Acid-sensing ion channel 4

Overview
NameAcid-sensing ion channel 4
Smed IDSMED30024465
Length (bp)2047
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Acid-sensing ion channel 4 (SMED30024465) t-SNE clustered cells

Violin plots show distribution of expression levels for Acid-sensing ion channel 4 (SMED30024465) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Acid-sensing ion channel 4 (SMED30024465) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Acid-sensing ion channel 4 (SMED30024465) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024465

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30024465h1SMcG0011547 SmedASXL_011935SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30024465h1SMcG0011547 SmedASXL_005940SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30024465h1SMcG0011547 dd_Smed_v4_15233_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30024465h1SMcG0011547 dd_Smed_v4_15233_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30024465h1SMcG0011547 dd_Smed_v4_15233_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30024465h1SMcG0011547 dd_Smed_v4_15233_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30024465h1SMcG0011547 dd_Smed_v6_15233_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Acid-sensing ion channel 4 vs. TrEMBL
Match: A0A3Q0KSB5 (Acid sensing ion channel 4, pituitary, putative OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 3.624e-18
Identity = 124/492 (25.20%), Postives = 212/492 (43.09%), Query Frame = 1
Query:   88 NKSSKLKFCSSKRILYGFIWLLIFGIMSYRIIDWGNQYFWSRD----NKINFAR----------ANNAPKILIKP---------YLLLCNVNPIRGTRIFLMSNGSKXXXXXXXXXXXXXXXQKGILKVLKQ--SMINKKLLIECSHKMEDMLKECKLNGKNCPKSSFETIWYNSRICHXXXXXXXXXXXXLTLDPEEFDYIIPNNGFVGFRLMLTDSQSHYTPVYD--------------------------------SIMAGPFYQTNVKIKLSKNI--TSTNQDN--CRGNSLDFSECSVKIQVNNSKRESQFQTVS-----------SQIFISSQYYKSPFFSTLLAPKSLRSIMRNGELLKNANLIQQRAYLRYTDKSIFYDLQQLTSVFRTLFQSLEQLHKQLIH-LNISVNSDHRHINHLSTSQTKCGSNFGAILHSLRQMLKQYQNFQTEFPTMRRLRYF---------NKYQPERNELSILNM 1317
            N S   K C   R+    I LLIF  + YRIID+ N+Y   +     NK + ++           NN    +I            + LCN+NPIRG+ +F + NGSKIYD I     +   +  GI K +     +I+K LL    HK+ +MLK C +  + C   +F ++      C+++ +  S+ ++ + LD +++DYIIP+ G +GF L +  ++   + + D                                 I     +QT +++ L  N+    TN  N  C   S  F EC      N+    S+  T+S           ++I  ++Q  K+    +LLA ++    +RN   L+    IQQRA+++ T+++ F +L+ L   +  L   L  + KQL+H + I +  D R    ++ + + C      ++     ++   Q+F+ E   +  +  F         N  QP  +  S LNM
Sbjct:  305 NLSKYFKCC--HRLTMLLICLLIFTCLCYRIIDYFNRYEMMKSLFVYNKFHLSKRSTYKNNNDHENNKLLSMIPEEEHNISNWFTITLCNLNPIRGSALFTIQNGSKIYDNIIKIRQNEIDFN-GITKKVNDNNGLISKALLKRTGHKLNEMLKFCYIGNEKCSHRNFTSVLTIYGQCYRMKLKPSVHEVRIVLDSQDYDYIIPHKGLIGFHLWIHPNEQKASYILDLKDDKDNLWKNTQNENAVDFNSLQQSNVIQSNEITVSTEFQTLIRVALDMNVHYKQTNMKNRLC-STSTGFKECEQNANQNSPTDLSE-DTISFSDKYNHNVWNARIVSATQSSKATIMYSLLALRNPNLFIRNKIDLERGLRIQQRAFIQLTNETAFNELRNLVPNYDDLRNQLISI-KQLLHEIEIGIWRDQREALQMTPTDSVCSK---MVIGYFETLINIIQSFKDELCKLSSVDVFYTTGFFNCLNHSQPMYDYHSQLNM 787          
BLAST of Acid-sensing ion channel 4 vs. TrEMBL
Match: A0A5K4EVP9 (Acid sensing ion channel 4, pituitary, putative OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 3.988e-18
Identity = 124/492 (25.20%), Postives = 212/492 (43.09%), Query Frame = 1
Query:   88 NKSSKLKFCSSKRILYGFIWLLIFGIMSYRIIDWGNQYFWSRD----NKINFAR----------ANNAPKILIKP---------YLLLCNVNPIRGTRIFLMSNGSKXXXXXXXXXXXXXXXQKGILKVLKQ--SMINKKLLIECSHKMEDMLKECKLNGKNCPKSSFETIWYNSRICHXXXXXXXXXXXXLTLDPEEFDYIIPNNGFVGFRLMLTDSQSHYTPVYD--------------------------------SIMAGPFYQTNVKIKLSKNI--TSTNQDN--CRGNSLDFSECSVKIQVNNSKRESQFQTVS-----------SQIFISSQYYKSPFFSTLLAPKSLRSIMRNGELLKNANLIQQRAYLRYTDKSIFYDLQQLTSVFRTLFQSLEQLHKQLIH-LNISVNSDHRHINHLSTSQTKCGSNFGAILHSLRQMLKQYQNFQTEFPTMRRLRYF---------NKYQPERNELSILNM 1317
            N S   K C   R+    I LLIF  + YRIID+ N+Y   +     NK + ++           NN    +I            + LCN+NPIRG+ +F + NGSKIYD I     +   +  GI K +     +I+K LL    HK+ +MLK C +  + C   +F ++      C+++ +  S+ ++ + LD +++DYIIP+ G +GF L +  ++   + + D                                 I     +QT +++ L  N+    TN  N  C   S  F EC      N+    S+  T+S           ++I  ++Q  K+    +LLA ++    +RN   L+    IQQRA+++ T+++ F +L+ L   +  L   L  + KQL+H + I +  D R    ++ + + C      ++     ++   Q+F+ E   +  +  F         N  QP  +  S LNM
Sbjct:  305 NLSKYFKCC--HRLTMLLICLLIFTCLCYRIIDYFNRYEMMKSLFVYNKFHLSKRSTYKNNNDHENNKLLSMIPEEEHNISNWFTITLCNLNPIRGSALFTIQNGSKIYDNIIKIRQNEIDFN-GITKKVNDNNGLISKALLKRTGHKLNEMLKFCYIGNEKCSHRNFTSVLTIYGQCYRMKLKPSVHEVRIVLDSQDYDYIIPHKGLIGFHLWIHPNEQKASYILDLKDDKDNLWKNTQNENAVDFNSLQQSNVIQSNEITVSTEFQTLIRVALDMNVHYKQTNMKNRLC-STSTGFKECEQNANQNSPTDLSE-DTISFSDKYNHNVWNARIVSATQSSKATIMYSLLALRNPNLFIRNKIDLERGLRIQQRAFIQLTNETAFNELRNLVPNYDDLRNQLISI-KQLLHEIEIGIWRDQREALQMTPTDSVCSK---MVIGYFETLINIIQSFKDELCKLSSVDVFYTTGFFNCLNHSQPMYDYHSQLNM 787          
BLAST of Acid-sensing ion channel 4 vs. TrEMBL
Match: G4LXJ7 (Acid sensing ion channel 4, pituitary, putative OS=Schistosoma mansoni OX=6183 GN=Smp_167450 PE=3 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 5.029e-18
Identity = 123/492 (25.00%), Postives = 212/492 (43.09%), Query Frame = 1
Query:  106 KFCSSK------RILYGFIWLLIFGIMSYRIIDWGNQYFWSRD----NKINFAR----------ANNAPKILIKP---------YLLLCNVNPIRGTRIFLMSNGSKXXXXXXXXXXXXXXXQKGILKVLKQ--SMINKKLLIECSHKMEDMLKECKLNGKNCPKSSFETIWYNSRICHXXXXXXXXXXXXLTLDPEEFDYIIPNNGFVGFRLMLTDSQSHYTPVYD--------------------------------SIMAGPFYQTNVKIKLSKNI--TSTNQDN--CRGNSLDFSECSVKIQVNNSKRESQFQTVS-----------SQIFISSQYYKSPFFSTLLAPKSLRSIMRNGELLKNANLIQQRAYLRYTDKSIFYDLQQLTSVFRTLFQSLEQLHKQLIH-LNISVNSDHRHINHLSTSQTKCGSNFGAILHSLRQMLKQYQNFQTEFPTMRRLRYF---------NKYQPERNELSILNM 1317
            KF S K      ++    I LLIF  + YRIID+ N+Y   +     NK + ++           NN    +I            + LCN+NPIRG+ +F + NGSKIYD I     +   +  GI K +     +I+K LL    HK+ +MLK C +  + C   +F ++      C+++ +  S+ ++ + LD +++DYIIP+ G +GF L +  ++   + + D                                 I     +QT +++ L  N+    TN  N  C   S  F EC      N+    S+  T+S           ++I  ++Q  K+    +LLA ++    +RN   L+    IQQRA+++ T+++ F +L+ L   +  L   L  + KQL+H + I +  D R    ++ + + C      ++     ++   Q+F+ E   +  +  F         N  QP  +  S LNM
Sbjct:    7 KFVSEKEKNPFRKLTMLLICLLIFTCLCYRIIDYFNRYEMMKSLFVYNKFHLSKRSTYKNNNDHENNKLLSMIPEEEHNISNWFTITLCNLNPIRGSALFTIQNGSKIYDNIIKIRQNEIDFN-GITKKVNDNNGLISKALLKRTGHKLNEMLKFCYIGNEKCSHRNFTSVLTIYGQCYRMKLKPSVHEVRIVLDSQDYDYIIPHKGLIGFHLWIHPNEQKASYILDLKDDKDNLWKNTQNENAVDFNSLQQSNVIQSNEITVSTEFQTLIRVALDMNVHYKQTNMKNRLC-STSTGFKECEQNANQNSPTDLSE-DTISFSDKYNHNVWNARIVSATQSSKATIMYSLLALRNPNLFIRNKIDLERGLRIQQRAFIQLTNETAFNELRNLVPNYDDLRNQLISI-KQLLHEIEIGIWRDQREALQMTPTDSVCSK---MVIGYFETLINIIQSFKDELCKLSSVDVFYTTGFFNCLNHSQPMYDYHSQLNM 491          
BLAST of Acid-sensing ion channel 4 vs. TrEMBL
Match: A0A095C6X5 (Uncharacterized protein OS=Schistosoma haematobium OX=6185 GN=MS3_06163 PE=3 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 5.232e-18
Identity = 112/439 (25.51%), Postives = 198/439 (45.10%), Query Frame = 1
Query:  139 FIWLLIFGIMSYRIIDWGNQYFWSRD----NKINFARA--------NNAPKIL---------IKPY--LLLCNVNPIRGTRIFLMSNGSKXXXXXXXXXXXXXXXQKGILKVLKQ--SMINKKLLIECSHKMEDMLKECKLNGKNCPKSSFETIWYNSRICHXXXXXXXXXXXXLTLDPEEFDYIIPNNGFVGFRLMLTDSQSHYTPVYD--------------------------------SIMAGPFYQTNVKIKLSKNI--TSTNQDN--CRGNSLDFSECSVKIQVNNSKRESQF--QTV-----------SSQIFISSQYYKSPFFSTLLAPKSLRSIMRNGELLKNANLIQQRAYLRYTDKSIFYDLQQLTSVFRTLFQSLEQLHKQLIH-LNISVNSDHRHINHLSTSQTKCGSNFGAILHSLRQMLKQYQN 1230
             I LLIF  + YRIID+ N++   +     NK   ++         N   K+L         I  +  + LCN+NPIRG+ +F + NGS+IYD I     +   +  GI K++    ++++K LL    HK+ +MLK C    + C   +F ++      C+++ +  S+ ++ + LD +++DYIIP+ G +GFRL +  S+   + + D                                 I     +QT +++ L  N+    TN  N  C   S  F+EC    Q  N K  +     TV           +++I  ++Q  K+    +LLA ++    +RN   L+    IQQRA+++ T+++ F +L++L   +  L   L  + KQL+H + I +  D R    ++ + + C         +L  + K +Q+
Sbjct:    3 LICLLIFICLCYRIIDYFNRHEMMKSLFVYNKFPLSKQSSYKNINDNGNNKLLSLMHKEEQNISDWFTITLCNLNPIRGSALFTVENGSEIYDRIIKIRQNEIDF-TGITKIVNNNNALVSKALLKRTGHKLNEMLKFCYTGNEKCSHRNFTSVLTIYGQCYRMELQPSVYEVRIVLDSQDYDYIIPHKGSIGFRLWIHPSEQKASYILDLKDDKDNPWKNTQNENVIDFSSLQQSDIIQSNEITVSTEFQTLIRVALDMNVHYKRTNMKNGLC-STSTGFTECE---QNANQKLPTDLLEDTVWLSDKYNHNVWNARIVSATQSSKATIMYSLLALRNPNLFIRNKIDLERGLRIQQRAFIQLTNETAFNELRKLVPGYDDLRNQLRSI-KQLLHEIEIGIWRDQREALQMTHTDSACSKMVIGYFETLINITKSFQD 435          
BLAST of Acid-sensing ion channel 4 vs. TrEMBL
Match: A0A4E0RD69 (Uncharacterized protein OS=Fasciola hepatica OX=6192 GN=D915_003531 PE=3 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 1.325e-17
Identity = 85/335 (25.37%), Postives = 147/335 (43.88%), Query Frame = 1
Query:  121 KRILYGFIWLLIFGIMSYRIIDW---GNQY-------FWSRDNKINFARANNAPKIL-------------IKPYLLLCNVNPIRGTRIFLMSNGSKXXXXXXXXXXXXXXXQKGILKVLKQSMINKKLLIECSHKMEDMLKECKLNGKNCPKSSFETIWYNSRICHXXX--XXXXXXXXXLTLDPEEFDYIIPNNGFVGFRLMLTDS-QSHYTPVYDSIMAGPFYQTNVKIKLSKNITSTNQDNCRGNSLDFSECSVKIQVNNSKRESQFQTVSSQIFISSQYYKSPFFSTLLAPKSLRSIMRNGELLKNANLIQQRAYLRYTDKSIFYDLQQLT 1047
            KR L+  I+LL+   + YRI DW    N +           DN   +A + N  K+L                 L+LC +NP++G+ +F M+NG  +Y+ +  +  +        L  L  +    +L+   +HKM  MLK C ++   C  + F  I      C+ +     + + ++ L LDPE++DYIIPN+GF+GFRL +  + Q          + GP++ T + ++  +        NC      F +                Q     +   SQ  K   F  LL+ K      R+ + ++ A L+QQRA+L+  +++ F+ L ++ 
Sbjct:   16 KRCLHLIIFLLVGFFLMYRIADWIMIRNSFPDLLRSMICDLDNNQRYAPSENLSKLLPTEKRMTSDSLDECTTNLILCGLNPVKGSAVFTMNNGDVVYNRLIQNRQNNQGNISTFLSALSDT--EYRLI---THKMSTMLKSCFVDSSECYATDFTLIRTREGFCYALPLNRTSGVHQVQLILDPEKYDYIIPNDGFIGFRLAVVHANQVKNADAIRFTVVGPYFHTFLDVRHQRG------KNCLDEKGSFKQ----------------QCPEHHLRAVSQSEKVDMFVQLLSQKKKERFARSEKAIEFAALVQQRAFLQAYNQTAFHLLMRMV 323          
BLAST of Acid-sensing ion channel 4 vs. Planmine SMEST
Match: SMESG000063169.1 (SMESG000063169.1)

HSP 1 Score: 1224.92 bits (3168), Expect = 0.000e+0
Identity = 640/645 (99.22%), Postives = 640/645 (99.22%), Query Frame = 1
Query:   58 MRKFQRNLNENKSSKLKFCSSKRILYGFIWLLIFGIMSYRIIDWGNQYFWSRDNKINFARANNAPKILIKPYLLLCNVNPIRGTRIFLMSNGSKXXXXXXXXXXXXXXXQKGILKVLKQSMINKKLLIECSHKMEDMLKECKLNGKNCPKSSFETIWYNSRICHXXXXXXXXXXXXLTLDPEEFDYIIPNNGFVGFRLMLTDSQSHYTPVYDSIMAGPFYQTNVKIKLSKNITSTNQDNCRGNSLDFSECSVKIQVNNSKRESQFQTVSSQIFISSQYYKSPFFSTLLAPKSLRSIMRNGELLKNANLIQQRAYLRYTDKSIFYDLQQLTSVFRTLFQSLEQLHKQLIHLNISVNSDHRHINHLSTSQTKCGSNFGAILHSLRQMLKQYQNFQTEFPTMRRLRYFNKYQPERNELSILNMIFGDDNLPNSKIRHSLQQQLNTMVSVKLQLKESTQNDNCHLEMIENLQNSYLQQXXXXXXXXXXXXDTLKNGKDQLMILRNSTSYIRTVFTSSRSKEMRKISMMNLVTIDIEIIPEPLTESLKQIDNQFSKYHRIAEVLGIICGTLGGSVPLLMLLEWCYRFKRKPEKQVNLNPNKIKSRVLQSVSTEHIELSSDLDSVHRVDHSQLQTQIDTNSDSQRAVVFVF 1992
            MRKFQRNLNENKSSKLKFCSSKRILYGFIWLLIFGIMSYRIIDWGNQYFWS DNKINFA ANNAPKILIKPYLLLCNVNPIRGTRIFLMSNGSKIYDIISDSITSRTSYQKGILKVLKQSMINKKLL ECSHKMEDMLKECKLNGKNCPKSSFETIWYNSRICHKININNSISKISLTLDPEEFDYIIPNNGFVGFRLMLTDSQSHYTP YDSIMAGPFYQTNVKIKLSKNITSTNQDNCRGNSLDFSECSVKIQVNNSKRESQFQTVSSQIFISSQYYKSPFFSTLLAPKSLRSIMRNGE LKNANLIQQRAYLRYTDKSIFYDLQQLTSVFRTLFQSLEQLHKQLIHLNISVNSDHRHINHLSTSQTKCGSNFGAILHSLRQMLKQYQNFQTEFPTMRRLRYFNKYQPERNELSILNMIFGDDNLPNSKIRHSLQQQLNTMVSVKLQLKESTQNDNCHLEMIENLQNSYLQQIEEINSVISNSIDTLKNGKDQLMILRNSTSYIRTVFTSSRSKEMRKISMMNLVTIDIEIIPEPLTESLKQIDNQFSKYHRIAEVLGIICGTLGGSVPLLMLLEWCYRFKRKPEKQVNLNPNKIKSRVLQSVSTEHIELSSDLDSVHRVDHSQLQTQIDTNSDSQRAVVFVF
Sbjct:    1 MRKFQRNLNENKSSKLKFCSSKRILYGFIWLLIFGIMSYRIIDWGNQYFWSSDNKINFAGANNAPKILIKPYLLLCNVNPIRGTRIFLMSNGSKIYDIISDSITSRTSYQKGILKVLKQSMINKKLLFECSHKMEDMLKECKLNGKNCPKSSFETIWYNSRICHKININNSISKISLTLDPEEFDYIIPNNGFVGFRLMLTDSQSHYTPAYDSIMAGPFYQTNVKIKLSKNITSTNQDNCRGNSLDFSECSVKIQVNNSKRESQFQTVSSQIFISSQYYKSPFFSTLLAPKSLRSIMRNGEHLKNANLIQQRAYLRYTDKSIFYDLQQLTSVFRTLFQSLEQLHKQLIHLNISVNSDHRHINHLSTSQTKCGSNFGAILHSLRQMLKQYQNFQTEFPTMRRLRYFNKYQPERNELSILNMIFGDDNLPNSKIRHSLQQQLNTMVSVKLQLKESTQNDNCHLEMIENLQNSYLQQIEEINSVISNSIDTLKNGKDQLMILRNSTSYIRTVFTSSRSKEMRKISMMNLVTIDIEIIPEPLTESLKQIDNQFSKYHRIAEVLGIICGTLGGSVPLLMLLEWCYRFKRKPEKQVNLNPNKIKSRVLQSVSTEHIELSSDLDSVHRVDHSQLQTQIDTNSDSQRAVVFVF 645          
BLAST of Acid-sensing ion channel 4 vs. Planmine SMEST
Match: SMESG000002858.1 (SMESG000002858.1)

HSP 1 Score: 121.324 bits (303), Expect = 1.737e-28
Identity = 147/610 (24.10%), Postives = 268/610 (43.93%), Query Frame = 1
Query:  124 RILYGFIWLLIFGIMSYRIIDWGNQYFWSRDNKINFARANNA---------PKILIKPYLLLCNVNPIRGTRIFLMSNGSKXXXXXXXXXXXXXXXQKGILKVLKQSM--INKKLLIECSHKMEDMLKECKLNGKNCPKSSFETIWYNSRICHXXXXXXXXXXXXLTLDPEEFDYIIPNNGFVGFRLMLTDSQSHYTPVYDSIMAGPFYQT-------NVKIKLSKNITSTNQ-------DNCRGNSLDFS--ECSVKIQVNNSKRESQFQTVSSQIFISSQYYKSPFFSTLLAPKSLRSIMRNGELLKNANLIQQRAYLRYTDKSIFYDLQQLTSVFRTLFQSLEQLHKQLIHLNISVNSDHRHINHLSTSQTKCGSNFGAILHSLRQMLKQYQN----FQTEFPTMRRLRYFNKYQPERNELSILNMIFGDDNLPNSKIRHSLQQQLNTMVSVKLQLKESTQNDNCHLEMIENLQNSYLQQXXXXXXXXXXXXDTLKNGKDQLMILRNSTSYIRTVFTSSRSKEMRKISMMNLVTIDI-----EIIPEPLTESLKQIDNQFSKYHRIAEVLGIICGTLGGSVPLLMLLEWCYRFKR-----KPEKQVN 1830
            RIL   + + I  ++ YR+  W +Q      N ++F   +NA              +  + LCN+NPIRG  +F + NGS++YD + D         K  +     SM  + K ++   SHK+E ML+ C L  ++C    F  IW ++R+C ++ +    + ++L LD EE  Y+IP  GFVGF+L + +       +  + M  PF +        +  I +++++ S          D CR     F+   CS    + N     QF   S QI  + Q   SPFF  L      +   +  E L    LIQ R  LR+    +F+ + +++ + R +     +L  Q+ +L  +++SD   + H+      C  +   +L  L +    + N        FP  +   + +       EL+++ M+F     P S   +  +++LN +  + ++LK  T   +C   +I+ +   Y+Q+I +  S +++        + +++ L+N ++ I +     R     K S++  VTID+     +I+P+P+     Q          ++E++ IIC +      L + +  C R  R     K  K+VN
Sbjct:   33 RILSVALSVSILILILYRVSIWYSQ------NMVSFLTPSNAHINDSSSTATWSSSEIPITLCNLNPIRGDLLFQLPNGSRLYDFLVDKW------HKAAISYRDDSMKFLPKSVIESASHKLESMLRWCYLGLESCHAQDFHRIWASNRLCDQLILKKKDTSLTLALDAEEMHYLIPGYGFVGFKLCIGN-------IIQTNMKHPFQECFYISNKLHTIIGVTRSVISDGSDCSVSSFDECRSKCFAFTNFNCSCYKYLKN----CQF---SHQISSNLQAAPSPFFYHLFKMHHFKQNYQVCESLI-PTLIQWRGVLRFLRPDLFHQMVEISKLLRGIQARQSKLSFQVRNLQHNISSDLVRLKHIKDDSKLC--DLPNLLDKLNKTCDMFHNELPVHNYSFPACKSHVHISG----SFELTVIEMLFSKT--PTSIFDNYFRKKLNQLSMLNIELKTQTSPFSCSNSIIQKMGAFYIQEIIDTRSDLNDFSINSLYFQKRILSLQNLSAEIMSTIIHKRRPNKDKNSLIT-VTIDVQTNSRQILPKPI-----QYKQNTVPLTVVSELIDIICSS-AAVAALFIFIVRCLRSPRVRSKTKTRKRVN 600          
BLAST of Acid-sensing ion channel 4 vs. Planmine SMEST
Match: SMESG000018290.1 (SMESG000018290.1)

HSP 1 Score: 78.9518 bits (193), Expect = 4.446e-15
Identity = 136/584 (23.29%), Postives = 265/584 (45.38%), Query Frame = 1
Query:  154 IFGIMSYRIIDW--------GNQYFWSRDN--KINFARANNAPKILIKPYLLLCNVNPIRGTRIFLMSNGSKXXXXXXXXXXXXXXXQKGILKVLKQSMINKKLLIECSHKMEDMLKECKLNGKNCPKSSFETIWYNSR--ICHXXXXXXXXXX-XXLTLDPEEFDYIIPNNGFVGFRLMLTDS--QSHYTPVYDSIMAGPFYQTNVKIKLSKNITSTNQDNCRGNSLDFSECSVKIQVNNSKRESQFQTVSSQIFISSQYYKSPFFSTLLAPK--SLRSIMRNGELLKNANLIQQRAYLRYTDKSIFYDLQQLTSVFRTLFQSLEQLHKQLIHLNISVNSDHRHINHLSTSQTKCGSN-FGAILHSLRQMLKQYQNFQTEFPTMRRLRYFNKYQPERNELSILNMIFGDDNLPNSKIRHSLQQQLNTMVSVKLQLK--------ESTQNDNCHLEMIENLQNSYLQQXXXXXXXXXXXXDTLKNGKDQLMILRNSTSYIRTVFTSSRSKEMRKISMMNLVTIDIEIIPEPLTESLKQIDNQFSKYHRIAEVLGIICGTLGGSVPLLMLLEWCYRFKRKPEKQV 1827
            + G++++RI  W        GN +    DN  K+ F   +       + Y+ LCN+N  RG+ +F   +  + +D    S++              Q++ +  ++   +HK+EDMLK C++    C    F  I + SR   C  + IN +    + +TLDPEEFDYI+PN G VGF + + +    +  +   + ++ GP ++T ++ K    +T T ++ C G+ +    C V++  N +  +S+   +S    I +Q  +SP+F  +++ K      + RN   +     +QQR++L+ ++ S+F  L  LT+      +  E L+K        ++S    I   S++Q K        +  SL ++    Q+FQ +  +   L   +        L I+N  F    +  S I + LQ  L  + + K+QL+         S  N +C     ++  + +  Q+E++   +   +  L    ++L +L +    IR  F+ ++  +++K+S   LV+I + +    ++E+        +  + +  +L  I  T+G S+  L+ L    R ++ P K +
Sbjct:    1 MLGLIAFRITIWILMYQDNAGNLFLQLTDNEEKLKFRNFSTGSD---QFYVTLCNINIARGSALFQKFDTLEAFDKYIQSLSRWQQAPN------YQTLPDPIMVNLSAHKLEDMLKICRIGTIVCSTHQF--IRHISRYGACFSLRINYTELNWLKITLDPEEFDYILPNFGIVGFNVFVHNKLPLNMGSMAENMVVIGPSFETMIRAK----VTQTMKNIC-GSQI---TCFVQLNCNKNCWKSK---ISVSPGIITQAVRSPYFMEIISKKFDYHVQVKRNLHRVYLGLSLQQRSFLKASNNSLFLTLSNLTASHVLTLK--EILNK--------IDSHMMEIQAYSSNQLKFDEECLHGLSLSLSRLGLLAQDFQLKRKSQDILDTKHLQSISHIYLYIINCFFSGIKIK-SPIANFLQSNLAVVSNFKVQLQNGDLNQQISSDSNKDCLSSFSKHKISFFRSQVEKLEKYVVLYLGQLDEANNKLYLLADEHRTIRATFSFTKI-QIQKLSTEKLVSIIVLVDRNQISEAAYL--TSVTTKNDLGSLLNSILTTIGFSIICLLFLGHLCRKRKIPTKSI 548          
BLAST of Acid-sensing ion channel 4 vs. Planmine SMEST
Match: SMESG000018290.1 (SMESG000018290.1)

HSP 1 Score: 73.9442 bits (180), Expect = 2.046e-13
Identity = 126/535 (23.55%), Postives = 246/535 (45.98%), Query Frame = 1
Query:  271 YLLLCNVNPIRGTRIFLMSNGSKXXXXXXXXXXXXXXXQKGILKVLKQSMINKKLLIECSHKMEDMLKECKLNGKNCPKSSFETIWYNSR--ICHXXXXXXXXXX-XXLTLDPEEFDYIIPNNGFVGFRLMLTDS--QSHYTPVYDSIMAGPFYQTNVKIKLSKNITSTNQDNCRGNSLDFSECSVKIQVNNSKRESQFQTVSSQIFISSQYYKSPFFSTLLAPK--SLRSIMRNGELLKNANLIQQRAYLRYTDKSIFYDLQQLTSVFRTLFQSLEQLHKQLIHLNISVNSDHRHINHLSTSQTKCGSN-FGAILHSLRQMLKQYQNFQTEFPTMRRLRYFNKYQPERNELSILNMIFGDDNLPNSKIRHSLQQQLNTMVSVKLQLK--------ESTQNDNCHLEMIENLQNSYLQQXXXXXXXXXXXXDTLKNGKDQLMILRNSTSYIRTVFTSSRSKEMRKISMMNLVTIDIEIIPEPLTESLKQIDNQFSKYHRIAEVLGIICGTLGGSVPLLMLLEWCYRFKRKPEKQV 1827
            Y+ LCN+N  RG+ +F   +  + +D    S++              Q++ +  ++   +HK+EDMLK C++    C    F  I + SR   C  + IN +    + +TLDPEEFDYI+PN G VGF + + +    +  +   + ++ GP ++T ++ K    +T T ++ C G+ +    C V++  N +  +S+   +S    I +Q  +SP+F  +++ K      + RN   +     +QQR++L+ ++ S+F  L  LT+      +  E L+K        ++S    I   S++Q K        +  SL ++    Q+FQ +  +   L   +        L I+N  F    +  S I + LQ  L  + + K+QL+         S  N +C     ++  + +  Q+E++   +   +  L    ++L +L +    IR  F+ ++  +++K+S   LV+I + +    ++E+        +  + +  +L  I  T+G S+  L+ L    R ++ P K +
Sbjct:   33 YVTLCNINIARGSALFQKFDTLEAFDKYIQSLSRWQQAPN------YQTLPDPIMVNLSAHKLEDMLKICRIGTIVCSTHQF--IRHISRYGACFSLRINYTELNWLKITLDPEEFDYILPNFGIVGFNVFVHNKLPLNMGSMAENMVVIGPSFETMIRAK----VTQTMKNIC-GSQI---TCFVQLNCNKNCWKSK---ISVSPGIITQAVRSPYFMEIISKKFDYHVQVKRNLHRVYLGLSLQQRSFLKASNNSLFLTLSNLTASHVLTLK--EILNK--------IDSHMMEIQAYSSNQLKFDEECLHGLSLSLSRLGLLAQDFQLKRKSQDILDTKHLQSISHIYLYIINCFFSGIKIK-SPIANFLQSNLAVVSNFKVQLQNGDLNQQISSDSNKDCLSSFSKHKISFFRSQVEKLEKYVVLYLGQLDEANNKLYLLADEHRTIRATFSFTKI-QIQKLSTEKLVSIIVLVDRNQISEAAYL--TSVTTKNDLGSLLNSILTTIGFSIICLLFLGHLCRKRKIPTKSI 534          
BLAST of Acid-sensing ion channel 4 vs. Planmine SMEST
Match: SMESG000073148.1 (SMESG000073148.1)

HSP 1 Score: 70.8626 bits (172), Expect = 1.490e-12
Identity = 76/276 (27.54%), Postives = 132/276 (47.83%), Query Frame = 1
Query:  268 PYLLLCNVNPIRGTRIFLMSNGSKXXXXXXXXXXXXXXXQKGILKVLKQSMINKKLLIECSHKMEDMLKECKLNGKNCPKSSFETIWYNSRICHXXXXXXXXXXXXLTLDPEEFDYIIPNNGFVGFRLMLTDSQSHYTPVYDSIMAGPFYQTNVKIKLSKNITS----------TNQDNCRGNSLDFSECSVKIQVNNSKRESQFQTVSSQIFISSQYYKSPFFSTLLAPKSLRSIMRNGELLKNANLIQQRAYLRYTDKSIFYDLQQLTSVFRTL 1065
            P ++LCN+NP +G+ +F   NGS +YD I D + S        L V K    +K      +H ++ ML  CK++ + C  +SF +  +    C+++ I +    ISL L+ E++DY++P + +VGF++ + +         ++++A P     V IK+S+ +             N++     S +  E    I++N        Q ++  I+ +   YK   F     PKS  SI        N++LIQ R+ LRY DK  F  L++ T +  T+
Sbjct:   21 PAIVLCNLNPFKGSELFKSVNGSGLYDSIVDKLISANPISDEFLTVNKN--FSKVFSSRFNHGIQQMLISCKIDNEECAHNSFASHRHGLLQCYQLPITSLNRIISLVLNSEQYDYLVPVSKYVGFKIWINNGLKVNE---ETVIATPGNHNIVDIKVSEKVIYLKNFSGEKHLVNKEYTYSLSTNIPEHYSIIRLN--------QVMTLPIY-AKLIYKD--FQRTFPPKSQTSIY-------NSHLIQCRSILRYFDKEAFLTLEKSTEIAITI 273          
The following BLAST results are available for this feature:
BLAST of Acid-sensing ion channel 4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Acid-sensing ion channel 4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Acid-sensing ion channel 4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Acid-sensing ion channel 4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Acid-sensing ion channel 4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Acid-sensing ion channel 4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Acid-sensing ion channel 4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Acid-sensing ion channel 4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3Q0KSB53.624e-1825.20Acid sensing ion channel 4, pituitary, putative OS... [more]
A0A5K4EVP93.988e-1825.20Acid sensing ion channel 4, pituitary, putative OS... [more]
G4LXJ75.029e-1825.00Acid sensing ion channel 4, pituitary, putative OS... [more]
A0A095C6X55.232e-1825.51Uncharacterized protein OS=Schistosoma haematobium... [more]
A0A4E0RD691.325e-1725.37Uncharacterized protein OS=Fasciola hepatica OX=61... [more]
back to top
BLAST of Acid-sensing ion channel 4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Acid-sensing ion channel 4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Acid-sensing ion channel 4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Acid-sensing ion channel 4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Acid-sensing ion channel 4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Acid-sensing ion channel 4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000063169.10.000e+099.22SMESG000063169.1[more]
SMESG000002858.11.737e-2824.10SMESG000002858.1[more]
SMESG000018290.14.446e-1523.29SMESG000018290.1[more]
SMESG000018290.12.046e-1323.55SMESG000018290.1[more]
SMESG000073148.11.490e-1227.54SMESG000073148.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024465 ID=SMED30024465|Name=Acid-sensing ion channel 4|organism=Schmidtea mediterranea sexual|type=transcript|length=2047bp
GCGTCAAGAATTTTGTTTGAATTATCATGATTTTTTGAACCATTCTTCGA
TGAAACCATGAGAAAATTCCAAAGAAATTTAAATGAAAATAAAAGTTCTA
AACTGAAATTTTGTTCCTCAAAGCGGATTCTTTATGGATTTATTTGGTTG
CTGATTTTCGGAATAATGTCGTACCGGATAATTGACTGGGGCAACCAATA
TTTCTGGAGCAGAGATAATAAAATAAATTTTGCCCGTGCCAACAATGCTC
CGAAAATATTAATAAAACCGTATTTGTTGTTATGTAATGTCAATCCGATT
CGTGGAACGAGGATATTCCTAATGTCAAATGGCAGCAAAATTTATGACAT
CATCAGTGATTCTATAACTAGTCGTACGAGTTATCAGAAAGGAATTCTAA
AAGTTTTGAAGCAATCAATGATTAATAAAAAATTATTAATTGAATGTTCA
CATAAAATGGAAGATATGTTAAAAGAATGCAAGTTAAATGGAAAAAATTG
TCCAAAAAGCTCTTTTGAAACTATTTGGTACAATTCGAGAATTTGCCACA
AAATTAATATAAATAATTCAATTTCGAAAATTTCTTTGACACTTGACCCC
GAAGAATTCGACTATATCATTCCAAATAATGGCTTCGTCGGTTTTAGGCT
TATGTTGACAGATAGTCAATCTCATTATACACCAGTTTATGACAGTATTA
TGGCAGGGCCATTTTATCAAACGAATGTCAAAATTAAGTTATCAAAAAAC
ATCACATCAACTAATCAAGACAATTGCAGAGGAAATTCTCTCGATTTTAG
TGAATGCTCCGTAAAAATTCAGGTAAATAATTCGAAAAGGGAATCACAAT
TTCAGACTGTCTCATCTCAGATCTTTATTTCTTCCCAATATTACAAATCG
CCATTTTTCTCCACTCTATTAGCTCCAAAATCTCTAAGATCCATAATGAG
AAATGGAGAACTTCTAAAAAATGCCAACCTCATCCAACAGCGAGCCTATC
TCCGATATACTGACAAAAGTATATTTTATGATCTACAACAGTTGACATCC
GTCTTTCGTACTCTATTTCAATCTCTGGAACAATTGCATAAACAACTAAT
TCATCTCAACATATCAGTCAATTCAGATCATCGCCACATAAACCATTTAT
CAACAAGCCAAACGAAATGCGGCTCAAATTTCGGTGCAATTCTACATTCT
CTACGACAAATGCTCAAACAATATCAGAATTTTCAAACCGAATTTCCTAC
AATGCGCCGTTTAAGATATTTCAACAAATACCAACCGGAACGGAATGAGC
TCTCAATTCTCAACATGATATTCGGTGATGACAATTTGCCAAACTCGAAA
ATCAGGCATTCTCTTCAACAACAATTGAACACAATGGTCAGTGTCAAACT
CCAACTGAAAGAATCCACTCAAAACGACAACTGTCATTTAGAGATGATAG
AAAATCTACAAAATTCCTATTTACAACAAATAGAAGAAATAAATTCTGTG
ATTTCCAACTCAATTGATACTTTAAAAAATGGCAAAGATCAACTAATGAT
ATTAAGAAATTCCACTTCGTATATCAGAACAGTTTTTACCTCATCTCGGT
CAAAGGAAATGAGGAAAATTTCAATGATGAATCTGGTAACAATTGACATT
GAAATCATCCCAGAGCCACTGACAGAATCCTTGAAACAAATTGACAACCA
GTTCTCCAAGTATCACAGAATAGCTGAAGTATTAGGAATTATATGTGGGA
CCTTAGGAGGATCAGTTCCACTTTTGATGTTATTAGAATGGTGTTATAGA
TTTAAAAGAAAACCAGAGAAACAAGTGAACTTAAATCCAAATAAAATAAA
GTCAAGAGTTCTGCAAAGTGTAAGTACTGAACACATTGAATTATCTTCGG
ATCTGGATTCAGTGCATCGTGTAGATCATTCTCAATTACAGACTCAAATA
GATACAAATTCTGATTCACAAAGGGCCGTCGTTTTTGTATTTTGAAATTA
CAGTCAAATGTTATTCTTCACTTTTCGTTTTCTGTGATAGATCGGAA
back to top

protein sequence of SMED30024465-orf-1

>SMED30024465-orf-1 ID=SMED30024465-orf-1|Name=SMED30024465-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=646bp
MRKFQRNLNENKSSKLKFCSSKRILYGFIWLLIFGIMSYRIIDWGNQYFW
SRDNKINFARANNAPKILIKPYLLLCNVNPIRGTRIFLMSNGSKIYDIIS
DSITSRTSYQKGILKVLKQSMINKKLLIECSHKMEDMLKECKLNGKNCPK
SSFETIWYNSRICHKININNSISKISLTLDPEEFDYIIPNNGFVGFRLML
TDSQSHYTPVYDSIMAGPFYQTNVKIKLSKNITSTNQDNCRGNSLDFSEC
SVKIQVNNSKRESQFQTVSSQIFISSQYYKSPFFSTLLAPKSLRSIMRNG
ELLKNANLIQQRAYLRYTDKSIFYDLQQLTSVFRTLFQSLEQLHKQLIHL
NISVNSDHRHINHLSTSQTKCGSNFGAILHSLRQMLKQYQNFQTEFPTMR
RLRYFNKYQPERNELSILNMIFGDDNLPNSKIRHSLQQQLNTMVSVKLQL
KESTQNDNCHLEMIENLQNSYLQQIEEINSVISNSIDTLKNGKDQLMILR
NSTSYIRTVFTSSRSKEMRKISMMNLVTIDIEIIPEPLTESLKQIDNQFS
KYHRIAEVLGIICGTLGGSVPLLMLLEWCYRFKRKPEKQVNLNPNKIKSR
VLQSVSTEHIELSSDLDSVHRVDHSQLQTQIDTNSDSQRAVVFVF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR001873ENaC
Vocabulary: biological process
TermDefinition
GO:0006814sodium ion transport
GO:0006810transport
GO:0006811ion transport
GO:0035725sodium ion transmembrane transport
Vocabulary: molecular function
TermDefinition
GO:0005272sodium channel activity
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.10.3590.10coord: 79..195
e-value: 8.7E-10
score: 40.1
NoneNo IPR availableGENE3DG3DSA:2.60.470.10coord: 53..232
e-value: 8.7E-10
score: 40.1
NoneNo IPR availableGENE3DG3DSA:1.10.287.820coord: 233..243
e-value: 8.7E-10
score: 40.1
NoneNo IPR availableGENE3DG3DSA:1.10.287.770coord: 28..52
e-value: 8.7E-10
score: 40.1
NoneNo IPR availableTMHMMTMhelixcoord: 558..580
NoneNo IPR availableTMHMMTMhelixcoord: 24..42