLRKRVPTFAYEKRLSRIETLRLAITYICFMTELL 193          
BLAST of SMED30024482 vs. Planmine SMEST
Match: SMESG000029000.1 (SMESG000029000.1)

HSP 1 Score: 63.1586 bits (152), Expect = 1.995e-12
Identity = 35/74 (47.30%), Postives = 48/74 (64.86%), Query Frame = -2
Query:   10 NYCNSNNQPTQLTKSNPIKRTAANDRERKRMYCLNRAFDQLRDVVPYSSNQKKMSKFETLLMAQTYIETLVEML 231
            N  N +N+P +   S   +R AAN RER+RMY LN AFD LR  VP  + +K++S+ ETL +A TYI  + E+L
Sbjct:  127 NSPNPSNKPKRKRISTVAQRRAANIRERRRMYSLNEAFDSLRKRVPTFAYEKRLSRIETLRLAITYICFMTELL 200          
BLAST of SMED30024482 vs. Planmine SMEST
Match: SMESG000019274.1 (SMESG000019274.1)

HSP 1 Score: 60.077 bits (144), Expect = 1.558e-11
Identity = 34/82 (41.46%), Postives = 55/82 (67.07%), Query Frame = -2
Query:    4 IVGEMANYCNSNNQPTQLTKSNPIKRTAANDRERKRMYCLNRAFDQLRDVVPYSSNQKKMSKFETLLMAQTYIETLVEMLEN 249
            ++G+  N  N++++P +   +   +R AAN RER+RM  LN+AFD+LR +VP  + +K++S+ ETL +A TYI  + E L N
Sbjct:   93 LLGQY-NSSNNSDKPKRRRTTTIEQRHAANIRERRRMNNLNKAFDRLRQLVPTFAYEKQLSRIETLRLAITYISFMTEQLIN 173          
BLAST of SMED30024482 vs. Planmine SMEST
Match: SMESG000060237.1 (SMESG000060237.1)

HSP 1 Score: 55.8398 bits (133), Expect = 7.071e-10
Identity = 30/58 (51.72%), Postives = 37/58 (63.79%), Query Frame = -2
Query:    7 RTAANDRERKRMYCLNRAFDQLRDVVPYSSNQ--KKMSKFETLLMAQTYIETLVEMLE 174
            R   N RERKRM+ LN A D LR V+PY++    KK+SK  TLL+A+ YI  L   LE
Sbjct:   36 RLKINSRERKRMHDLNSALDSLRQVIPYANGPTVKKLSKIATLLLAKNYILMLKNSLE 93          
The following BLAST results are available for this feature:
BLAST of SMED30024482 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ATOH11.935e-1661.40atonal bHLH transcription factor 1 [Source:HGNC Sy... [more]
FERD3L4.067e-1253.45Fer3 like bHLH transcription factor [Source:HGNC S... [more]
BHLHA152.647e-1146.43basic helix-loop-helix family member a15 [Source:H... [more]
BHLHA152.647e-1146.43basic helix-loop-helix family member a15 [Source:H... [more]
NEUROD11.890e-1052.63neuronal differentiation 1 [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of SMED30024482 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lin-321.313e-1556.90pep chromosome:WBcel235:X:2229208:2230122:-1 gene:... [more]
cnd-15.257e-1343.66Neurogenic differentiation factor 1 [Source:UniPr... [more]
ngn-11.141e-941.94NeuroGeNin [Source:UniProtKB/TrEMBL;Acc:Q95XG7][more]
hlh-322.221e-945.00Helix Loop Helix [Source:UniProtKB/TrEMBL;Acc:Q7Y... [more]
hlh-171.957e-845.45Helix Loop Helix [Source:UniProtKB/TrEMBL;Acc:O45... [more]
back to top
BLAST of SMED30024482 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cato2.024e-1560.34gene:FBgn0024249 transcript:FBtr0087183[more]
amos1.273e-1458.93gene:FBgn0003270 transcript:FBtr0081081[more]
ato2.317e-1255.36gene:FBgn0010433 transcript:FBtr0081828[more]
Fer31.330e-1150.00gene:FBgn0037937 transcript:FBtr0082435[more]
dimm3.418e-1042.11gene:FBgn0023091 transcript:FBtr0333354[more]
back to top
BLAST of SMED30024482 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atoh1b2.255e-1849.37atonal bHLH transcription factor 1b [Source:ZFIN;A... [more]
AL807792.27.341e-1656.90pep chromosome:GRCz11:CHR_ALT_CTG8_2_5:29594098:29... [more]
AL807792.37.341e-1656.90pep chromosome:GRCz11:CHR_ALT_CTG8_1_14:29595591:2... [more]
atoh1a8.635e-1656.90atonal bHLH transcription factor 1a [Source:ZFIN;A... [more]
ferd3l5.006e-1344.29Fer3-like bHLH transcription factor [Source:ZFIN;A... [more]
back to top
BLAST of SMED30024482 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ATOH13.650e-1659.65atonal bHLH transcription factor 1 [Source:NCBI ge... [more]
st6gal14.905e-1646.74ST6 beta-galactosamide alpha-2,6-sialyltranferase ... [more]
znf4232.709e-1239.24zinc finger protein 423 [Source:Xenbase;Acc:XB-GEN... [more]
ferd3l3.091e-1253.45Fer3-like bHLH transcription factor [Source:NCBI g... [more]
ppil64.297e-1248.05peptidylprolyl isomerase like 6 [Source:Xenbase;Ac... [more]
back to top
BLAST of SMED30024482 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Atoh11.266e-1661.40atonal bHLH transcription factor 1 [Source:MGI Sym... [more]
Ferd3l8.104e-1251.72Fer3 like bHLH transcription factor [Source:MGI Sy... [more]
Bhlha152.694e-1149.06basic helix-loop-helix family, member a15 [Source:... [more]
Neurod11.227e-1052.63neurogenic differentiation 1 [Source:MGI Symbol;Ac... [more]
Neurod42.424e-1052.63neurogenic differentiation 4 [Source:MGI Symbol;Ac... [more]
back to top
BLAST of SMED30024482 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P48985|ATOH1_MOUSE8.856e-1661.40Protein atonal homolog 1 OS=Mus musculus OX=10090 ... [more]
sp|Q92858|ATOH1_HUMAN9.293e-1661.40Protein atonal homolog 1 OS=Homo sapiens OX=9606 G... [more]
sp|Q5IS79|ATOH1_PANTR9.784e-1661.40Protein atonal homolog 1 OS=Pan troglodytes OX=959... [more]
sp|Q10574|LIN32_CAEEL1.670e-1456.90Protein lin-32 OS=Caenorhabditis elegans OX=6239 G... [more]
sp|Q9Y0A7|AMOS_DROME1.276e-1358.93Basic helix-loop-helix transcription factor amos O... [more]
back to top
BLAST of SMED30024482 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
H6V0512.514e-4693.67Atonal OS=Schmidtea polychroa OX=50054 PE=2 SV=1[more]
Q8JHA18.713e-1661.40BHLH transcription factor ath1 (Fragment) OS=Serin... [more]
A0A140H4V51.423e-1548.78Atonal-like protein 1 (Fragment) OS=Scyliorhinus t... [more]
T1INY92.409e-1554.17BHLH domain-containing protein OS=Strigamia mariti... [more]
A0A0N5APG92.624e-1562.71BHLH domain-containing protein OS=Syphacia muris O... [more]
back to top
BLAST of SMED30024482 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atoh1b2.263e-1760.34atonal bHLH transcription factor 1b [Source:ZFIN;A... [more]
atoh1a2.924e-1758.93atonal bHLH transcription factor 1a [Source:ZFIN;A... [more]
atoh1c3.920e-1556.90atonal bHLH transcription factor 1c [Source:ZFIN;A... [more]
ferd3l1.275e-1250.00Fer3-like bHLH transcription factor [Source:ZFIN;A... [more]
neurod42.079e-1153.45neuronal differentiation 4 [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of SMED30024482 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
neurod11.953e-1152.63neuronal differentiation 1 [Source:NCBI gene;Acc:3... [more]
si:dkey-34f9.31.463e-1047.37si:dkey-34f9.3 [Source:ZFIN;Acc:ZDB-GENE-081104-41... [more]
ENSPMAT00000006843.13.124e-1047.37pep scaffold:Pmarinus_7.0:GL488467:178:1220:1 gene... [more]
tcf213.192e-941.38transcription factor 21 [Source:NCBI gene;Acc:5581... [more]
scxa3.350e-946.43scleraxis bHLH transcription factor a [Source:ZFIN... [more]
back to top
BLAST of SMED30024482 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30024482 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO438496.887e-1147.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
NVATO21.071e-1040.58Atonal-related protein 2; Predicted protein [Sour... [more]
EDO429242.393e-1044.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO436667.829e-1043.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO308311.486e-935.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30024482 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atoh1a1.984e-1760.34atonal bHLH transcription factor 1 [Source:NCBI ge... [more]
atoh1b1.836e-1656.90neurogenin-2 [Source:NCBI gene;Acc:101175327][more]
atoh74.876e-1356.90atonal bHLH transcription factor 7 [Source:NCBI ge... [more]
ferd3l1.006e-1248.28Fer3 like bHLH transcription factor [Source:NCBI g... [more]
bhlha152.561e-1245.16class A basic helix-loop-helix protein 15 [Source:... [more]
back to top
BLAST of SMED30024482 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000046205.11.464e-52100.00SMESG000046205.1[more]
SMESG000029000.11.515e-1247.30SMESG000029000.1[more]
SMESG000029000.11.995e-1247.30SMESG000029000.1[more]
SMESG000019274.11.558e-1141.46SMESG000019274.1[more]
SMESG000060237.17.071e-1051.72SMESG000060237.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024482 ID=SMED30024482|Name=SMED30024482|organism=Schmidtea mediterranea sexual|type=transcript|length=511bp
TTAATTTTCTAACATTTCCACAAGAGTTTCTATATACGTTTGAGCCATTA
ATAGAGTTTCAAACTTTGACATTTTCTTTTGATTAGAAGAGTAAGGAACG
ACATCTCTCAGTTGGTCAAAGGCTCGGTTCAAACAATACATCCGTTTTCG
TTCTCTGTCATTGGCTGCGGTCCGTTTGATAGGATTCGATTTGGTAAGTT
GAGTCGGCTGGTTGTTTGAGTTGCAATAGTTGGCCATTTCTCCCACAATG
TCAAATGAAACATTTTCACTTTCCACTAAATTTATAGTCCAATTGAAGCA
TACGGCAAGCTAGGAATCATCACGACATCTCAGAAGGTGGACCAAATCCC
ACTGGGAAACAATTGAATAAACTGGGAATTCATATTATTAGACAATTTGC
ATGCAATTGACTGATATCGGATAATTATATTGAATTATTAATGTCCAACG
ATTCAATAGATCTCTCACATTTCCTCGGCAGTTATGGAATAATTCTCCTA
GCGATCTTTTT
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036638HLH_DNA-bd_sf
IPR011598bHLH_dom
Vocabulary: molecular function
TermDefinition
GO:0046983protein dimerization activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR011598Myc-type, basic helix-loop-helix (bHLH) domainSMARTSM00353finuluscoord: 26..78
e-value: 1.7E-14
score: 64.1
IPR011598Myc-type, basic helix-loop-helix (bHLH) domainPFAMPF00010HLHcoord: 21..72
e-value: 8.4E-17
score: 60.9
IPR011598Myc-type, basic helix-loop-helix (bHLH) domainPROSITEPS50888BHLHcoord: 20..72
score: 15.237
IPR011598Myc-type, basic helix-loop-helix (bHLH) domainCDDcd00083HLHcoord: 21..77
e-value: 1.29936E-15
score: 62.2315
IPR036638Helix-loop-helix DNA-binding domain superfamilyGENE3DG3DSA:4.10.280.10coord: 20..78
e-value: 9.2E-22
score: 78.6
IPR036638Helix-loop-helix DNA-binding domain superfamilySUPERFAMILYSSF47459HLH, helix-loop-helix DNA-binding domaincoord: 20..77
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..21
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..25
NoneNo IPR availablePANTHERPTHR19290:SF97BASIC HELIX-LOOP-HELIX TRANSCRIPTION FACTOR AMOS-RELATEDcoord: 19..77
NoneNo IPR availablePANTHERPTHR19290BASIC HELIX-LOOP-HELIX PROTEIN NEUROGENIN-RELATEDcoord: 19..77