Si:ch211-106h4.9

Overview
NameSi:ch211-106h4.9
Smed IDSMED30024475
Length (bp)814
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Si:ch211-106h4.9 (SMED30024475) t-SNE clustered cells

Violin plots show distribution of expression levels for Si:ch211-106h4.9 (SMED30024475) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Si:ch211-106h4.9 (SMED30024475) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Si:ch211-106h4.9 (SMED30024475) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024475

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30024475h1SMcG0019112 dd_Smed_v4_3756_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30024475h1SMcG0019112 dd_Smed_v4_3756_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30024475h1SMcG0019112 dd_Smed_v4_3756_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Si:ch211-106h4.9 vs. Ensembl Human
Match: MYRIP (myosin VIIA and Rab interacting protein [Source:HGNC Symbol;Acc:HGNC:19156])

HSP 1 Score: 54.299 bits (129), Expect = 8.763e-8
Identity = 36/123 (29.27%), Postives = 60/123 (48.78%), Query Frame = 1
Query:   85 RDLNISCLNEEEKSRLLQVLDRNNKLVNHENVRLSRMDTEI--KGELKTYQNKQSKSTAKECLNCSSDLKDF----DGCEKCQKSVCVKCCRSFGSQKVMLCKVCYREMLLEAKKAKWFYDNI 435
            R L++S L ++E   +LQV+ R+  L   E  RLS +  ++  +G   +  +K  +     C+ C S           C  C+ +VC  CC     +K  +C VC +  LL A+  +WFY+N+
Sbjct:    3 RKLDLSGLTDDETEHVLQVVQRDFNLRKKEEERLSELKQKLDEEGSKCSILSKHQQFVEHCCMRCCSPFTFLVNTKRQCGDCKFNVCKSCCSYQKHEKAWVCCVCQQARLLRAQSLEWFYNNV 125          
BLAST of Si:ch211-106h4.9 vs. Ensembl Human
Match: MYRIP (myosin VIIA and Rab interacting protein [Source:HGNC Symbol;Acc:HGNC:19156])

HSP 1 Score: 54.6842 bits (130), Expect = 8.927e-8
Identity = 36/123 (29.27%), Postives = 60/123 (48.78%), Query Frame = 1
Query:   85 RDLNISCLNEEEKSRLLQVLDRNNKLVNHENVRLSRMDTEI--KGELKTYQNKQSKSTAKECLNCSSDLKDFDG----CEKCQKSVCVKCCRSFGSQKVMLCKVCYREMLLEAKKAKWFYDNI 435
            R L++S L ++E   +LQV+ R+  L   E  RLS +  ++  +G   +  +K  +     C+ C S           C  C+ +VC  CC     +K  +C VC +  LL A+  +WFY+N+
Sbjct:    3 RKLDLSGLTDDETEHVLQVVQRDFNLRKKEEERLSELKQKLDEEGSKCSILSKHQQFVEHCCMRCCSPFTFLVNTKRQCGDCKFNVCKSCCSYQKHEKAWVCCVCQQARLLRAQSLEWFYNNV 125          
BLAST of Si:ch211-106h4.9 vs. Ensembl Human
Match: MYRIP (myosin VIIA and Rab interacting protein [Source:HGNC Symbol;Acc:HGNC:19156])

HSP 1 Score: 54.6842 bits (130), Expect = 8.927e-8
Identity = 36/123 (29.27%), Postives = 60/123 (48.78%), Query Frame = 1
Query:   85 RDLNISCLNEEEKSRLLQVLDRNNKLVNHENVRLSRMDTEI--KGELKTYQNKQSKSTAKECLNCSSDLKDFDG----CEKCQKSVCVKCCRSFGSQKVMLCKVCYREMLLEAKKAKWFYDNI 435
            R L++S L ++E   +LQV+ R+  L   E  RLS +  ++  +G   +  +K  +     C+ C S           C  C+ +VC  CC     +K  +C VC +  LL A+  +WFY+N+
Sbjct:    3 RKLDLSGLTDDETEHVLQVVQRDFNLRKKEEERLSELKQKLDEEGSKCSILSKHQQFVEHCCMRCCSPFTFLVNTKRQCGDCKFNVCKSCCSYQKHEKAWVCCVCQQARLLRAQSLEWFYNNV 125          
BLAST of Si:ch211-106h4.9 vs. Ensembl Human
Match: MYRIP (myosin VIIA and Rab interacting protein [Source:HGNC Symbol;Acc:HGNC:19156])

HSP 1 Score: 54.299 bits (129), Expect = 9.337e-8
Identity = 36/123 (29.27%), Postives = 60/123 (48.78%), Query Frame = 1
Query:   85 RDLNISCLNEEEKSRLLQVLDRNNKLVNHENVRLSRMDTEI--KGELKTYQNKQSKSTAKECLNCSSDLKDF----DGCEKCQKSVCVKCCRSFGSQKVMLCKVCYREMLLEAKKAKWFYDNI 435
            R L++S L ++E   +LQV+ R+  L   E  RLS +  ++  +G   +  +K  +     C+ C S           C  C+ +VC  CC     +K  +C VC +  LL A+  +WFY+N+
Sbjct:    3 RKLDLSGLTDDETEHVLQVVQRDFNLRKKEEERLSELKQKLDEEGSKCSILSKHQQFVEHCCMRCCSPFTFLVNTKRQCGDCKFNVCKSCCSYQKHEKAWVCCVCQQARLLRAQSLEWFYNNV 125          
BLAST of Si:ch211-106h4.9 vs. Ensembl Human
Match: SYTL4 (synaptotagmin like 4 [Source:HGNC Symbol;Acc:HGNC:15588])

HSP 1 Score: 50.447 bits (119), Expect = 1.220e-6
Identity = 37/122 (30.33%), Postives = 57/122 (46.72%), Query Frame = 1
Query:   91 LNISCLNEEEKSRLLQVLDRNNKLVNHENVRLSRMDTEI-----KGELKTYQNKQSKSTAKECLNCSSDLKDF----DGCEKCQKSVCVKCCRSFGSQKVMLCKVCYREMLLEAKKAKWFYD 429
            L++S L+EEEK  +L VL R+ ++   +  R+ R+  E+     KG  +  Q+   ++    C  C   L       + C  C   VC + CR   S     CKVC +E+ L+     WFYD
Sbjct:    5 LDLSFLSEEEKDLILSVLQRDEEVRKADEKRIRRLKNELLEIKRKGAKRGSQHYSDRT----CARCQESLGRLSPKTNTCRGCNHLVC-RDCRIQESNGTWRCKVCAKEIELKKATGDWFYD 121          
BLAST of Si:ch211-106h4.9 vs. Ensembl Zebrafish
Match: si:ch211-106h4.9 (si:ch211-106h4.9 [Source:ZFIN;Acc:ZDB-GENE-070705-17])

HSP 1 Score: 55.0694 bits (131), Expect = 3.696e-8
Identity = 34/123 (27.64%), Postives = 57/123 (46.34%), Query Frame = 1
Query:   85 RDLNISCLNEEEKSRLLQVLDRNNKLVNHENVRLSRMDTEI--KGELKTYQNKQSKSTAKECLNCSSD----LKDFDGCEKCQKSVCVKCCRSFGSQKVMLCKVCYREMLLEAKKAKWFYDNI 435
            R L++S L + E   ++QV+ R+ +L   E  RL  M   +  +G      ++Q +   + C+ C S     L     C  C  ++C  CC      K  LC  C +  LL+ +  +WFY+N+
Sbjct:    3 RKLDLSGLTDVEAEHVMQVVQRDMQLRKTEETRLFEMKKALVEEGSRSVLLSRQHRFNERCCIRCCSPFTFLLNTKRSCLDCSYNICKSCCTYSKKDKAWLCSSCQKTRLLKTQSLEWFYNNV 125          
BLAST of Si:ch211-106h4.9 vs. Ensembl Zebrafish
Match: myrip (Danio rerio myosin VIIA and Rab interacting protein (myrip), mRNA. [Source:RefSeq mRNA;Acc:NM_001353925])

HSP 1 Score: 53.9138 bits (128), Expect = 5.141e-8
Identity = 36/123 (29.27%), Postives = 58/123 (47.15%), Query Frame = 1
Query:   85 RDLNISCLNEEEKSRLLQVLDRNNKLVNHENVRLSRMDTEIK--GELKTYQNKQSKSTAKECLNCSSD----LKDFDGCEKCQKSVCVKCCRSFGSQKVMLCKVCYREMLLEAKKAKWFYDNI 435
            R L++S L+  E   +L+V+ R+ +L   E  RLS M  E++  G      +KQ K     C+ C S     L     C  C  ++C  CC    S++  +C  C +   L  +  +WFY+N+
Sbjct:    3 RKLDLSGLSNNEAEHVLRVVQRDMQLRKKEEERLSEMKQELEEEGSRCLLLSKQQKFNEHCCIRCCSPFTFLLNPKRQCLDCHYNICKSCCSYSQSERGYICAACQKSRHLRTQSLEWFYNNV 125          
BLAST of Si:ch211-106h4.9 vs. Ensembl Zebrafish
Match: si:ch211-106h4.9 (si:ch211-106h4.9 [Source:ZFIN;Acc:ZDB-GENE-070705-17])

HSP 1 Score: 53.9138 bits (128), Expect = 5.912e-8
Identity = 35/128 (27.34%), Postives = 59/128 (46.09%), Query Frame = 1
Query:   85 RDLNISCLNEEEKSRLLQVLDRNNKLVNHENVRLSRMDTEI--KGELKTYQNKQSKSTAKECLNCSSD----LKDFDGCEKCQKSVCVKCCRSFGSQKVMLCKVCYREMLLEAKKAKWFYDNIPQSTK 450
            R L++S L + E   ++QV+ R+ +L   E  RL  M   +  +G      ++Q +   + C+ C S     L     C  C  ++C  CC      K  LC  C +  LL+ +  +WFY+N+ +  K
Sbjct:    3 RKLDLSGLTDVEAEHVMQVVQRDMQLRKTEETRLFEMKKALVEEGSRSVLLSRQHRFNERCCIRCCSPFTFLLNTKRSCLDCSYNICKSCCTYSKKDKAWLCSSCQKTRLLKTQSLEWFYNNVRRRFK 130          
BLAST of Si:ch211-106h4.9 vs. Ensembl Zebrafish
Match: si:ch211-106h4.9 (si:ch211-106h4.9 [Source:ZFIN;Acc:ZDB-GENE-070705-17])

HSP 1 Score: 53.9138 bits (128), Expect = 8.276e-8
Identity = 34/123 (27.64%), Postives = 57/123 (46.34%), Query Frame = 1
Query:   85 RDLNISCLNEEEKSRLLQVLDRNNKLVNHENVRLSRMDTEI--KGELKTYQNKQSKSTAKECLNCSSD----LKDFDGCEKCQKSVCVKCCRSFGSQKVMLCKVCYREMLLEAKKAKWFYDNI 435
            R L++S L + E   ++QV+ R+ +L   E  RL  M   +  +G      ++Q +   + C+ C S     L     C  C  ++C  CC      K  LC  C +  LL+ +  +WFY+N+
Sbjct:    3 RKLDLSGLTDVEAEHVMQVVQRDMQLRKTEETRLFEMKKALVEEGSRSVLLSRQHRFNERCCIRCCSPFTFLLNTKRSCLDCSYNICKSCCTYSKKDKAWLCSSCQKTRLLKTQSLEWFYNNV 125          
BLAST of Si:ch211-106h4.9 vs. Ensembl Zebrafish
Match: sytl4 (synaptotagmin-like 4 [Source:ZFIN;Acc:ZDB-GENE-070209-217])

HSP 1 Score: 53.1434 bits (126), Expect = 1.201e-7
Identity = 35/121 (28.93%), Postives = 59/121 (48.76%), Query Frame = 1
Query:   88 DLNISCLNEEEKSRLLQVLDRNNKLVNHENVRLSRMDTE-IKGELKTYQNKQSKSTAKECLNCSSDLKDFDG----CEKCQKSVCVKC--CRSFGSQKVMLCKVCYREMLLEAKKAKWFYD 429
            ++N+S L + E+  +L+VL R+  L + E++R+ ++  E +    K  +    K + + C  C   L    G    C  C+  VC KC   R  GS    +C VC +E+ L+     WF+D
Sbjct:    6 EINVSFLTDSEQEFILEVLRRDEDLRHLEDLRVKKLKAEFLDIRRKGAKRGSGKYSERSCGRCQEPLSLLSGSGSQCRSCKHQVCKKCQSVRPNGS---WVCTVCAKEIDLKMSTGDWFFD 123          
BLAST of Si:ch211-106h4.9 vs. Ensembl Xenopus
Match: rph3al (rabphilin 3A like (without C2 domains) [Source:NCBI gene;Acc:496416])

HSP 1 Score: 54.299 bits (129), Expect = 5.364e-8
Identity = 38/120 (31.67%), Postives = 58/120 (48.33%), Query Frame = 1
Query:  106 LNEEEKSRLLQVLDRNNKLVNHENVRLSRMDTEIKGELKTYQNKQSKSTAKECLNCSSDLKDFDG-----CEKCQKSVCVKC-CRSFGSQK--VMLCKVCYREMLLEAKKAKWFYDNIPQ 441
            LN+ E   +LQV+ R  K+   E  R+ R+   ++   K        +   +CL C  +L  F G     C+ C+K VC KC   + GSQK  V LCK+C  +  +  +   WFY  +P+
Sbjct:   47 LNQNEIDVILQVIRRAEKVDTLEQQRIGRLVERLENMRKNVMG----NGMSQCLLCG-ELLGFLGTTSVFCQDCKKKVCTKCGIETVGSQKRQVWLCKICSEQREVWKRSGAWFYKGLPK 161          
BLAST of Si:ch211-106h4.9 vs. Ensembl Xenopus
Match: rph3al (rabphilin 3A like (without C2 domains) [Source:NCBI gene;Acc:496416])

HSP 1 Score: 54.299 bits (129), Expect = 5.885e-8
Identity = 38/120 (31.67%), Postives = 58/120 (48.33%), Query Frame = 1
Query:  106 LNEEEKSRLLQVLDRNNKLVNHENVRLSRMDTEIKGELKTYQNKQSKSTAKECLNCSSDLKDFDG-----CEKCQKSVCVKC-CRSFGSQK--VMLCKVCYREMLLEAKKAKWFYDNIPQ 441
            LN+ E   +LQV+ R  K+   E  R+ R+   ++   K        +   +CL C  +L  F G     C+ C+K VC KC   + GSQK  V LCK+C  +  +  +   WFY  +P+
Sbjct:   47 LNQNEIDVILQVIRRAEKVDTLEQQRIGRLVERLENMRKNVMG----NGMSQCLLCG-ELLGFLGTTSVFCQDCKKKVCTKCGIETVGSQKRQVWLCKICSEQREVWKRSGAWFYKGLPK 161          
BLAST of Si:ch211-106h4.9 vs. Ensembl Xenopus
Match: rph3al (rabphilin 3A like (without C2 domains) [Source:NCBI gene;Acc:496416])

HSP 1 Score: 54.299 bits (129), Expect = 6.154e-8
Identity = 38/120 (31.67%), Postives = 58/120 (48.33%), Query Frame = 1
Query:  106 LNEEEKSRLLQVLDRNNKLVNHENVRLSRMDTEIKGELKTYQNKQSKSTAKECLNCSSDLKDFDG-----CEKCQKSVCVKC-CRSFGSQK--VMLCKVCYREMLLEAKKAKWFYDNIPQ 441
            LN+ E   +LQV+ R  K+   E  R+ R+   ++   K        +   +CL C  +L  F G     C+ C+K VC KC   + GSQK  V LCK+C  +  +  +   WFY  +P+
Sbjct:   95 LNQNEIDVILQVIRRAEKVDTLEQQRIGRLVERLENMRKNVMG----NGMSQCLLCG-ELLGFLGTTSVFCQDCKKKVCTKCGIETVGSQKRQVWLCKICSEQREVWKRSGAWFYKGLPK 209          
BLAST of Si:ch211-106h4.9 vs. Ensembl Xenopus
Match: rph3al (rabphilin 3A like (without C2 domains) [Source:NCBI gene;Acc:496416])

HSP 1 Score: 54.299 bits (129), Expect = 6.217e-8
Identity = 38/120 (31.67%), Postives = 58/120 (48.33%), Query Frame = 1
Query:  106 LNEEEKSRLLQVLDRNNKLVNHENVRLSRMDTEIKGELKTYQNKQSKSTAKECLNCSSDLKDFDG-----CEKCQKSVCVKC-CRSFGSQK--VMLCKVCYREMLLEAKKAKWFYDNIPQ 441
            LN+ E   +LQV+ R  K+   E  R+ R+   ++   K        +   +CL C  +L  F G     C+ C+K VC KC   + GSQK  V LCK+C  +  +  +   WFY  +P+
Sbjct:   46 LNQNEIDVILQVIRRAEKVDTLEQQRIGRLVERLENMRKNVMG----NGMSQCLLCG-ELLGFLGTTSVFCQDCKKKVCTKCGIETVGSQKRQVWLCKICSEQREVWKRSGAWFYKGLPK 160          
BLAST of Si:ch211-106h4.9 vs. Ensembl Xenopus
Match: selenon (selenoprotein N [Source:Xenbase;Acc:XB-GENE-6456840])

HSP 1 Score: 52.373 bits (124), Expect = 4.191e-7
Identity = 35/123 (28.46%), Postives = 58/123 (47.15%), Query Frame = 1
Query:   85 RDLNISCLNEEEKSRLLQVLDRNNKLVNHENVRLSRMDTEI--KGELKTYQNKQSKSTAKECLNCSSDLKDFDG----CEKCQKSVCVKCCRSFGSQKVMLCKVCYREMLLEAKKAKWFYDNI 435
            R L++S L E+E   +LQV+ R+  L   E  RLS +  ++  +G   +   KQ K     C+ C S           C  C+ ++C  C      +K  +C VC +  LL  +  +W+Y+N+
Sbjct:    3 RKLDLSGLTEDEAEHVLQVVQRDFSLRKKEEERLSELKQKLDEEGNKCSILAKQQKFNEHCCIRCCSPFTFLINSKRQCSDCKFNICKNCSSYQKKEKAWICNVCQQTRLLRTQSLEWYYNNV 125          
BLAST of Si:ch211-106h4.9 vs. Ensembl Mouse
Match: Myrip (myosin VIIA and Rab interacting protein [Source:MGI Symbol;Acc:MGI:2384407])

HSP 1 Score: 57.7658 bits (138), Expect = 5.781e-9
Identity = 38/123 (30.89%), Postives = 60/123 (48.78%), Query Frame = 1
Query:   85 RDLNISCLNEEEKSRLLQVLDRNNKLVNHENVRLSRMDTEIKGELK--TYQNKQSKSTAKECLNCSSDLKDFDG----CEKCQKSVCVKCCRSFGSQKVMLCKVCYREMLLEAKKAKWFYDNI 435
            R L++S L ++E   +LQV+ R+  L   E  RLS M   +  E    +  +K  K   + C+ C S           C +C+ SVC  CC     +K+ +C VC +  LL  +  +WFY+N+
Sbjct:    3 RKLDLSGLTDDETEHVLQVVQRDFNLRKKEEDRLSEMKQRLAEENSKCSILSKHQKFVERCCMRCCSPFTFLVNARRRCGECKFSVCKSCCSYQKHEKLWVCCVCQQARLLRTQSLEWFYNNV 125          
BLAST of Si:ch211-106h4.9 vs. Ensembl Mouse
Match: Myrip (myosin VIIA and Rab interacting protein [Source:MGI Symbol;Acc:MGI:2384407])

HSP 1 Score: 55.8398 bits (133), Expect = 6.307e-9
Identity = 39/128 (30.47%), Postives = 61/128 (47.66%), Query Frame = 1
Query:   85 RDLNISCLNEEEKSRLLQVLDRNNKLVNHENVRLSRMDTEIKGELK--TYQNKQSKSTAKECLNCSSDLKDFDG----CEKCQKSVCVKCCRSFGSQKVMLCKVCYREMLLEAKKAKWFYDNIPQSTK 450
            R L++S L ++E   +LQV+ R+  L   E  RLS M   +  E    +  +K  K   + C+ C S           C +C+ SVC  CC     +K+ +C VC +  LL  +  +WFY+N+    K
Sbjct:    3 RKLDLSGLTDDETEHVLQVVQRDFNLRKKEEDRLSEMKQRLAEENSKCSILSKHQKFVERCCMRCCSPFTFLVNARRRCGECKFSVCKSCCSYQKHEKLWVCCVCQQARLLRTQSLEWFYNNVKSRFK 130          
BLAST of Si:ch211-106h4.9 vs. Ensembl Mouse
Match: Rph3al (rabphilin 3A-like (without C2 domains) [Source:MGI Symbol;Acc:MGI:1923492])

HSP 1 Score: 50.8322 bits (120), Expect = 5.122e-7
Identity = 37/121 (30.58%), Postives = 57/121 (47.11%), Query Frame = 1
Query:  103 CLNEEEKSRLLQVLDRNNKLVNHENVRLSRMDTEIKGELKTYQNKQSKSTAKECLNCSSDLKDFDG-----CEKCQKSVCVKCC--RSFGSQK-VMLCKVCYREMLLEAKKAKWFYDNIPQ 441
            CL+  E   +LQV+ R  +L   E  R+ R+       L+T Q     +   +CL C   L  F G     C+ C+K VC KC    S G ++ + LCK+C  +  +  +   WFY  +P+
Sbjct:   46 CLSPGELEIILQVIQRAERLDILEQQRIGRLVER----LETMQRNVMGNGLSQCLLCGEVL-GFLGSSSVFCKDCRKKVCTKCGIEASPGQKRPLWLCKICSEQREVWKRSGAWFYKGLPK 161          
BLAST of Si:ch211-106h4.9 vs. Ensembl Mouse
Match: Rph3al (rabphilin 3A-like (without C2 domains) [Source:MGI Symbol;Acc:MGI:1923492])

HSP 1 Score: 50.8322 bits (120), Expect = 5.122e-7
Identity = 37/121 (30.58%), Postives = 57/121 (47.11%), Query Frame = 1
Query:  103 CLNEEEKSRLLQVLDRNNKLVNHENVRLSRMDTEIKGELKTYQNKQSKSTAKECLNCSSDLKDFDG-----CEKCQKSVCVKCC--RSFGSQK-VMLCKVCYREMLLEAKKAKWFYDNIPQ 441
            CL+  E   +LQV+ R  +L   E  R+ R+       L+T Q     +   +CL C   L  F G     C+ C+K VC KC    S G ++ + LCK+C  +  +  +   WFY  +P+
Sbjct:   46 CLSPGELEIILQVIQRAERLDILEQQRIGRLVER----LETMQRNVMGNGLSQCLLCGEVL-GFLGSSSVFCKDCRKKVCTKCGIEASPGQKRPLWLCKICSEQREVWKRSGAWFYKGLPK 161          
BLAST of Si:ch211-106h4.9 vs. Ensembl Mouse
Match: Sytl4 (synaptotagmin-like 4 [Source:MGI Symbol;Acc:MGI:1351606])

HSP 1 Score: 48.1358 bits (113), Expect = 7.979e-6
Identity = 36/122 (29.51%), Postives = 55/122 (45.08%), Query Frame = 1
Query:   91 LNISCLNEEEKSRLLQVLDRNNKLVNHENVRLSRMDTEI-----KGELKTYQNKQSKSTAKECLNCSSDLKDF----DGCEKCQKSVCVKCCRSFGSQKVMLCKVCYREMLLEAKKAKWFYD 429
            L++S L+E E+  +L VL R+ +L   +  R+ R+  E+     KG  +  Q+   ++    C  C   L         C  C   VC + CR   S     CKVC +E+ L+     WFYD
Sbjct:    5 LDLSFLSEMERDLILGVLQRDEELRKADEKRIRRLKNELLEIKRKGAKRGSQHYSDRT----CARCQEGLGRLIPKSSTCVGCNHLVC-RECRVLESNGSWRCKVCSKEIELKKATGDWFYD 121          
BLAST of Si:ch211-106h4.9 vs. UniProt/SwissProt
Match: sp|Q7TNY7|MYRIP_RAT (Rab effector MyRIP OS=Rattus norvegicus OX=10116 GN=Myrip PE=1 SV=1)

HSP 1 Score: 57.7658 bits (138), Expect = 3.935e-8
Identity = 38/123 (30.89%), Postives = 60/123 (48.78%), Query Frame = 1
Query:   85 RDLNISCLNEEEKSRLLQVLDRNNKLVNHENVRLSRMDTEIKGELK--TYQNKQSKSTAKECLNCSSDLKDFDG----CEKCQKSVCVKCCRSFGSQKVMLCKVCYREMLLEAKKAKWFYDNI 435
            R L++S L ++E   +LQV+ R+  L   E  RLS M   +  E    +  +K  K   + C+ C S           C +C+ SVC  CC     +K+ +C VC +  LL  +  +WFY+N+
Sbjct:    3 RKLDLSGLTDDETEHVLQVVQRDFNLRKKEEDRLSEMKQRLAEENSKCSILSKHQKFVERCCMRCCSPFTFLVNARRRCGECKFSVCKSCCSYQKHEKLWVCCVCQQARLLRTQSLEWFYNNV 125          
BLAST of Si:ch211-106h4.9 vs. UniProt/SwissProt
Match: sp|Q8K3I4|MYRIP_MOUSE (Rab effector MyRIP OS=Mus musculus OX=10090 GN=Myrip PE=1 SV=1)

HSP 1 Score: 57.7658 bits (138), Expect = 4.044e-8
Identity = 38/123 (30.89%), Postives = 60/123 (48.78%), Query Frame = 1
Query:   85 RDLNISCLNEEEKSRLLQVLDRNNKLVNHENVRLSRMDTEIKGELK--TYQNKQSKSTAKECLNCSSDLKDFDG----CEKCQKSVCVKCCRSFGSQKVMLCKVCYREMLLEAKKAKWFYDNI 435
            R L++S L ++E   +LQV+ R+  L   E  RLS M   +  E    +  +K  K   + C+ C S           C +C+ SVC  CC     +K+ +C VC +  LL  +  +WFY+N+
Sbjct:    3 RKLDLSGLTDDETEHVLQVVQRDFNLRKKEEDRLSEMKQRLAEENSKCSILSKHQKFVERCCMRCCSPFTFLVNARRRCGECKFSVCKSCCSYQKHEKLWVCCVCQQARLLRTQSLEWFYNNV 125          
BLAST of Si:ch211-106h4.9 vs. UniProt/SwissProt
Match: sp|Q8NFW9|MYRIP_HUMAN (Rab effector MyRIP OS=Homo sapiens OX=9606 GN=MYRIP PE=1 SV=2)

HSP 1 Score: 54.6842 bits (130), Expect = 4.287e-7
Identity = 36/123 (29.27%), Postives = 60/123 (48.78%), Query Frame = 1
Query:   85 RDLNISCLNEEEKSRLLQVLDRNNKLVNHENVRLSRMDTEI--KGELKTYQNKQSKSTAKECLNCSSDLKDFDG----CEKCQKSVCVKCCRSFGSQKVMLCKVCYREMLLEAKKAKWFYDNI 435
            R L++S L ++E   +LQV+ R+  L   E  RLS +  ++  +G   +  +K  +     C+ C S           C  C+ +VC  CC     +K  +C VC +  LL A+  +WFY+N+
Sbjct:    3 RKLDLSGLTDDETEHVLQVVQRDFNLRKKEEERLSELKQKLDEEGSKCSILSKHQQFVEHCCMRCCSPFTFLVNTKRQCGDCKFNVCKSCCSYQKHEKAWVCCVCQQARLLRAQSLEWFYNNV 125          
BLAST of Si:ch211-106h4.9 vs. UniProt/SwissProt
Match: sp|A8T6P4|MYRIP_DANRE (Rab effector MyRIP OS=Danio rerio OX=7955 GN=myrip PE=1 SV=1)

HSP 1 Score: 53.1434 bits (126), Expect = 1.048e-6
Identity = 36/123 (29.27%), Postives = 58/123 (47.15%), Query Frame = 1
Query:   85 RDLNISCLNEEEKSRLLQVLDRNNKLVNHENVRLSRMDTEIKGELK--TYQNKQSKSTAKECLNCSSD----LKDFDGCEKCQKSVCVKCCRSFGSQKVMLCKVCYREMLLEAKKAKWFYDNI 435
            R L++S L+  E   +L+V+ R+ +L   E  RLS M  E++ E       +KQ K     C+ C S     L     C  C  ++C  CC    S++  +C  C +   L  +  +WFY+N+
Sbjct:    3 RKLDLSGLSNNEAEHVLRVVQRDMQLRKKEEERLSEMKQELEEEGSRCLLLSKQQKFNEHCCIRCCSPFTFLLNPKRQCLDCHYNICKSCCSYSQSERGYICAACQKSRHLRTQSLEWFYNNV 125          
BLAST of Si:ch211-106h4.9 vs. UniProt/SwissProt
Match: sp|O54880|RPH3L_RAT (Rab effector Noc2 OS=Rattus norvegicus OX=10116 GN=Rph3al PE=1 SV=1)

HSP 1 Score: 51.6026 bits (122), Expect = 2.006e-6
Identity = 47/168 (27.98%), Postives = 72/168 (42.86%), Query Frame = 1
Query:  103 CLNEEEKSRLLQVLDRNNKLVNHENVRLSRMDTEIKGELKTYQNKQSKSTAKECLNCSSDLKDFDG-----CEKCQKSVCVKCC--RSFGSQK-VMLCKVCYREMLLEAKKAKWFYDNIP------QSTKIDDDNGICPEISQQEERQIQLVSALDDAAYKAAIDRIA 564
            CL+  E   +LQV+ R  +L   E  R+ R+       L+T Q     +   +CL C  ++  F G     C+ C+K VC KC    S G ++ + LCK+C  +  +  +   WFY  +P      ++    DD    P   +  E Q Q  SA     Y  A  R+ 
Sbjct:   46 CLSPGEVEVILQVIQRAERLDILEQQRIGRLVER----LETMQKNVMGNGVSQCLLCG-EMLGFLGSSSVFCKDCRKKVCTKCGIEASPGQKRPLWLCKICSEQREVWKRSGAWFYKGLPKYILPLKTPGRADDPHFRPLPVEPTEPQPQ--SAEVSRVYTWARGRVV 206          
BLAST of Si:ch211-106h4.9 vs. TrEMBL
Match: A0A131YKZ1 (Myosin viia and rab OS=Rhipicephalus appendiculatus OX=34631 PE=4 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 3.214e-8
Identity = 37/122 (30.33%), Postives = 64/122 (52.46%), Query Frame = 1
Query:   85 RDLNISCLNEEEKSRLLQVLDRNNKLVNHENVRLSRMDTEIKGELKTYQNKQS-KSTAKECLNCSSDLKDFDG----CEKCQKSVCVKCCRSFGSQKVMLCKVCYREMLLEAKKAKWFYDNI 435
            R LN+S L++EE  R+L V+ R+ +L   E  RL R++ E++G ++   +++  K   K C +CSS           C +C   VC  C       +   C++C ++  L A+  +WFY+N+
Sbjct:    3 RRLNLSHLSQEECERILAVIQRDLELRAREKERLGRLEEELQGHVRGSAHREVCKDGGKSCAHCSSTFNLLFNRKLVCRECGLFVCRDCATYDSRDRGWYCRLCEQQRSLRAQSCEWFYENV 124          
BLAST of Si:ch211-106h4.9 vs. TrEMBL
Match: A0A224YUB2 (Myosin viia and rab OS=Rhipicephalus zambeziensis OX=60191 PE=4 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 3.257e-8
Identity = 37/122 (30.33%), Postives = 64/122 (52.46%), Query Frame = 1
Query:   85 RDLNISCLNEEEKSRLLQVLDRNNKLVNHENVRLSRMDTEIKGELKTYQNKQS-KSTAKECLNCSSDLKDFDG----CEKCQKSVCVKCCRSFGSQKVMLCKVCYREMLLEAKKAKWFYDNI 435
            R LN+S L++EE  R+L V+ R+ +L   E  RL R++ E++G ++   +++  K   K C +CSS           C +C   VC  C       +   C++C ++  L A+  +WFY+N+
Sbjct:    3 RRLNLSHLSQEECERILAVIQRDLELRAREKERLGRLEEELQGHVRGSAHREVCKDGGKSCAHCSSTFNLLFNRKLVCRECGLFVCRDCATYDSRDRGWYCRLCEQQRSLRAQSCEWFYENV 124          
BLAST of Si:ch211-106h4.9 vs. TrEMBL
Match: A0A131YIH2 (Myosin viia and rab OS=Rhipicephalus appendiculatus OX=34631 PE=4 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 3.294e-8
Identity = 37/122 (30.33%), Postives = 64/122 (52.46%), Query Frame = 1
Query:   85 RDLNISCLNEEEKSRLLQVLDRNNKLVNHENVRLSRMDTEIKGELKTYQNKQS-KSTAKECLNCSSDLKDFDG----CEKCQKSVCVKCCRSFGSQKVMLCKVCYREMLLEAKKAKWFYDNI 435
            R LN+S L++EE  R+L V+ R+ +L   E  RL R++ E++G ++   +++  K   K C +CSS           C +C   VC  C       +   C++C ++  L A+  +WFY+N+
Sbjct:    3 RRLNLSHLSQEECERILAVIQRDLELRAREKERLGRLEEELQGHVRGSAHREVCKDGGKSCAHCSSTFNLLFNRKLVCRECGLFVCRDCATYDSRDRGWYCRLCEQQRSLRAQSCEWFYENV 124          
BLAST of Si:ch211-106h4.9 vs. TrEMBL
Match: A0A224Z4L5 (Myosin viia and rab OS=Rhipicephalus zambeziensis OX=60191 PE=4 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 3.314e-8
Identity = 37/122 (30.33%), Postives = 64/122 (52.46%), Query Frame = 1
Query:   85 RDLNISCLNEEEKSRLLQVLDRNNKLVNHENVRLSRMDTEIKGELKTYQNKQS-KSTAKECLNCSSDLKDFDG----CEKCQKSVCVKCCRSFGSQKVMLCKVCYREMLLEAKKAKWFYDNI 435
            R LN+S L++EE  R+L V+ R+ +L   E  RL R++ E++G ++   +++  K   K C +CSS           C +C   VC  C       +   C++C ++  L A+  +WFY+N+
Sbjct:    3 RRLNLSHLSQEECERILAVIQRDLELRAREKERLGRLEEELQGHVRGSAHREVCKDGGKSCAHCSSTFNLLFNRKLVCRECGLFVCRDCATYDSRDRGWYCRLCEQQRSLRAQSCEWFYENV 124          
BLAST of Si:ch211-106h4.9 vs. TrEMBL
Match: A0A131YIM5 (Myosin viia and rab OS=Rhipicephalus appendiculatus OX=34631 PE=4 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 3.314e-8
Identity = 37/122 (30.33%), Postives = 64/122 (52.46%), Query Frame = 1
Query:   85 RDLNISCLNEEEKSRLLQVLDRNNKLVNHENVRLSRMDTEIKGELKTYQNKQS-KSTAKECLNCSSDLKDFDG----CEKCQKSVCVKCCRSFGSQKVMLCKVCYREMLLEAKKAKWFYDNI 435
            R LN+S L++EE  R+L V+ R+ +L   E  RL R++ E++G ++   +++  K   K C +CSS           C +C   VC  C       +   C++C ++  L A+  +WFY+N+
Sbjct:    3 RRLNLSHLSQEECERILAVIQRDLELRAREKERLGRLEEELQGHVRGSAHREVCKDGGKSCAHCSSTFNLLFNRKLVCRECGLFVCRDCATYDSRDRGWYCRLCEQQRSLRAQSCEWFYENV 124          
BLAST of Si:ch211-106h4.9 vs. Ensembl Cavefish
Match: si:ch211-106h4.9 (rab effector MyRIP-like [Source:NCBI gene;Acc:103028056])

HSP 1 Score: 62.003 bits (149), Expect = 1.930e-10
Identity = 39/123 (31.71%), Postives = 61/123 (49.59%), Query Frame = 1
Query:   85 RDLNISCLNEEEKSRLLQVLDRNNKLVNHENVRLSRMDTEIKGELK--TYQNKQSKSTAKECLNCSSD----LKDFDGCEKCQKSVCVKCCRSFGSQKVMLCKVCYREMLLEAKKAKWFYDNI 435
            R L++S L EEE   +LQV+ R+ +L   E  RLS +  E+  E       ++Q     + C+ C S     LK    C  C  ++C +CC    ++K  LC  C +  LL+ +  +WFY N+
Sbjct:    4 RKLDLSTLTEEEAEHVLQVVQRDMRLRKTEEERLSDLKQELDEEDSRCVLLSRQQGFNQRCCIRCCSPFTFLLKPRRRCLDCNYNICKRCCSYSSTEKGWLCSACEKSRLLKTQSLEWFYSNV 126          
BLAST of Si:ch211-106h4.9 vs. Ensembl Cavefish
Match: si:ch211-106h4.9 (rab effector MyRIP-like [Source:NCBI gene;Acc:103028056])

HSP 1 Score: 62.003 bits (149), Expect = 2.026e-10
Identity = 39/123 (31.71%), Postives = 61/123 (49.59%), Query Frame = 1
Query:   85 RDLNISCLNEEEKSRLLQVLDRNNKLVNHENVRLSRMDTEIKGELK--TYQNKQSKSTAKECLNCSSD----LKDFDGCEKCQKSVCVKCCRSFGSQKVMLCKVCYREMLLEAKKAKWFYDNI 435
            R L++S L EEE   +LQV+ R+ +L   E  RLS +  E+  E       ++Q     + C+ C S     LK    C  C  ++C +CC    ++K  LC  C +  LL+ +  +WFY N+
Sbjct:    4 RKLDLSTLTEEEAEHVLQVVQRDMRLRKTEEERLSDLKQELDEEDSRCVLLSRQQGFNQRCCIRCCSPFTFLLKPRRRCLDCNYNICKRCCSYSSTEKGWLCSACEKSRLLKTQSLEWFYSNV 126          
BLAST of Si:ch211-106h4.9 vs. Ensembl Cavefish
Match: sytl4 (synaptotagmin like 4 [Source:NCBI gene;Acc:103045066])

HSP 1 Score: 50.0618 bits (118), Expect = 1.195e-6
Identity = 33/126 (26.19%), Postives = 58/126 (46.03%), Query Frame = 1
Query:   79 TLRDLNISCLNEEEKSRLLQVLDRNNKLVNHENVRLSRMDTEI-----KGELKTYQNKQSKSTAKECLNCSSDLKDFDG----CEKCQKSVCVKCCRSFGSQKVMLCKVCYREMLLEAKKAKWFYD 429
            ++  +N+S L + E+  +L VL R+ +L + E  R+ R+  E+     KG  ++  N  ++S    C  C   +         C  C+  VC + C +    +  +C VC +E  L+     WFYD
Sbjct:    4 SMETINVSFLTDSERDLILNVLRRDEELRHLEEKRVKRLKFELLEIRRKGAKRSSGNYSTRS----CGRCQQPMGRLGSRTNQCPVCKHEVC-QNCHAVRPNRAWVCSVCAKEADLKKSTGDWFYD 124          
BLAST of Si:ch211-106h4.9 vs. Ensembl Cavefish
Match: sytl4 (synaptotagmin like 4 [Source:NCBI gene;Acc:103045066])

HSP 1 Score: 48.9062 bits (115), Expect = 2.739e-6
Identity = 33/126 (26.19%), Postives = 58/126 (46.03%), Query Frame = 1
Query:   79 TLRDLNISCLNEEEKSRLLQVLDRNNKLVNHENVRLSRMDTEI-----KGELKTYQNKQSKSTAKECLNCSSDLKDFDG----CEKCQKSVCVKCCRSFGSQKVMLCKVCYREMLLEAKKAKWFYD 429
            ++  +N+S L + E+  +L VL R+ +L + E  R+ R+  E+     KG  ++  N  ++S    C  C   +         C  C+  VC + C +    +  +C VC +E  L+     WFYD
Sbjct:    4 SMETINVSFLTDSERDLILNVLRRDEELRHLEEKRVKRLKFELLEIRRKGAKRSSGNYSTRS----CGRCQQPMGRLGSRTNQCPVCKHEVC-QNCHAVRPNRAWVCSVCAKEADLKKSTGDWFYD 124          
BLAST of Si:ch211-106h4.9 vs. Ensembl Cavefish
Match: RIMS2 (regulating synaptic membrane exocytosis 2 [Source:HGNC Symbol;Acc:HGNC:17283])

HSP 1 Score: 48.9062 bits (115), Expect = 3.909e-6
Identity = 43/137 (31.39%), Postives = 61/137 (44.53%), Query Frame = 1
Query:   61 SIAKPLTLRDLNISCLNEEEKSRLLQVLDRNNKLVNHENVRLSRMDTEI---KGELK-----TYQNKQSKSTAKECLNCSSDLKDFDG----CEKCQKSVCVKCCR--SFGSQKVM-LCKVCYREMLLEAKKAKWFY 426
            S A P  + DL  S L EEE+  +L V+DR  K    E   L ++  +    K ++K     T + +  KS +  C  C    K  DG    C  CQ   C +C    S  S KVM +C +C ++  +  K   WFY
Sbjct:   10 SPAAPPDMPDL--SHLTEEERKIILSVMDRQKKEEEKEQSMLKKLHQQFEMYKDQVKKIGEETQKTQDQKSDSPTCGICHKT-KFADGCGHVCSYCQTKFCARCGGRVSLRSNKVMWVCNLCRKQQEILTKSGAWFY 143          
BLAST of Si:ch211-106h4.9 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009931.1 (pep scaffold:Pmarinus_7.0:GL476634:726032:749970:1 gene:ENSPMAG00000008982.1 transcript:ENSPMAT00000009931.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 45.0542 bits (105), Expect = 5.572e-6
Identity = 34/122 (27.87%), Postives = 63/122 (51.64%), Query Frame = 1
Query:  106 LNEEEKSRLLQVLDRNNKLVNHENVRLSRMDTEI--KGELKTYQNKQSKSTAKECLNCSSD-LKDFDGCEKCQKSVCVKCCR---SFGSQ-KVMLCKVCYREMLLEAKKAKWFYDNIPQSTK 450
            L+++E + +++VL R+  L   E+ ++  +   +  K  +     +Q     K C+ C S  L   +  E+CQ S C+  CR   ++  Q K  LC VC ++ LL+A+  +W+YD + +  K
Sbjct:   10 LSQDEAAHIMEVLQRDAHLRQLEDRKIGELKEHLQEKKSMMGLLARQEAFNDKCCILCYSPFLILINSRERCQ-SCCLYVCRDCSAYNRQAKARLCSVCLKQRLLKARSFEWYYDTVRKRFK 130          
BLAST of Si:ch211-106h4.9 vs. Ensembl Medaka
Match: myrip (myosin VIIA and Rab interacting protein [Source:NCBI gene;Acc:101165516])

HSP 1 Score: 56.6102 bits (135), Expect = 1.017e-8
Identity = 36/123 (29.27%), Postives = 59/123 (47.97%), Query Frame = 1
Query:   85 RDLNISCLNEEEKSRLLQVLDRNNKLVNHENVRLSRMDTEI--KGELKTYQNKQSKSTAKECLNCSSD----LKDFDGCEKCQKSVCVKCCRSFGSQKVMLCKVCYREMLLEAKKAKWFYDNI 435
            R L++S L ++E   +L+V+ R+ KL   E  RLS M  E+  +G   +  +KQ +     C+ C +     L     C  CQ +VC  CC      K  LC  C +  +   +  +W+Y+N+
Sbjct:    3 RKLDLSGLTDDEAEHVLKVVQRDMKLRKKEEARLSEMKQELAEEGSRCSILSKQQRFNEHCCIRCCAPFTFLLNPKRQCLDCQYNVCKTCCTYSKKDKAWLCSACQKGRIYRTQSLEWYYNNV 125          
BLAST of Si:ch211-106h4.9 vs. Ensembl Medaka
Match: si:ch211-106h4.9 (rab effector MyRIP [Source:NCBI gene;Acc:101164255])

HSP 1 Score: 53.5286 bits (127), Expect = 1.054e-7
Identity = 38/124 (30.65%), Postives = 63/124 (50.81%), Query Frame = 1
Query:   85 RDLNISCLNEEEKSRLLQVLDRNNKLVNHENVRLSRMDTEI--KGELKTYQNKQSKSTAKECLNCSSD----LKDFDGCEKCQKSVCVKCCRSFGSQ-KVMLCKVCYREMLLEAKKAKWFYDNI 435
            R L+++ L E E + +LQV+ R+ KL   +  RLS +  E+  +G      ++Q+    + C+ C S     L     C  C  +VC K CR +  + ++ LC  C +  LL+A   +WFY N+
Sbjct:    3 RKLDLTGLTEGEAAHVLQVVQRDMKLRKKDEERLSELKQELDEEGSRCLLLSRQTCFNRRCCIRCCSPFSFLLNPKRQCSSCSYNVC-KACRVYNKRDRIWLCSACQKSRLLKALSLEWFYSNV 125          
BLAST of Si:ch211-106h4.9 vs. Ensembl Medaka
Match: si:ch211-106h4.9 (rab effector MyRIP [Source:NCBI gene;Acc:101164255])

HSP 1 Score: 53.5286 bits (127), Expect = 1.120e-7
Identity = 38/124 (30.65%), Postives = 63/124 (50.81%), Query Frame = 1
Query:   85 RDLNISCLNEEEKSRLLQVLDRNNKLVNHENVRLSRMDTEI--KGELKTYQNKQSKSTAKECLNCSSD----LKDFDGCEKCQKSVCVKCCRSFGSQ-KVMLCKVCYREMLLEAKKAKWFYDNI 435
            R L+++ L E E + +LQV+ R+ KL   +  RLS +  E+  +G      ++Q+    + C+ C S     L     C  C  +VC K CR +  + ++ LC  C +  LL+A   +WFY N+
Sbjct:    3 RKLDLTGLTEGEAAHVLQVVQRDMKLRKKDEERLSELKQELDEEGSRCLLLSRQTCFNRRCCIRCCSPFSFLLNPKRQCSSCSYNVC-KACRVYNKRDRIWLCSACQKSRLLKALSLEWFYSNV 125          
BLAST of Si:ch211-106h4.9 vs. Ensembl Medaka
Match: sytl4 (synaptotagmin like 4 [Source:NCBI gene;Acc:101163586])

HSP 1 Score: 49.6766 bits (117), Expect = 1.616e-6
Identity = 36/124 (29.03%), Postives = 64/124 (51.61%), Query Frame = 1
Query:   76 LTLRDLNISCLNEEEKSRLLQVLDRNNKLVNHENVRLSRMDTEI-----KGELKTYQNKQSKSTAKECLNCSSDLKDFDG-CEKCQKSVCVKCCRSFGSQKVMLCKVCYREMLLEAKKAKWFYD 429
            + L  +N+S L++ E+ ++L+VL R+ +L   E  R+ ++ TE+     KG  K    K S+ +   C    S L  F+  C+ C+ +VC + C++        C VC +E  ++ +   WFYD
Sbjct:    1 MALEMINLSFLSDLEREKILEVLKRDEELRLTEERRVRKLKTELLEVKRKGA-KRSSGKYSEHSCGRCQEPLSRLAVFNSQCKICKHNVC-RNCQAVLPDGSWFCTVCVKESDVKKRTGDWFYD 122          
BLAST of Si:ch211-106h4.9 vs. Ensembl Medaka
Match: sytl4 (synaptotagmin like 4 [Source:NCBI gene;Acc:101163586])

HSP 1 Score: 49.6766 bits (117), Expect = 1.678e-6
Identity = 36/124 (29.03%), Postives = 64/124 (51.61%), Query Frame = 1
Query:   76 LTLRDLNISCLNEEEKSRLLQVLDRNNKLVNHENVRLSRMDTEI-----KGELKTYQNKQSKSTAKECLNCSSDLKDFDG-CEKCQKSVCVKCCRSFGSQKVMLCKVCYREMLLEAKKAKWFYD 429
            + L  +N+S L++ E+ ++L+VL R+ +L   E  R+ ++ TE+     KG  K    K S+ +   C    S L  F+  C+ C+ +VC + C++        C VC +E  ++ +   WFYD
Sbjct:    1 MALEMINLSFLSDLEREKILEVLKRDEELRLTEERRVRKLKTELLEVKRKGA-KRSSGKYSEHSCGRCQEPLSRLAVFNSQCKICKHNVC-RNCQAVLPDGSWFCTVCVKESDVKKRTGDWFYD 122          
BLAST of Si:ch211-106h4.9 vs. Planmine SMEST
Match: SMESG000026729.1 (SMESG000026729.1)

HSP 1 Score: 477.248 bits (1227), Expect = 5.614e-173
Identity = 234/236 (99.15%), Postives = 235/236 (99.58%), Query Frame = 1
Query:   58 MSIAKPLTLRDLNISCLNEEEKSRLLQVLDRNNKLVNHENVRLSRMDTEIKGELKTYQNKQSKSTAKECLNCSSDLKDFDGCEKCQKSVCVKCCRSFGSQKVMLCKVCYREMLLEAKKAKWFYDNIPQSTKIDDDNGICPEISQQEERQIQLVSALDDAAYKAAIDRIADKLNEIDVENTNLSKSRFGPKKTFGKPPVSQQKDKLKSTSQSEKENKENKLAMDNFIAKITEYNEQM 765
            MSIAKPLTLRDLNISCLNEEEKSRLLQVLDRNNKLVNHENVRLSRMDTEIKGELKTYQNKQSKSTAKECLNCSSDLKDFDGCEKCQKSVCVKCCRSFGSQKVMLCKVCYREMLLEAKKAKWFYDNIPQSTKIDDDNGICPEISQQEERQIQLVSALDDAAYKAAIDRIADKLNEIDVENTNLSKSRFGPKKTFGKP VSQQ+DKLKSTSQSEKENKENKLAMDNFIAKITEYNEQM
Sbjct:    1 MSIAKPLTLRDLNISCLNEEEKSRLLQVLDRNNKLVNHENVRLSRMDTEIKGELKTYQNKQSKSTAKECLNCSSDLKDFDGCEKCQKSVCVKCCRSFGSQKVMLCKVCYREMLLEAKKAKWFYDNIPQSTKIDDDNGICPEISQQEERQIQLVSALDDAAYKAAIDRIADKLNEIDVENTNLSKSRFGPKKTFGKPQVSQQRDKLKSTSQSEKENKENKLAMDNFIAKITEYNEQM 236          
BLAST of Si:ch211-106h4.9 vs. Planmine SMEST
Match: SMESG000078217.1 (SMESG000078217.1)

HSP 1 Score: 49.6766 bits (117), Expect = 1.488e-6
Identity = 41/151 (27.15%), Postives = 60/151 (39.74%), Query Frame = 1
Query:  106 LNEEEKSRLLQVLDRNNKLVNHENVRLSRMDT--------EIKGEL----------KTYQNKQSK--------------STAKECLNCSSDLK---------DFDGCEKCQKSVCVKCCRSFGSQKVMLCKVCYREMLLEAKKAKWFYDNI 435
            L E EK +L  VL+RN KL   E+ RL ++ +        EI  E             Y+N  S+              +    C++C              +   C  C+  +C KC        V +CK C++ +L EAK  KWFY+NI
Sbjct:   19 LTESEKKKLEVVLNRNEKLNKKEHARLRKLSSTESESTFVEICPEYNLSTRSLNSCHLYRNSVSEIMKENFKKNNTLEINLIGNCISCGRRFSILPWSCASPNGSSCILCKSKMCKKCTHHMDRPNVEICKSCHKNILFEAKSGKWFYNNI 169          
BLAST of Si:ch211-106h4.9 vs. Planmine SMEST
Match: SMESG000010162.1 (SMESG000010162.1)

HSP 1 Score: 48.521 bits (114), Expect = 3.222e-6
Identity = 45/177 (25.42%), Postives = 81/177 (45.76%), Query Frame = 1
Query:  118 EKSRLLQVLDRNNKLVNHENVRLSRMDTEIKGELKTYQNKQSKSTAKECLNCSSDL----KDFDGCEKCQKSVCVKCCRSFGSQKVM-LCKVCYREMLLEAKKAKWFYDNIPQSTK---IDDDNGICPEISQQEERQIQLVSALDDAAYKAAIDRIADKLNEIDVENTNLSKSRFGP 624
            E  +L+ VL++N  +   E+ R+  ++ E+    K  +  + K+    C  C+S         + C+ CQ  VC  C     S KVM LCK+CY+E L + K   W  +   ++ +   + + N   P I ++ ER +Q     +   Y  A D    +++ +  +  NL  +R+ P
Sbjct:   24 EIKKLMVVLNKNEDIERRESKRVKMLERELNFFRKIIREIEIKTN--HCSICNSQFIICFNPVNICQFCQNEVCGNCMVFIKSPKVMQLCKLCYKEWLKQVKSGNWLLEIAKETDRQISVLERNQKLPMIQKEIERLLQ-----EKVEYSKAND-FKTQIDNLICKKDNLHTNRYEP 192          
BLAST of Si:ch211-106h4.9 vs. Planmine SMEST
Match: SMESG000014370.1 (SMESG000014370.1)

HSP 1 Score: 46.9802 bits (110), Expect = 9.778e-6
Identity = 32/125 (25.60%), Postives = 58/125 (46.40%), Query Frame = 1
Query:   97 ISCLNEEEKSRLLQVLDRNNKLVNHENVRLSRMDTEIKGELKTYQNKQSKSTAKECLNCS-----SDLKDFDGCEKCQKSVCVKCCRSFGSQKVMLCKVCYREMLLEAKKAKWFYDNIPQSTKID 456
            I  +NE E +R+ ++      +++ EN +LS     +    K  +N    S    CL+       S  +    C  CQ  VC  C RS   +K+ +C  C+++++L+AK   WF+  + +   +D
Sbjct:   38 IDAINELEANRIRRL---KTLIISQENAKLS----SVHPNNKALKNLLCHSCGSYCLSSRIAIGKSSTRSSILCRICQLPVCHSCWRSVVDKKLKICPSCHKKIVLDAKTGNWFHQQMKKRLSVD 155          
The following BLAST results are available for this feature:
BLAST of Si:ch211-106h4.9 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MYRIP8.763e-829.27myosin VIIA and Rab interacting protein [Source:HG... [more]
MYRIP8.927e-829.27myosin VIIA and Rab interacting protein [Source:HG... [more]
MYRIP8.927e-829.27myosin VIIA and Rab interacting protein [Source:HG... [more]
MYRIP9.337e-829.27myosin VIIA and Rab interacting protein [Source:HG... [more]
SYTL41.220e-630.33synaptotagmin like 4 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of Si:ch211-106h4.9 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Si:ch211-106h4.9 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Si:ch211-106h4.9 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-106h4.93.696e-827.64si:ch211-106h4.9 [Source:ZFIN;Acc:ZDB-GENE-070705-... [more]
myrip5.141e-829.27Danio rerio myosin VIIA and Rab interacting protei... [more]
si:ch211-106h4.95.912e-827.34si:ch211-106h4.9 [Source:ZFIN;Acc:ZDB-GENE-070705-... [more]
si:ch211-106h4.98.276e-827.64si:ch211-106h4.9 [Source:ZFIN;Acc:ZDB-GENE-070705-... [more]
sytl41.201e-728.93synaptotagmin-like 4 [Source:ZFIN;Acc:ZDB-GENE-070... [more]
back to top
BLAST of Si:ch211-106h4.9 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rph3al5.364e-831.67rabphilin 3A like (without C2 domains) [Source:NCB... [more]
rph3al5.885e-831.67rabphilin 3A like (without C2 domains) [Source:NCB... [more]
rph3al6.154e-831.67rabphilin 3A like (without C2 domains) [Source:NCB... [more]
rph3al6.217e-831.67rabphilin 3A like (without C2 domains) [Source:NCB... [more]
selenon4.191e-728.46selenoprotein N [Source:Xenbase;Acc:XB-GENE-645684... [more]
back to top
BLAST of Si:ch211-106h4.9 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Myrip5.781e-930.89myosin VIIA and Rab interacting protein [Source:MG... [more]
Myrip6.307e-930.47myosin VIIA and Rab interacting protein [Source:MG... [more]
Rph3al5.122e-730.58rabphilin 3A-like (without C2 domains) [Source:MGI... [more]
Rph3al5.122e-730.58rabphilin 3A-like (without C2 domains) [Source:MGI... [more]
Sytl47.979e-629.51synaptotagmin-like 4 [Source:MGI Symbol;Acc:MGI:13... [more]
back to top
BLAST of Si:ch211-106h4.9 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7TNY7|MYRIP_RAT3.935e-830.89Rab effector MyRIP OS=Rattus norvegicus OX=10116 G... [more]
sp|Q8K3I4|MYRIP_MOUSE4.044e-830.89Rab effector MyRIP OS=Mus musculus OX=10090 GN=Myr... [more]
sp|Q8NFW9|MYRIP_HUMAN4.287e-729.27Rab effector MyRIP OS=Homo sapiens OX=9606 GN=MYRI... [more]
sp|A8T6P4|MYRIP_DANRE1.048e-629.27Rab effector MyRIP OS=Danio rerio OX=7955 GN=myrip... [more]
sp|O54880|RPH3L_RAT2.006e-627.98Rab effector Noc2 OS=Rattus norvegicus OX=10116 GN... [more]
back to top
BLAST of Si:ch211-106h4.9 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A131YKZ13.214e-830.33Myosin viia and rab OS=Rhipicephalus appendiculatu... [more]
A0A224YUB23.257e-830.33Myosin viia and rab OS=Rhipicephalus zambeziensis ... [more]
A0A131YIH23.294e-830.33Myosin viia and rab OS=Rhipicephalus appendiculatu... [more]
A0A224Z4L53.314e-830.33Myosin viia and rab OS=Rhipicephalus zambeziensis ... [more]
A0A131YIM53.314e-830.33Myosin viia and rab OS=Rhipicephalus appendiculatu... [more]
back to top
BLAST of Si:ch211-106h4.9 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-106h4.91.930e-1031.71rab effector MyRIP-like [Source:NCBI gene;Acc:1030... [more]
si:ch211-106h4.92.026e-1031.71rab effector MyRIP-like [Source:NCBI gene;Acc:1030... [more]
sytl41.195e-626.19synaptotagmin like 4 [Source:NCBI gene;Acc:1030450... [more]
sytl42.739e-626.19synaptotagmin like 4 [Source:NCBI gene;Acc:1030450... [more]
RIMS23.909e-631.39regulating synaptic membrane exocytosis 2 [Source:... [more]
back to top
BLAST of Si:ch211-106h4.9 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000009931.15.572e-627.87pep scaffold:Pmarinus_7.0:GL476634:726032:749970:1... [more]
back to top
BLAST of Si:ch211-106h4.9 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Si:ch211-106h4.9 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Si:ch211-106h4.9 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
myrip1.017e-829.27myosin VIIA and Rab interacting protein [Source:NC... [more]
si:ch211-106h4.91.054e-730.65rab effector MyRIP [Source:NCBI gene;Acc:101164255... [more]
si:ch211-106h4.91.120e-730.65rab effector MyRIP [Source:NCBI gene;Acc:101164255... [more]
sytl41.616e-629.03synaptotagmin like 4 [Source:NCBI gene;Acc:1011635... [more]
sytl41.678e-629.03synaptotagmin like 4 [Source:NCBI gene;Acc:1011635... [more]
back to top
BLAST of Si:ch211-106h4.9 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000026729.15.614e-17399.15SMESG000026729.1[more]
SMESG000078217.11.488e-627.15SMESG000078217.1[more]
SMESG000010162.13.222e-625.42SMESG000010162.1[more]
SMESG000014370.19.778e-625.60SMESG000014370.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024475 ID=SMED30024475|Name=Si:ch211-106h4.9|organism=Schmidtea mediterranea sexual|type=transcript|length=814bp
GGTCATCTAGTGCAAAGCATTATTTGACCATAATTATTCATAACTGTATT
GTCAACAATGTCAATAGCGAAACCTTTAACTTTGCGCGATCTTAATATAA
GTTGTTTAAATGAAGAGGAAAAATCTCGATTACTTCAAGTTTTGGATAGA
AATAACAAACTGGTAAATCATGAAAATGTTCGTTTAAGTCGAATGGATAC
TGAAATCAAAGGAGAACTGAAAACGTATCAGAATAAACAATCAAAGTCAA
CGGCAAAAGAATGTCTAAACTGTTCGAGCGATCTTAAGGACTTTGACGGA
TGTGAAAAATGCCAGAAAAGTGTTTGTGTAAAATGCTGTCGGTCTTTCGG
TTCTCAAAAAGTGATGCTATGCAAAGTCTGTTACAGAGAAATGTTGCTGG
AAGCGAAAAAGGCTAAATGGTTTTATGACAACATTCCACAATCCACAAAA
ATTGACGATGACAATGGAATTTGTCCGGAGATCTCCCAGCAGGAAGAACG
ACAAATCCAACTGGTGAGTGCGCTAGATGACGCGGCATACAAGGCAGCGA
TTGATAGAATCGCGGATAAATTAAACGAAATTGACGTTGAGAACACAAAT
TTGTCGAAATCCCGTTTTGGACCGAAGAAAACATTCGGTAAACCTCCGGT
TTCCCAGCAAAAGGATAAGCTGAAAAGTACTTCTCAAAGCGAAAAAGAAA
ACAAGGAAAACAAACTTGCAATGGATAATTTCATAGCGAAAATTACCGAA
TACAATGAACAAATGAAAAAATAAAATTAAAAAAAGATTGAAAAAACACG
ATGAAATTGAACAA
back to top

protein sequence of SMED30024475-orf-1

>SMED30024475-orf-1 ID=SMED30024475-orf-1|Name=SMED30024475-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=239bp
MSIAKPLTLRDLNISCLNEEEKSRLLQVLDRNNKLVNHENVRLSRMDTEI
KGELKTYQNKQSKSTAKECLNCSSDLKDFDGCEKCQKSVCVKCCRSFGSQ
KVMLCKVCYREMLLEAKKAKWFYDNIPQSTKIDDDNGICPEISQQEERQI
QLVSALDDAAYKAAIDRIADKLNEIDVENTNLSKSRFGPKKTFGKPPVSQ
QKDKLKSTSQSEKENKENKLAMDNFIAKITEYNEQMKK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0046872metal ion binding
GO:0017137Rab GTPase binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR041282FYVE_2
IPR013083Znf_RING/FYVE/PHD
IPR011011Znf_FYVE_PHD
IPR010911Rab_BD
Vocabulary: biological process
TermDefinition
GO:0006886intracellular protein transport
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 6..146
e-value: 4.4E-19
score: 70.3
IPR041282FYVE-type zinc fingerPFAMPF02318FYVE_2coord: 15..126
e-value: 1.7E-14
score: 54.0
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 186..220
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 206..220
IPR010911Rab-binding domainPROSITEPS50916RABBDcoord: 11..125
score: 10.35
IPR011011Zinc finger, FYVE/PHD-typeSUPERFAMILYSSF57903FYVE/PHD zinc fingercoord: 17..131