S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase

Overview
NameS-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase
Smed IDSMED30024454
Length (bp)2024
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase (SMED30024454) t-SNE clustered cells

Violin plots show distribution of expression levels for S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase (SMED30024454) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase (SMED30024454) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase (SMED30024454) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024454

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30024454h1SMcG0006785 SmedASXL_012511SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30024454h1SMcG0006785 SmedASXL_012511SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30024454h1SMcG0006785 dd_Smed_v4_6762_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30024454h1SMcG0006785 dd_Smed_v4_6762_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase vs. Ensembl Human
Match: TYW1 (tRNA-yW synthesizing protein 1 homolog [Source:HGNC Symbol;Acc:HGNC:25598])

HSP 1 Score: 672.159 bits (1733), Expect = 0.000e+0
Identity = 346/647 (53.48%), Postives = 434/647 (67.08%), Query Frame = 2
Query:  137 IKILYGSLTGKSKILAEKFSKECIHNNYDFKMMNMNTYDPEENLNKE---KSLLVIFVSTYENGTPPEDAKWFYNWLIDAKDDFRVDKNFLENLQFAVVGLGSSYYESNFNIVSKAIDEAFGSLSGKRLLEIGICDENVVNSKNGGLDYDYQEWSKKFWKTLTCT--SETKNSNGDVXXXXXXXXXXXXXXXXXXXXXXXIEI----TEENSDDEVLTSDEEEEKNMDSGNELVDMEDLGMMMR-------------------KRKDIVENKTPREMLTPMLRTSLEKQGYKLIGSHSGVKMCRWTKSMLRGRGGCYKHAFYGIASHRCMEATPSLACANKCVFCWRHHSNPVGTEWKWIMDPPEMIVDEAVAKHIQMVKQFKGVPGVQEERFLEGLKPKHCALSLVGEPIMYPRINTLVGLLHSRQISTFLVTNAQFPDAIQQLVPVTQLYVSVDAGEKDALKKIDRPLFKDFWERFVASLTAVKDKKQRTVYRLTLVKAWNVDELDAYANLVDLGQPHFIEVKGVTYCGDSKASKLTMANVPWHEEVLSFVQQLADRLENYEIAAEHEHSNCVLLAQKKFKVNDEWNTWIDYEKFHELVQ------TGKDFDATEYMAPTPSWAAYGSNEKGFNPSDTRFRKLRK 1975
            +KI YGS TG +K  A   ++     +    ++N+  YDP+++L +E   K++ V  V+TY +G P E A+WF  WL +A  DFR  K +L+ +++AV GLG+S Y S+FN V K +D+    L   R++  G  D +VV SK+G ++ D++ W  KF   L      E K S G  C   K    +  +       +E+ E+    TEE    E  + +E   ++  S N +VD+EDLG +M                    +     E+   R M+TP LR +L KQGY+LIGSHSGVK+CRWTKSMLRGRGGCYKH FYGI SHRCME TPSLACANKCVFCWRHH+NPVGTEW+W MD PEMI+ EA+  H  M+KQFKGVPGV+ ERF EG+  KHCALSLVGEPIMYP IN  + LLH  +IS+FLVTNAQFP  I+ L PVTQLYVSVDA  KD+LKKIDRPLFKDFW+RF+ SL A+  K+QRTVYRLTLVKAWNVDEL AYA LV LG P FIEVKGVTYCG+S AS LTMA+VPWHEEV+ FV +L D +  YEIA EHEHSNC+L+A +KFK+  EW TWIDY +F EL+Q        K F A +YMA TP WA +G++E+GF+P DTR ++  K
Sbjct:   79 VKIFYGSQTGTAKGFATVLAEAVTSLDLPVAIINLKEYDPDDHLIEEVTSKNVCVFLVATYTDGLPTESAEWFCKWLEEASIDFRFGKTYLKGMRYAVFGLGNSAYASHFNKVGKNVDKWLWMLGAHRVMSRGEGDCDVVKSKHGSIEADFRAWKTKFISQLQALQKGERKKSCGGHCKKGKCESHQHGSEEREEGSHEQDELHHRDTEEEEPFESSSEEEFGGEDHQSLNSIVDVEDLGKIMDHVKKEKREKEQQEEKSGLFRNMGRNEDGERRAMITPALREALTKQGYQLIGSHSGVKLCRWTKSMLRGRGGCYKHTFYGIESHRCMETTPSLACANKCVFCWRHHTNPVGTEWRWKMDQPEMILKEAIENHQNMIKQFKGVPGVKAERFEEGMTVKHCALSLVGEPIMYPEINRFLKLLHQCKISSFLVTNAQFPAEIRNLEPVTQLYVSVDASTKDSLKKIDRPLFKDFWQRFLDSLKALAVKQQRTVYRLTLVKAWNVDELQAYAQLVSLGNPDFIEVKGVTYCGESSASSLTMAHVPWHEEVVQFVHELVDLIPEYEIACEHEHSNCLLIAHRKFKIGGEWWTWIDYNRFQELIQEYEDSGGSKTFSAKDYMARTPHWALFGASERGFDPKDTRHQRKNK 725          
BLAST of S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase vs. Ensembl Human
Match: TYW1 (tRNA-yW synthesizing protein 1 homolog [Source:HGNC Symbol;Acc:HGNC:25598])

HSP 1 Score: 569.311 bits (1466), Expect = 0.000e+0
Identity = 309/616 (50.16%), Postives = 392/616 (63.64%), Query Frame = 2
Query:  230 MMNMNTYDPEENLNKE---KSLLVIFVSTYENGTPPEDAKWFYNWLIDAKDDFRVDKNFLENLQFAVVGLGSSYYESNFNIVSKAIDEAFGSLSGKRLLEIGICDENVVNSKNGGLDYDYQEWSKKFWKTLTCT--SETKNSNGDVXXXXXXXXXXXXXXXXXXXXXXXIEI----TEENSDDEVLTSDEEEEKNMDSGNELVDMEDLGMMMRKRKDIV-------------------ENKTPREMLTPMLRTSLEKQGYKLIGSHSGVKMCRWTKSMLRGRGGCYKHAFYGIASHRCMEATPSLACANKCVFCWRHHSNPVGTEWKWIMDPPEMIVDEAVAKHIQMVKQFKGVPGVQEERFLEGLKPKHCALSLVGEPIMYPRINTLVGLLHSRQISTFLVTNAQFPDAIQQLVPVTQLYVSVDAGEKDALKKIDRPLFKDFWERFVASLTAVKDKKQRTVYRLTLVKAWNVDELDAYANLVDLGQPHFIEVKGVTYCGDSKASKLTMANVPWHEEVLSFVQQLADRLENYEIAAEHEHSNCVLLAQKKFKVNDEWNTWIDYEKFHELVQTGKD------FDATEYMAPTPSWAAYGSNEKGFNPSDTRFRKLRK 1975
            ++N+  YDP+++L +E   K++ V  V+TY +G P E A+WF  WL +A  DFR  K +L+ +++AV GLG+S Y S+FN V K +D+    L   R++  G  D +VV SK+G ++ D++ W  KF   L      E K S G  C   K    +  +       +E+ E+    TEE    E  + +E   ++  S N +VD+EDLG +M   K                      E+   R M+TP LR +L KQ +                   R R     H  +   SHRCME TPSLACANKCVFCWRHH+NPVGTEW+W MD PEMI+ EA+  H  M+KQFKGVPGV+ ERF EG+  KHCALSLVGEPIMYP IN  + LLH  +IS+FLVTNAQFP  I+ L PVTQLYVSVDA  KD+LKKIDRPLFKDFW+RF+ SL A+  K+QRTVYRLTLVKAWNVDEL AYA LV LG P FIEVKGVTYCG+S AS LTMA+VPWHEEV+ FV +L D +  YEIA EHEHSNC+L+A +KFK+  EW TWIDY +F EL+Q  +D      F A +YMA TP WA +G++E+GF+P DTR ++  K
Sbjct:   64 IINLKEYDPDDHLIEEVTSKNVCVFLVATYTDGLPTESAEWFCKWLEEASIDFRFGKTYLKGMRYAVFGLGNSAYASHFNKVGKNVDKWLWMLGAHRVMSRGEGDCDVVKSKHGSIEADFRAWKTKFISQLQALQKGERKKSCGGHCKKGKCESHQHGSEEREEGSHEQDELHHRDTEEEEPFESSSEEEFGGEDHQSLNSIVDVEDLGKIMDHVKKEKREKEQQEEKSGLFRNMGRNEDGERRAMITPALREALTKQVHAP-----------------RERRLLQTHILWN-ESHRCMETTPSLACANKCVFCWRHHTNPVGTEWRWKMDQPEMILKEAIENHQNMIKQFKGVPGVKAERFEEGMTVKHCALSLVGEPIMYPEINRFLKLLHQCKISSFLVTNAQFPAEIRNLEPVTQLYVSVDASTKDSLKKIDRPLFKDFWQRFLDSLKALAVKQQRTVYRLTLVKAWNVDELQAYAQLVSLGNPDFIEVKGVTYCGESSASSLTMAHVPWHEEVVQFVHELVDLIPEYEIACEHEHSNCLLIAHRKFKIGGEWWTWIDYNRFQELIQEYEDSGGSKTFSAKDYMARTPHWALFGASERGFDPKDTRHQRKNK 661          
BLAST of S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase vs. Ensembl Human
Match: TYW1B (tRNA-yW synthesizing protein 1 homolog B [Source:HGNC Symbol;Acc:HGNC:33908])

HSP 1 Score: 550.821 bits (1418), Expect = 0.000e+0
Identity = 307/640 (47.97%), Postives = 394/640 (61.56%), Query Frame = 2
Query:  158 LTGKSKILAEKFSKECIHNNYDFKMMNMNTYDPEENLNKE---KSLLVIFVSTYENGTPPEDAKWFYNWLIDAKDDFRVDKNFLENLQFAVVGLGSSYYESNFNIVSKAIDEAFGSLSGKRLLEIGICDENVVNSKNGGLDYDYQEWSKKFWKTLTCT--SETKNSNGDVXXXXXXXXXXXXXXXXXXXXXXXIEI----TEENSDDEVLTSDEEEEKNMDSGNELVDMEDLGMMMRKRKDIV-------------------ENKTPREMLTPMLRTSLEKQGYKLIGSHSGVKMCRWTKSMLRGRGGCYKHAFYGIASHRCMEATPSLACANKCVFCWRHHSNPVGTEWKWIMDPPEMIVDEAVAKHIQMVKQFKGVPGVQEERFLEGLKPKHCALSLVGEPIMYPRINTLVGLLHSRQISTFLVTNAQFPDAIQQLVPVTQLYVSVDAGEKDALKKIDRPLFKDFWERFVASLTAVKDKKQRTVYRLTLVKAWNVDELDAYANLVDLGQPHFIEVKGVTYCGDSKASKLTMANVPWHEEVLSFVQQLADRLENYEIAAEHEHSNCVLLAQKKFKVNDEWNTWIDYEKFHELVQTGKD------FDATEYMAPTPSWAAYGSNEKGFNPSDTRFRKLRK 1975
            + G + +LAE  +      +    ++N+  YDP+++L +E   K++ V  V+TY +G P E A+WF  WL +A  DFR  K +L+ ++ AV GLG+S Y S+FN V K +D+    L   R++  G  D +VV SK+G ++ +++ W  KF   L      E K S G  C   K    +  +        E+ E+    T+E    E  + +E   ++  S N +VD+EDLG +M   K                      E+   R M+TP LR +L KQ                     R R     H  +   SHRCME TPSLACANKCVFCW HH+NPVGTEW W MD PEMI+ EA+  H  M+KQFKGVPGV+ ERF EG+  KHCALSLVGEPIMYP IN  + LLH  +IS+FLVTNAQFP  I+ L PVTQLYVSVDA  KD+LKKIDRPLFKDFW++F+ SL A+  K+QRTVYRL LVKAWNVDEL AYA LV LG P FIEVKGVTYC +S AS LTMA+VPWHEEV+ FV++L D +  YEIA EHEHSNC+L+A +KFK+  EW TWIDY +F EL+Q  +D      F A +YMA TP WA +G+NE+ F+P DTR ++  K
Sbjct:   44 MQGFATVLAEAVTSL----DLPVAIINLKEYDPDDHLIEEVTSKNVCVFLVATYTDGLPTESAEWFCKWLEEASIDFRFGKTYLKGMRDAVFGLGNSAYASHFNKVGKNVDKWLWMLGVHRVMSRGEGDCDVVKSKHGSIEANFRAWKTKFISQLQALQKGERKKSCGGHCKKGKCESHQHGSEEREEGSQEQDELHHRDTKEEEPFESSSEEEFGGEDHQSLNSIVDVEDLGKIMDHVKKEKREKEQQEEKSGLFRNMGRNEDGERRAMITPALREALTKQ-----------------VDAPRERSLLQTHILWN-ESHRCMETTPSLACANKCVFCWWHHNNPVGTEWLWKMDQPEMILKEAIENHQNMIKQFKGVPGVKAERFEEGMTVKHCALSLVGEPIMYPEINRFLKLLHQCKISSFLVTNAQFPAEIRNLEPVTQLYVSVDASTKDSLKKIDRPLFKDFWQQFLDSLKALAVKQQRTVYRLMLVKAWNVDELQAYAQLVSLGNPDFIEVKGVTYCRESSASSLTMAHVPWHEEVVQFVRELVDLIPEYEIACEHEHSNCLLIAHRKFKIGGEWWTWIDYNRFQELIQEYEDSGGSKTFSAKDYMARTPHWALFGANERSFDPKDTRHQRKNK 661          
BLAST of S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase vs. Ensembl Human
Match: TYW1B (tRNA-yW synthesizing protein 1 homolog B [Source:HGNC Symbol;Acc:HGNC:33908])

HSP 1 Score: 404.831 bits (1039), Expect = 2.288e-134
Identity = 208/353 (58.92%), Postives = 240/353 (67.99%), Query Frame = 2
Query:  794 SGNELVDMEDLGMMMRKRKDIV-------------------ENKTPREMLTPMLRTSLEKQGYKLIGSHSGVKMCRWTKSMLRGRGGCYKHAFYGIASHRCMEATPSLACANKCVFCWRHHSNPVGTEWKWIMDPPEMIVDEAVAKHIQMVKQFKGVPGVQEERFLEGLKPKHCALSLVGEPIMYPRINTLVGLLHSRQISTFLVTNAQFPDAIQQLVPVTQLYVSVDAGEKDALKKIDRPLFKDFWERFVASLTAVKDKKQRTVYRLTLVKAWNVDELDAYANLVDLGQPHFIEVKGVTYCGDSKASKLTMANVPWHEEVLSFVQQLADRLENYEIAAEHEHSNCVLLAQKK 1795
            S N +VD+EDLG +M   K                      E+   R M+TP LR +L KQ                     R R     H  +   SHRCME TPSLACANKCVFCW HH+NPVGTEW W MD PEMI+ EA+  H  M+KQFKGVPGV+ ERF EG+  KHCALSLVGEPIMYP IN  + LLH  +IS+FLVTNAQFP  I+ L PVTQLYVSVDA  KD+LKKIDRPLFKDFW++F+ SL A+  K+QRTVYRL LVKAWNVDEL AYA LV LG P FIEVKGVTYC +S AS LTMA+VPWHEEV+ FV++L D +  YEIA EHEHSNC+L+A +K
Sbjct:   99 SLNSIVDVEDLGKIMDHVKKEKREKEQQEEKSGLFRNMGRNEDGERRAMITPALREALTKQ-----------------VDAPRERSLLQTHILWN-ESHRCMETTPSLACANKCVFCWWHHNNPVGTEWLWKMDQPEMILKEAIENHQNMIKQFKGVPGVKAERFEEGMTVKHCALSLVGEPIMYPEINRFLKLLHQCKISSFLVTNAQFPAEIRNLEPVTQLYVSVDASTKDSLKKIDRPLFKDFWQQFLDSLKALAVKQQRTVYRLMLVKAWNVDELQAYAQLVSLGNPDFIEVKGVTYCRESSASSLTMAHVPWHEEVVQFVRELVDLIPEYEIACEHEHSNCLLIAHRK 433          
BLAST of S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase vs. Ensembl Human
Match: TYW1 (tRNA-yW synthesizing protein 1 homolog [Source:HGNC Symbol;Acc:HGNC:25598])

HSP 1 Score: 122.865 bits (307), Expect = 1.391e-29
Identity = 94/289 (32.53%), Postives = 144/289 (49.83%), Query Frame = 2
Query:  137 IKILYGSLTGKSKILAEKFSKECIHNNYDFKMMNMNTYDPEENLNKE---KSLLVIFVSTYENGTPPEDAKWFYNWLIDAKDDFRVDKNFLENLQFAVVGLGSSYYESNFNIVSKAIDEAFGSLSGKRLLEIGICDENVVNSKNGGLDYDYQEWSKKFWKTLTC--TSETKNSNGDVXXXXXXXXXXXXXXXXXXXXXXXIEI----TEENSDDEVLTSDEEEEKNMDSGNELVDMEDLGMMMRKRKDIV-------------------ENKTPREMLTPMLRTSLEKQ 919
            +KI YGS TG +K  A   ++     +    ++N+  YDP+++L +E   K++ V  V+TY +G P E A+WF  WL +A  DFR  K +L+ +++AV GLG+S Y S+FN V K +D+    L   R++  G  D +VV SK+G ++ D++ W  KF   L      E K S G  C   K    +  +       +E+ E+    TEE    E  + +E   ++  S N +VD+EDLG +M   K                      E+   R M+TP LR +L KQ
Sbjct:   79 VKIFYGSQTGTAKGFATVLAEAVTSLDLPVAIINLKEYDPDDHLIEEVTSKNVCVFLVATYTDGLPTESAEWFCKWLEEASIDFRFGKTYLKGMRYAVFGLGNSAYASHFNKVGKNVDKWLWMLGAHRVMSRGEGDCDVVKSKHGSIEADFRAWKTKFISQLQALQKGERKKSCGGHCKKGKCESHQHGSEEREEGSHEQDELHHRDTEEEEPFESSSEEEFGGEDHQSLNSIVDVEDLGKIMDHVKKEKREKEQQEEKSGLFRNMGRNEDGERRAMITPALREALTKQ 367          
BLAST of S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase vs. Ensembl Celegans
Match: emb-8 (NADPH--cytochrome P450 reductase [Source:UniProtKB/TrEMBL;Acc:Q09590])

HSP 1 Score: 65.0846 bits (157), Expect = 9.856e-11
Identity = 48/165 (29.09%), Postives = 84/165 (50.91%), Query Frame = 2
Query:  122 NEKNTIKILYGSLTGKSKILAEKFSKECIHNNYDFKMMNMNTYDPE-ENLNK----EKSLLVIFVSTYENGTPPEDAKWFYNWLIDAKDDFRVDKNFLENLQFAVVGLGSSYYESNFNIVSKAIDEAFGSLSGKRLLEIGICDENVVNSKNGGLDYDYQEWSKKF 601
            NE   + I+YGS TG ++ ++ + +K+     Y  K + ++  D E E+LN+    E +LLV+ ++TY  G P ++A     +L     D       L  ++FAV GLG+  YE +FN +   +D+    L  KR+  +G+ D+      +  L+ D+  W + F
Sbjct:   68 NENRQVLIMYGSQTGTAEEMSGRLAKDL--TRYTKKAVVVDPEDIECEDLNRLSEVEDALLVLCIATYGEGDPTDNAVTLVEYLNAGDCD-------LSGVRFAVFGLGNKTYE-HFNEIGIQMDKQLEKLGAKRIFHLGLGDD------DANLEEDFMIWREAF 216          
BLAST of S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase vs. Ensembl Celegans
Match: emb-8 (NADPH--cytochrome P450 reductase [Source:UniProtKB/TrEMBL;Acc:Q09590])

HSP 1 Score: 65.0846 bits (157), Expect = 9.856e-11
Identity = 48/165 (29.09%), Postives = 84/165 (50.91%), Query Frame = 2
Query:  122 NEKNTIKILYGSLTGKSKILAEKFSKECIHNNYDFKMMNMNTYDPE-ENLNK----EKSLLVIFVSTYENGTPPEDAKWFYNWLIDAKDDFRVDKNFLENLQFAVVGLGSSYYESNFNIVSKAIDEAFGSLSGKRLLEIGICDENVVNSKNGGLDYDYQEWSKKF 601
            NE   + I+YGS TG ++ ++ + +K+     Y  K + ++  D E E+LN+    E +LLV+ ++TY  G P ++A     +L     D       L  ++FAV GLG+  YE +FN +   +D+    L  KR+  +G+ D+      +  L+ D+  W + F
Sbjct:   68 NENRQVLIMYGSQTGTAEEMSGRLAKDL--TRYTKKAVVVDPEDIECEDLNRLSEVEDALLVLCIATYGEGDPTDNAVTLVEYLNAGDCD-------LSGVRFAVFGLGNKTYE-HFNEIGIQMDKQLEKLGAKRIFHLGLGDD------DANLEEDFMIWREAF 216          
BLAST of S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase vs. Ensembl Celegans
Match: mtrr-1 (Methionine synthase reductase [Source:UniProtKB/Swiss-Prot;Acc:Q17574])

HSP 1 Score: 62.003 bits (149), Expect = 1.019e-9
Identity = 43/163 (26.38%), Postives = 83/163 (50.92%), Query Frame = 2
Query:  143 ILYGSLTGKSKILAEKFSKECIHNNYDFKMMNMNTYDPEENLNKEKSLLVIFVSTYENGTPPEDAKWFYNWLIDAKDDFRVDKN-----FLENLQFAVVGLGSSYYESNFNIVSKAIDEAFGSLSGKRLLEIGICDENVVNSKNGGLDYDYQEWSKKFWKTLT 616
            I +GS TG+++ +A+   ++        ++  ++  + + NLN+EK L  I VS+  +G  P++   F           R+++N     +L+NL + ++GLG S Y S++  + + ID+   +L   RL +    D+ V      GL+ + + W +KF+ TL 
Sbjct:    6 IAFGSQTGQAETIAKSLKEKAELIGLTPRLHALDENEKKFNLNEEK-LCAIVVSSTGDGDAPDNCARFVR---------RINRNSLENEYLKNLDYVLLGLGDSNY-SSYQTIPRKIDKQLTALGANRLFDRAEADDQV------GLELEVEPWIEKFFATLA 151          
BLAST of S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase vs. Ensembl Celegans
Match: mtrr-1 (Methionine synthase reductase [Source:UniProtKB/Swiss-Prot;Acc:Q17574])

HSP 1 Score: 62.003 bits (149), Expect = 1.019e-9
Identity = 43/163 (26.38%), Postives = 83/163 (50.92%), Query Frame = 2
Query:  143 ILYGSLTGKSKILAEKFSKECIHNNYDFKMMNMNTYDPEENLNKEKSLLVIFVSTYENGTPPEDAKWFYNWLIDAKDDFRVDKN-----FLENLQFAVVGLGSSYYESNFNIVSKAIDEAFGSLSGKRLLEIGICDENVVNSKNGGLDYDYQEWSKKFWKTLT 616
            I +GS TG+++ +A+   ++        ++  ++  + + NLN+EK L  I VS+  +G  P++   F           R+++N     +L+NL + ++GLG S Y S++  + + ID+   +L   RL +    D+ V      GL+ + + W +KF+ TL 
Sbjct:    6 IAFGSQTGQAETIAKSLKEKAELIGLTPRLHALDENEKKFNLNEEK-LCAIVVSSTGDGDAPDNCARFVR---------RINRNSLENEYLKNLDYVLLGLGDSNY-SSYQTIPRKIDKQLTALGANRLFDRAEADDQV------GLELEVEPWIEKFFATLA 151          
BLAST of S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase vs. Ensembl Celegans
Match: fre-1 (NADPH-dependent diflavin oxidoreductase 1 [Source:UniProtKB/TrEMBL;Acc:M1ZMI3])

HSP 1 Score: 59.3066 bits (142), Expect = 6.353e-9
Identity = 43/165 (26.06%), Postives = 75/165 (45.45%), Query Frame = 2
Query:  134 TIKILYGSLTGKSKILAEKFSKECIHNNYDFKMMNMNTYDPEENLNKEKSLLVIFVSTYENGTPPEDAKWFYNWLIDAKDDFRVDKNFLENLQFAVVGLGSSYYESNFNIVSKAIDEAFGSLSGKRLLEIGICDENVVNSKNGGLDYDYQEWSKKFWKTLTCTSE 628
            +I ILYGS TG ++ +AE   +E    +   ++  ++ YD  + L  EK +L +  +T +   PP   K    W +  +     D  FL+N+   V+GLG S Y+  +N   K +      L  K +  + + D+        G+D  +  W  + WK +   +E
Sbjct:    2 SIAILYGSETGTAQDIAESLRREAQQRHLQARVHELDEYDVSQ-LPMEKVVLFVVSTTGQGEMPPNMRK---TWKLLLRKSLGAD--FLKNVNIGVLGLGDSSYQ-KYNFAGKKLYRRLVQLGAKMMCGVHLADDQ----HEIGIDGAFIPWKTECWKKIKEIAE 155          
BLAST of S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase vs. Ensembl Fly
Match: Cpr (gene:FBgn0015623 transcript:FBtr0331224)

HSP 1 Score: 68.9366 bits (167), Expect = 8.042e-12
Identity = 46/163 (28.22%), Postives = 78/163 (47.85%), Query Frame = 2
Query:  134 TIKILYGSLTGKSKILAEKFSKECIHNNYDFKMMNMNTYDPEENL---NKEKSLLVIFVSTYENGTPPEDAKWFYNWLIDAKDDFRVDKNFLENLQFAVVGLGSSYYESNFNIVSKAIDEAFGSLSGKRLLEIGICDENVVNSKNGGLDYDYQEWSKKFWKTL 613
            ++ + YGS TG  +  A + +KE I       + +    D EE L   + + SL V  ++TY  G P ++A  FY W+     D       L  L +AV GLG+  YE ++N V+  +D+    L   R+ E+G+ D+      +  ++ D+  W  +FW  +
Sbjct:   83 SLVVFYGSQTGTGEEFAGRLAKEGIRYRLKGMVADPEECDMEELLQLKDIDNSLAVFCLATYGEGDPTDNAMEFYEWITSGDVD-------LSGLNYAVFGLGNKTYE-HYNKVAIYVDKRLEELGANRVFELGLGDD------DANIEDDFITWKDRFWPAV 231          
BLAST of S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase vs. Ensembl Fly
Match: Cpr (gene:FBgn0015623 transcript:FBtr0331223)

HSP 1 Score: 68.9366 bits (167), Expect = 8.042e-12
Identity = 46/163 (28.22%), Postives = 78/163 (47.85%), Query Frame = 2
Query:  134 TIKILYGSLTGKSKILAEKFSKECIHNNYDFKMMNMNTYDPEENL---NKEKSLLVIFVSTYENGTPPEDAKWFYNWLIDAKDDFRVDKNFLENLQFAVVGLGSSYYESNFNIVSKAIDEAFGSLSGKRLLEIGICDENVVNSKNGGLDYDYQEWSKKFWKTL 613
            ++ + YGS TG  +  A + +KE I       + +    D EE L   + + SL V  ++TY  G P ++A  FY W+     D       L  L +AV GLG+  YE ++N V+  +D+    L   R+ E+G+ D+      +  ++ D+  W  +FW  +
Sbjct:   83 SLVVFYGSQTGTGEEFAGRLAKEGIRYRLKGMVADPEECDMEELLQLKDIDNSLAVFCLATYGEGDPTDNAMEFYEWITSGDVD-------LSGLNYAVFGLGNKTYE-HYNKVAIYVDKRLEELGANRVFELGLGDD------DANIEDDFITWKDRFWPAV 231          
BLAST of S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase vs. Ensembl Fly
Match: Cpr (gene:FBgn0015623 transcript:FBtr0079250)

HSP 1 Score: 68.9366 bits (167), Expect = 8.042e-12
Identity = 46/163 (28.22%), Postives = 78/163 (47.85%), Query Frame = 2
Query:  134 TIKILYGSLTGKSKILAEKFSKECIHNNYDFKMMNMNTYDPEENL---NKEKSLLVIFVSTYENGTPPEDAKWFYNWLIDAKDDFRVDKNFLENLQFAVVGLGSSYYESNFNIVSKAIDEAFGSLSGKRLLEIGICDENVVNSKNGGLDYDYQEWSKKFWKTL 613
            ++ + YGS TG  +  A + +KE I       + +    D EE L   + + SL V  ++TY  G P ++A  FY W+     D       L  L +AV GLG+  YE ++N V+  +D+    L   R+ E+G+ D+      +  ++ D+  W  +FW  +
Sbjct:   83 SLVVFYGSQTGTGEEFAGRLAKEGIRYRLKGMVADPEECDMEELLQLKDIDNSLAVFCLATYGEGDPTDNAMEFYEWITSGDVD-------LSGLNYAVFGLGNKTYE-HYNKVAIYVDKRLEELGANRVFELGLGDD------DANIEDDFITWKDRFWPAV 231          
BLAST of S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase vs. Ensembl Fly
Match: CG13667 (gene:FBgn0035890 transcript:FBtr0076611)

HSP 1 Score: 63.1586 bits (152), Expect = 5.465e-10
Identity = 47/170 (27.65%), Postives = 82/170 (48.24%), Query Frame = 2
Query:  143 ILYGSLTGKSKILAEKFSKECIHNNYDFKMMNMNTYDPEENLNKEKSLLVIFVSTYENGTPPEDAKWFYNWLIDAKDDFRVDKNFLENLQFAVVGLGSSYYESNFNIVSKAIDEAFGSLSGKRLLEIGICDENVVNSKNGGLDYDYQEWSKKFWKTLTCTS---ETKNSN 643
            +LYGS TG ++ +AE+  +E     +   ++  + YD  + +  E+ L+V  V+T  +G  P++ K  + +L+       +    L+ +QFA +GLG S Y   FN  +K + +   +L    +  +G+CD+       G L      W+K  W  L   S   E+K SN
Sbjct:    5 VLYGSQTGTAQDVAEQIWRESHQLGFQGPVLPFDEYDMTKLI--EERLVVFVVATTGDGVEPDNMKLAWRFLLKRS----LPAQSLQGMQFACLGLGDSSY-PKFNYAAKKLSKRLQNLGANSVCPVGLCDD---QHDYGHLGVSL-SWTKDLWTALKGISGLDESKLSN 163          
BLAST of S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase vs. Ensembl Fly
Match: CG13667 (gene:FBgn0035890 transcript:FBtr0076610)

HSP 1 Score: 63.1586 bits (152), Expect = 5.465e-10
Identity = 47/170 (27.65%), Postives = 82/170 (48.24%), Query Frame = 2
Query:  143 ILYGSLTGKSKILAEKFSKECIHNNYDFKMMNMNTYDPEENLNKEKSLLVIFVSTYENGTPPEDAKWFYNWLIDAKDDFRVDKNFLENLQFAVVGLGSSYYESNFNIVSKAIDEAFGSLSGKRLLEIGICDENVVNSKNGGLDYDYQEWSKKFWKTLTCTS---ETKNSN 643
            +LYGS TG ++ +AE+  +E     +   ++  + YD  + +  E+ L+V  V+T  +G  P++ K  + +L+       +    L+ +QFA +GLG S Y   FN  +K + +   +L    +  +G+CD+       G L      W+K  W  L   S   E+K SN
Sbjct:    5 VLYGSQTGTAQDVAEQIWRESHQLGFQGPVLPFDEYDMTKLI--EERLVVFVVATTGDGVEPDNMKLAWRFLLKRS----LPAQSLQGMQFACLGLGDSSY-PKFNYAAKKLSKRLQNLGANSVCPVGLCDD---QHDYGHLGVSL-SWTKDLWTALKGISGLDESKLSN 163          
BLAST of S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase vs. Ensembl Zebrafish
Match: tyw1 (tRNA-yW synthesizing protein 1 homolog (S. cerevisiae) [Source:NCBI gene;Acc:562076])

HSP 1 Score: 704.131 bits (1816), Expect = 0.000e+0
Identity = 354/646 (54.80%), Postives = 446/646 (69.04%), Query Frame = 2
Query:  137 IKILYGSLTGKSKILAEKFSKECIHNNYDFKMMNMNTYDPEENLNKE---KSLLVIFVSTYENGTPPEDAKWFYNWLIDAKDDFRVDKNFLENLQFAVVGLGSSYYESNFNIVSKAIDEAFGSLSGKRLLEIGICDENVVNSKNGGLDYDYQEWSKKFWKTLTCTS--ETKNSNGDVXXXXXXXXXXXXXXXXXXXXXXXIEITEENSDDEVLTSDEEEEKNMDSGNELVDMEDLGMM---MRKRKDIVE-------------------NKTPREMLTPMLRTSLEKQGYKLIGSHSGVKMCRWTKSMLRGRGGCYKHAFYGIASHRCMEATPSLACANKCVFCWRHHSNPVGTEWKWIMDPPEMIVDEAVAKHIQMVKQFKGVPGVQEERFLEGLKPKHCALSLVGEPIMYPRINTLVGLLHSRQISTFLVTNAQFPDAIQQLVPVTQLYVSVDAGEKDALKKIDRPLFKDFWERFVASLTAVKDKKQRTVYRLTLVKAWNVDELDAYANLVDLGQPHFIEVKGVTYCGDSKASKLTMANVPWHEEVLSFVQQLADRLENYEIAAEHEHSNCVLLAQKKFKVNDEWNTWIDYEKFHELVQT------GKDFDATEYMAPTPSWAAYGSNEKGFNPSDTRFRKLRK 1975
            +K+ YGS TG +K  A++ +++ I      ++++M  +DPE+ L +E   K + V  V+TY +G P E A+WF  WL +A  DFR  K +L+ +++AV GLG+S Y  ++N VSK+ID+    LS  R++  G  D NVV S++G +  D+Q W  KF   L   +  E K  +G+       +  K            +   +EE   +     +   E     G+ ++DMEDLG +   M+K K  +E                    +  REM+TP LR SL KQGYKLIGSHSGVK+CRWTKSMLRGRGGCYKH FYGI SHRCME TPSLACANKCVFCWRHH+NPVGTEW+W MDP E I+ EA+  H  M++QF+GVPGV+ ERF EGL  KHCALSLVGEPIMYP IN+ + LLH + IS+FLVTNAQFP+ I+ LVPVTQLYVSVDA  KD+LKKIDRPLFKDFW+RF+ SL A+ +K+QRTVYRLTLVKAWNVDEL AYA+L+ LGQP FIEVKGVTYCG+S AS LTMANVPWHEEV+ FVQQLA+ L +YEIA EHEHSNC+LLA  KFKV+ EW TWIDYE+F EL+Q        K+F A +YMA TPSWA +G+ E+GF+P+DTRF++  K
Sbjct:  103 VKVFYGSQTGTAKGFAKELAEDVIAQGIQCEVIDMKDFDPEDRLAEECTSKIICVFLVATYTDGQPTESAEWFCKWLQEASTDFRYGKTYLKGMRYAVFGLGNSVYVGHYNTVSKSIDKWLWMLSAARIMTRGEGDCNVVKSRHGSVQADFQAWKGKFLNRLQALAKGEKKACSGNCKKASCKNKKKHKEEAEDNHSLAEKNNSEEELMESSSDEESSSEDEKSHGS-VIDMEDLGNVMNHMKKAKQRMEEDEEDSQRVKQNGERKSECEEERREMITPALRDSLTKQGYKLIGSHSGVKLCRWTKSMLRGRGGCYKHTFYGIESHRCMETTPSLACANKCVFCWRHHTNPVGTEWRWKMDPAEKIIQEAMENHRNMIRQFRGVPGVRPERFEEGLTVKHCALSLVGEPIMYPEINSFLKLLHQQNISSFLVTNAQFPEEIRSLVPVTQLYVSVDASTKDSLKKIDRPLFKDFWQRFLDSLRALGEKQQRTVYRLTLVKAWNVDELKAYADLIALGQPDFIEVKGVTYCGESSASSLTMANVPWHEEVIYFVQQLANLLPDYEIACEHEHSNCLLLANHKFKVDGEWWTWIDYERFQELIQQYEESGGTKNFSAMDYMAKTPSWAVFGAGERGFDPTDTRFQRKNK 747          
BLAST of S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase vs. Ensembl Zebrafish
Match: pora (P450 (cytochrome) oxidoreductase a [Source:ZFIN;Acc:ZDB-GENE-050809-121])

HSP 1 Score: 82.0333 bits (201), Expect = 9.855e-16
Identity = 54/168 (32.14%), Postives = 85/168 (50.60%), Query Frame = 2
Query:  134 TIKILYGSLTGKSKILAEKFSKECIHNNYDFKMMNMNTYDPEENLNKE--------KSLLVIFVSTYENGTPPEDAKWFYNWLIDAKDDFRVDKNFLENLQFAVVGLGSSYYESNFNIVSKAIDEAFGSLSGKRLLEIGICDENVVNSKNGGLDYDYQEWSKKFWKTL 613
            ++ + YGS TG  +  A + SK+   + Y  K M     DPEE    E        KS+ V  ++TY  G P ++A+ FY+WL    DD       LE + FAV GLG+  YE ++N + K  D+    L GKR+ ++G+ D+      +  L+ D+  W ++FW  +
Sbjct:   76 SVVVFYGSQTGTGEEFANRLSKDA--HRYGMKGM---AADPEEYDMSELSRLKEIPKSMAVFCMATYGEGDPTDNAQEFYDWLQGTDDD-------LEGVNFAVFGLGNKTYE-HYNAMGKYTDKRLAELGGKRVFDLGLGDD------DSNLEEDFISWKEQFWPAV 224          
BLAST of S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase vs. Ensembl Zebrafish
Match: porb (P450 (cytochrome) oxidoreductase b [Source:ZFIN;Acc:ZDB-GENE-030131-5767])

HSP 1 Score: 75.8702 bits (185), Expect = 8.664e-14
Identity = 50/167 (29.94%), Postives = 86/167 (51.50%), Query Frame = 2
Query:  137 IKILYGSLTGKSKILAEKFSKECIHNNYDFKMMNMNTYDPEE----NLNK----EKSLLVIFVSTYENGTPPEDAKWFYNWLIDAKDDFRVDKNFLENLQFAVVGLGSSYYESNFNIVSKAIDEAFGSLSGKRLLEIGICDENVVNSKNGGLDYDYQEWSKKFWKTL 613
            I + YGS TG     AE+FS     + + + M  M   DPEE     L++    + SL +  ++TY  G P ++A+ FY+WL +A  DF         L++ V  LG+  YE ++N + K +D+    L  +R+ ++G+ D+      +G L+ D+  W ++FW  +
Sbjct:   74 IVVFYGSQTGT----AEEFSNRLAKDAHRYGMKGMAA-DPEEYDLSELSRMGEIDNSLAIFCLATYGEGDPTDNAQDFYDWLQEADADF-------SGLKYTVFALGNKTYE-HYNAMGKYVDKRLEELGAQRIFDLGMGDD------DGNLEEDFVSWREQFWPAV 221          
BLAST of S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase vs. Ensembl Zebrafish
Match: ndor1 (NADPH dependent diflavin oxidoreductase 1 [Source:NCBI gene;Acc:393621])

HSP 1 Score: 70.4774 bits (171), Expect = 4.129e-12
Identity = 53/165 (32.12%), Postives = 82/165 (49.70%), Query Frame = 2
Query:  131 NTIKILYGSLTGKSKILAEKFSKECIHNNYDFKMMNMNTYDPEENLNKEKSLLVIFVSTYENGTPPEDAKWFYNWLIDAKDDFR--VDKNFLENLQFAVVGLGSSYYESNFNIVSKAIDEAFGSLSGKRLLEIGICDENVVNSKNGGLDYDYQEWSKKFW-KTLT 616
            +T+ +LYGS TG ++  AE+  ++        K   ++TY+   NL  E SL+V   +T   G PP++ K F+ +L      FR  +  + L  L  AV+GLG S Y   FN V+K + +    L    LL +G+ D+      +G +D     W   FW KTL+
Sbjct:    4 HTVLVLYGSQTGTAQDTAERIGRQAQRRRLRVKAEALDTYN-VANLISE-SLVVFVCATTGQGDPPDNMKKFWRFL------FRKSLPADSLSRLDCAVLGLGDSSY-PKFNFVAKKLHKRLLQLGANMLLPVGLADDQHDLGPDGVID----PWLLSFWQKTLS 155          
BLAST of S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase vs. Ensembl Zebrafish
Match: ndor1 (NADPH dependent diflavin oxidoreductase 1 [Source:NCBI gene;Acc:393621])

HSP 1 Score: 70.4774 bits (171), Expect = 4.129e-12
Identity = 53/165 (32.12%), Postives = 82/165 (49.70%), Query Frame = 2
Query:  131 NTIKILYGSLTGKSKILAEKFSKECIHNNYDFKMMNMNTYDPEENLNKEKSLLVIFVSTYENGTPPEDAKWFYNWLIDAKDDFR--VDKNFLENLQFAVVGLGSSYYESNFNIVSKAIDEAFGSLSGKRLLEIGICDENVVNSKNGGLDYDYQEWSKKFW-KTLT 616
            +T+ +LYGS TG ++  AE+  ++        K   ++TY+   NL  E SL+V   +T   G PP++ K F+ +L      FR  +  + L  L  AV+GLG S Y   FN V+K + +    L    LL +G+ D+      +G +D     W   FW KTL+
Sbjct:    4 HTVLVLYGSQTGTAQDTAERIGRQAQRRRLRVKAEALDTYN-VANLISE-SLVVFVCATTGQGDPPDNMKKFWRFL------FRKSLPADSLSRLDCAVLGLGDSSY-PKFNFVAKKLHKRLLQLGANMLLPVGLADDQHDLGPDGVID----PWLLSFWQKTLS 155          
BLAST of S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase vs. Ensembl Xenopus
Match: large2 (LARGE xylosyl- and glucuronyltransferase 2 [Source:Xenbase;Acc:XB-GENE-5871953])

HSP 1 Score: 697.197 bits (1798), Expect = 0.000e+0
Identity = 348/645 (53.95%), Postives = 450/645 (69.77%), Query Frame = 2
Query:  137 IKILYGSLTGKSKILAEKFSKECIHNNYDFKMMNMNTYDPEENLNKE---KSLLVIFVSTYENGTPPEDAKWFYNWLIDAKDDFRVDKNFLENLQFAVVGLGSSYYESNFNIVSKAIDEAFGSLSGKRLLEIGICDENVVNSKNGGLDYDYQEWSKKFWKTL-TCTSETKNSNGDVXXXXXXXXXXXXXXXXXXXXXXXIEITEENSDDEVLTSDEEEEKNMDSGNELVDMEDLG---MMMRKRK-------------------DIVENKTPREMLTPMLRTSLEKQGYKLIGSHSGVKMCRWTKSMLRGRGGCYKHAFYGIASHRCMEATPSLACANKCVFCWRHHSNPVGTEWKWIMDPPEMIVDEAVAKHIQMVKQFKGVPGVQEERFLEGLKPKHCALSLVGEPIMYPRINTLVGLLHSRQISTFLVTNAQFPDAIQQLVPVTQLYVSVDAGEKDALKKIDRPLFKDFWERFVASLTAVKDKKQRTVYRLTLVKAWNVDELDAYANLVDLGQPHFIEVKGVTYCGDSKASKLTMANVPWHEEVLSFVQQLADRLENYEIAAEHEHSNCVLLAQKKFKVNDEWNTWIDYEKFHELVQT------GKDFDATEYMAPTPSWAAYGSNEKGFNPSDTRFRKLRK 1975
            +KI YGS TG +K  A     E        +++NM  YDP++NL +E   K++ V  V+TY +G PPE A+WF  WL +A +DFR  K +L+ +++AV GLG+S Y +++N V K ID+    LS  R++     D NVV SK+G ++ D++ W  +F   L    S  K      C   K      +++++   + +  E  E   +    TSD E E++ + G+ L+DMEDLG    +M+K K                   +  E + PREM+TP L+ +L KQGY+LIGSHSGVK+CRWTKSMLRGRGGCYKH FYGI SHRCME TPSLACANKCVFCWRHH+NPVGTEW+W MD PEMI++EA+  H  M+KQFKGVPGV+ ER+ EGL  KHCALSLVGEPIMYP IN  + LLH++ IS+FLVTNAQFP+ I+ L PVTQLYVSVDA  KD+LKKIDRPLFKDFW+RF+ SL A+ +K+QRTVYRLTLVKAWNV+EL AYA+LV +G+P FIEVKGVTYCG+S AS LTMANVPWH+EV+ FV++LAD L +YE+A EHEHSNC+L+A +KFK+N +W TWIDYE+F EL++        + F A +Y+A TP WA +GS E+GF+P D RF++  K
Sbjct:   84 VKIFYGSQTGTAKGFAHMLDGEITLLGLPVEIINMKEYDPDDNLIEEATSKNVCVFLVATYTDGQPPESAEWFCKWLEEASNDFRFGKTYLKGMRYAVFGLGNSVYSTHYNTVGKNIDKWLWMLSASRVMTRAEGDCNVVKSKHGSIESDFEAWKARFLSRLKALISGEKKPCSGKCKKGKCKSKMKSSTDAVEEEAKHSEHEETEEETFETTSDSEPEEHGEPGSGLIDMEDLGKAMSIMKKAKREQDTNEEARNRGKSLQSDEAKEKEEPREMITPALQEALTKQGYRLIGSHSGVKLCRWTKSMLRGRGGCYKHTFYGIESHRCMETTPSLACANKCVFCWRHHTNPVGTEWRWKMDQPEMILEEAILNHQNMIKQFKGVPGVKPERYEEGLVVKHCALSLVGEPIMYPEINKFLRLLHNQHISSFLVTNAQFPEEIRSLEPVTQLYVSVDASTKDSLKKIDRPLFKDFWQRFLDSLKALAEKQQRTVYRLTLVKAWNVEELKAYADLVAVGRPDFIEVKGVTYCGESSASNLTMANVPWHDEVVRFVEELADLLPDYEVACEHEHSNCMLIAHEKFKINGDWWTWIDYERFQELIRAFDESKGSQTFTAMDYVAKTPEWALFGSRERGFDPLDKRFQRKNK 728          
BLAST of S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase vs. Ensembl Xenopus
Match: large2 (LARGE xylosyl- and glucuronyltransferase 2 [Source:Xenbase;Acc:XB-GENE-5871953])

HSP 1 Score: 697.197 bits (1798), Expect = 0.000e+0
Identity = 348/645 (53.95%), Postives = 450/645 (69.77%), Query Frame = 2
Query:  137 IKILYGSLTGKSKILAEKFSKECIHNNYDFKMMNMNTYDPEENLNKE---KSLLVIFVSTYENGTPPEDAKWFYNWLIDAKDDFRVDKNFLENLQFAVVGLGSSYYESNFNIVSKAIDEAFGSLSGKRLLEIGICDENVVNSKNGGLDYDYQEWSKKFWKTL-TCTSETKNSNGDVXXXXXXXXXXXXXXXXXXXXXXXIEITEENSDDEVLTSDEEEEKNMDSGNELVDMEDLG---MMMRKRK-------------------DIVENKTPREMLTPMLRTSLEKQGYKLIGSHSGVKMCRWTKSMLRGRGGCYKHAFYGIASHRCMEATPSLACANKCVFCWRHHSNPVGTEWKWIMDPPEMIVDEAVAKHIQMVKQFKGVPGVQEERFLEGLKPKHCALSLVGEPIMYPRINTLVGLLHSRQISTFLVTNAQFPDAIQQLVPVTQLYVSVDAGEKDALKKIDRPLFKDFWERFVASLTAVKDKKQRTVYRLTLVKAWNVDELDAYANLVDLGQPHFIEVKGVTYCGDSKASKLTMANVPWHEEVLSFVQQLADRLENYEIAAEHEHSNCVLLAQKKFKVNDEWNTWIDYEKFHELVQT------GKDFDATEYMAPTPSWAAYGSNEKGFNPSDTRFRKLRK 1975
            +KI YGS TG +K  A     E        +++NM  YDP++NL +E   K++ V  V+TY +G PPE A+WF  WL +A +DFR  K +L+ +++AV GLG+S Y +++N V K ID+    LS  R++     D NVV SK+G ++ D++ W  +F   L    S  K      C   K      +++++   + +  E  E   +    TSD E E++ + G+ L+DMEDLG    +M+K K                   +  E + PREM+TP L+ +L KQGY+LIGSHSGVK+CRWTKSMLRGRGGCYKH FYGI SHRCME TPSLACANKCVFCWRHH+NPVGTEW+W MD PEMI++EA+  H  M+KQFKGVPGV+ ER+ EGL  KHCALSLVGEPIMYP IN  + LLH++ IS+FLVTNAQFP+ I+ L PVTQLYVSVDA  KD+LKKIDRPLFKDFW+RF+ SL A+ +K+QRTVYRLTLVKAWNV+EL AYA+LV +G+P FIEVKGVTYCG+S AS LTMANVPWH+EV+ FV++LAD L +YE+A EHEHSNC+L+A +KFK+N +W TWIDYE+F EL++        + F A +Y+A TP WA +GS E+GF+P D RF++  K
Sbjct:  105 VKIFYGSQTGTAKGFAHMLDGEITLLGLPVEIINMKEYDPDDNLIEEATSKNVCVFLVATYTDGQPPESAEWFCKWLEEASNDFRFGKTYLKGMRYAVFGLGNSVYSTHYNTVGKNIDKWLWMLSASRVMTRAEGDCNVVKSKHGSIESDFEAWKARFLSRLKALISGEKKPCSGKCKKGKCKSKMKSSTDAVEEEAKHSEHEETEEETFETTSDSEPEEHGEPGSGLIDMEDLGKAMSIMKKAKREQDTNEEARNRGKSLQSDEAKEKEEPREMITPALQEALTKQGYRLIGSHSGVKLCRWTKSMLRGRGGCYKHTFYGIESHRCMETTPSLACANKCVFCWRHHTNPVGTEWRWKMDQPEMILEEAILNHQNMIKQFKGVPGVKPERYEEGLVVKHCALSLVGEPIMYPEINKFLRLLHNQHISSFLVTNAQFPEEIRSLEPVTQLYVSVDASTKDSLKKIDRPLFKDFWQRFLDSLKALAEKQQRTVYRLTLVKAWNVEELKAYADLVAVGRPDFIEVKGVTYCGESSASNLTMANVPWHDEVVRFVEELADLLPDYEVACEHEHSNCMLIAHEKFKINGDWWTWIDYERFQELIRAFDESKGSQTFTAMDYVAKTPEWALFGSRERGFDPLDKRFQRKNK 749          
BLAST of S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase vs. Ensembl Xenopus
Match: large2 (LARGE xylosyl- and glucuronyltransferase 2 [Source:Xenbase;Acc:XB-GENE-5871953])

HSP 1 Score: 674.085 bits (1738), Expect = 0.000e+0
Identity = 338/626 (53.99%), Postives = 434/626 (69.33%), Query Frame = 2
Query:  137 IKILYGSLTGKSKILAEKFSKECIHNNYDFKMMNMNTYDPEENLNKE---KSLLVIFVSTYENGTPPEDAKWFYNWLIDAKDDFRVDKNFLENLQFAVVGLGSSYYESNFNIVSKAIDEAFGSLSGKRLLEIGICDENVVNSKNGGLDYDYQEWSKKFWKTLTC--TSETKNSNGDVXXXXXXXXXXXXXXXXXXXXXXXIEITEENSDDEVLTSDEEEEKNMDSGNELVDMEDLG--MMMRKRKDIVENKTPREMLTPMLRTSLEKQGYKLIGSHSGVKMCRWTKSMLRGRGGCYKHAFYGIASHRCMEATPSLACANKCVFCWRHHSNPVGTEWKWIMDPPEMIVDEAVAKHIQMVKQFKGVPGVQEERFLEGLKPKHCALSLVGEPIMYPRINTLVGLLHSRQISTFLVTNAQFPDAIQQLVPVTQLYVSVDAGEKDALKKIDRPLFKDFWERFVASLTAVKDKKQRTVYRLTLVKAWNVDELDAYANLVDLGQPHFIEVKGVTYCGDSKASKLTMANVPWHEEVLSFVQQLADRLENYEIAAEHEHSNCVLLAQKKFKVNDEWNTWIDYEKFHELVQT------GKDFDATEYMAPTPSWAAYGSNEKGFNPSDTRFRKLRK 1975
            +KI YGS TG +K  A     E        +++NM  YDP++NL +E   K++ V  V+TY +G PPE A+WF  WL +A +DFR  K +L+ +++AV GLG+S Y +++N V K ID+    LS  R++     D NVV SK+G ++ D++ W  +F   L    + E K  +                      K++K+E  E        TSD E E++ + G+ L+DMEDLG  MM+ K   +            +L    +  GY+LIGSHSGVK+CRWTKSMLRGRGGCYKH FYGI SHRCME TPSLACANKCVFCWRHH+NPVGTEW+W MD PEMI++EA+  H  M+KQFKGVPGV+ ER+ EGL  KHCALSLVGEPIMYP IN  + LLH++ IS+FLVTNAQFP+ I+ L PVTQLYVSVDA  KD+LKKIDRPLFKDFW+RF+ SL A+ +K+QRTVYRLTLVKAWNV+EL AYA+LV +G+P FIEVKGVTYCG+S AS LTMANVPWH+EV+ FV++LAD L +YE+A EHEHSNC+L+A +KFK+N +W TWIDYE+F EL++        + F A +Y+A TP WA +GS E+GF+P D RF++  K
Sbjct:   48 VKIFYGSQTGTAKGFAHMLDGEITLLGLPVEIINMKEYDPDDNLIEEATSKNVCVFLVATYTDGQPPESAEWFCKWLEEASNDFRFGKTYLKGMRYAVFGLGNSVYSTHYNTVGKNIDKWLWMLSASRVMTRAEGDCNVVKSKHGSIESDFEAWKARFLSRLKALISGEKKPCS----------------GKCKKGKSKKVETFET-------TSDSEPEEHGEPGSGLIDMEDLGKAMMLNKYFTVT-----------VLNLLCKFSGYRLIGSHSGVKLCRWTKSMLRGRGGCYKHTFYGIESHRCMETTPSLACANKCVFCWRHHTNPVGTEWRWKMDQPEMILEEAILNHQNMIKQFKGVPGVKPERYEEGLVVKHCALSLVGEPIMYPEINKFLRLLHNQHISSFLVTNAQFPEEIRSLEPVTQLYVSVDASTKDSLKKIDRPLFKDFWQRFLDSLKALAEKQQRTVYRLTLVKAWNVEELKAYADLVAVGRPDFIEVKGVTYCGESSASNLTMANVPWHDEVVRFVEELADLLPDYEVACEHEHSNCMLIAHEKFKINGDWWTWIDYERFQELIRAFDESKGSQTFTAMDYVAKTPEWALFGSRERGFDPLDKRFQRKNK 639          
BLAST of S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase vs. Ensembl Xenopus
Match: large2 (LARGE xylosyl- and glucuronyltransferase 2 [Source:Xenbase;Acc:XB-GENE-5871953])

HSP 1 Score: 673.7 bits (1737), Expect = 0.000e+0
Identity = 337/623 (54.09%), Postives = 436/623 (69.98%), Query Frame = 2
Query:  137 IKILYGSLTGKSKILAEKFSKECIHNNYDFKMMNMNTYDPEENLNKE---KSLLVIFVSTYENGTPPEDAKWFYNWLIDAKDDFRVDKNFLENLQFAVVGLGSSYYESNFNIVSKAIDEAFGSLSGKRLLEIGICDENVVNSKNGGLDYDYQEWSKKFWKTL-TCTSETKNSNGDVXXXXXXXXXXXXXXXXXXXXXXXIEITEENSDDEVLTSDEEEEKNMDSGNELVDMEDLGMMMRKRKDIVENKTPREMLTPMLRTSLEKQGYKLIGSHSGVKMCRWTKSMLRGRGGCYKHAFYGIASHRCMEATPSLACANKCVFCWRHHSNPVGTEWKWIMDPPEMIVDEAVAKHIQMVKQFKGVPGVQEERFLEGLKPKHCALSLVGEPIMYPRINTLVGLLHSRQISTFLVTNAQFPDAIQQLVPVTQLYVSVDAGEKDALKKIDRPLFKDFWERFVASLTAVKDKKQRTVYRLTLVKAWNVDELDAYANLVDLGQPHFIEVKGVTYCGDSKASKLTMANVPWHEEVLSFVQQLADRLENYEIAAEHEHSNCVLLAQKKFKVNDEWNTWIDYEKFHELVQT------GKDFDATEYMAPTPSWAAYGSNEKGFNPSDTRFRKLRK 1975
            +KI YGS TG +K  A     E        +++NM  YDP++NL +E   K++ V  V+TY +G PPE A+WF  WL +A +DFR  K +L+ +++AV GLG+S Y +++N V K ID+    LS  R++     D NVV SK+G ++ D++ W  +F   L    S  K      C   K      +++++   + +  E  E   +    TSD E E++ + G+ L+DMEDLG               + M+T +L    +  GY+LIGSHSGVK+CRWTKSMLRGRGGCYKH FYGI SHRCME TPSLACANKCVFCWRHH+NPVGTEW+W MD PEMI++EA+  H  M+KQFKGVPGV+ ER+ EGL  KHCALSLVGEPIMYP IN  + LLH++ IS+FLVTNAQFP+ I+ L PVTQLYVSVDA  KD+LKKIDRPLFKDFW+RF+ SL A+ +K+QRTVYRLTLVKAWNV+EL AYA+LV +G+P FIEVKGVTYCG+S AS LTMANVPWH+EV+ FV++LAD L +YE+A EHEHSNC+L+A +KFK+N +W TWIDYE+F EL++        + F A +Y+A TP WA +GS E+GF+P D RF++  K
Sbjct:   68 VKIFYGSQTGTAKGFAHMLDGEITLLGLPVEIINMKEYDPDDNLIEEATSKNVCVFLVATYTDGQPPESAEWFCKWLEEASNDFRFGKTYLKGMRYAVFGLGNSVYSTHYNTVGKNIDKWLWMLSASRVMTRAEGDCNVVKSKHGSIESDFEAWKARFLSRLKALISGEKKPCSGKCKKGKCKSKMKSSTDAVEEEAKHSEHEETEEETFETTSDSEPEEHGEPGSGLIDMEDLG---------------KAMIT-VLNLLCKFSGYRLIGSHSGVKLCRWTKSMLRGRGGCYKHTFYGIESHRCMETTPSLACANKCVFCWRHHTNPVGTEWRWKMDQPEMILEEAILNHQNMIKQFKGVPGVKPERYEEGLVVKHCALSLVGEPIMYPEINKFLRLLHNQHISSFLVTNAQFPEEIRSLEPVTQLYVSVDASTKDSLKKIDRPLFKDFWQRFLDSLKALAEKQQRTVYRLTLVKAWNVEELKAYADLVAVGRPDFIEVKGVTYCGESSASNLTMANVPWHDEVVRFVEELADLLPDYEVACEHEHSNCMLIAHEKFKINGDWWTWIDYERFQELIRAFDESKGSQTFTAMDYVAKTPEWALFGSRERGFDPLDKRFQRKNK 674          
BLAST of S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase vs. Ensembl Xenopus
Match: large2 (LARGE xylosyl- and glucuronyltransferase 2 [Source:Xenbase;Acc:XB-GENE-5871953])

HSP 1 Score: 608.986 bits (1569), Expect = 0.000e+0
Identity = 304/573 (53.05%), Postives = 397/573 (69.28%), Query Frame = 2
Query:  278 KSLLVIFVSTYENGTPPEDAKWFYNWLIDAKDDFRVDKNFLENLQFAVVGLGSSYYESNFNIVSKAIDEAFGSLSGKRLLEIGICDENVVNSKNGGLDYDYQEWSKKFWKTL-TCTSETKNSNGDVXXXXXXXXXXXXXXXXXXXXXXXIEITEENSDDEVLTSDEEEEKNMDSGNELVDMEDLGMMMRKRKDIVENKTPREMLTPMLRTSLEKQGYKLIGSHSGVKMCRWTKSMLRGRGGCYKHAFYGIASHRCMEATPSLACANKCVFCWRHHSNPVGTEWKWIMDPPEMIVDEAVAKHIQMVKQFKGVPGVQEERFLEGLKPKHCALSLVGEPIMYPRINTLVGLLHSRQISTFLVTNAQFPDAIQQLVPVTQLYVSVDAGEKDALKKIDRPLFKDFWERFVASLTAVKDKKQRTVYRLTLVKAWNVDELDAYANLVDLGQPHFIEVKGVTYCGDSKASKLTMANVPWHEEVLSFVQQLADRLENYEIAAEHEHSNCVLLAQKKFKVNDEWNTWIDYEKFHELVQT------GKDFDATEYMAPTPSWAAYGSNEKGFNPSDTRFRKLRK 1975
            K++ V  V+TY +G PPE A+WF  WL +A +DFR  K +L+ +++AV GLG+S Y +++N V K ID+    LS  R++     D NVV SK+G ++ D++ W  +F   L    S  K      C   K      +++++   + +  E  E   +    TSD E E++ + G+ L+DMEDLG  M                      S+ K+   +  S   + +  +++SMLRGRGGCYKH FYGI SHRCME TPSLACANKCVFCWRHH+NPVGTEW+W MD PEMI++EA+  H  M+KQFKGVPGV+ ER+ EGL  KHCALSLVGEPIMYP IN  + LLH++ IS+FLVTNAQFP+ I+ L PVTQLYVSVDA  KD+LKKIDRPLFKDFW+RF+ SL A+ +K+QRTVYRLTLVKAWNV+EL AYA+LV +G+P FIEVKGVTYCG+S AS LTMANVPWH+EV+ FV++LAD L +YE+A EHEHSNC+L+A +KFK+N +W TWIDYE+F EL++        + F A +Y+A TP WA +GS E+GF+P D RF++  K
Sbjct:    8 KNVCVFLVATYTDGQPPESAEWFCKWLEEASNDFRFGKTYLKGMRYAVFGLGNSVYSTHYNTVGKNIDKWLWMLSASRVMTRAEGDCNVVKSKHGSIESDFEAWKARFLSRLKALISGEKKPCSGKCKKGKCKSKMKSSTDAVEEEAKHSEHEETEEETFETTSDSEPEEHGEPGSGLIDMEDLGKAM----------------------SIMKKAKNMNLSFIHIYVFLFSQSMLRGRGGCYKHTFYGIESHRCMETTPSLACANKCVFCWRHHTNPVGTEWRWKMDQPEMILEEAILNHQNMIKQFKGVPGVKPERYEEGLVVKHCALSLVGEPIMYPEINKFLRLLHNQHISSFLVTNAQFPEEIRSLEPVTQLYVSVDASTKDSLKKIDRPLFKDFWQRFLDSLKALAEKQQRTVYRLTLVKAWNVEELKAYADLVAVGRPDFIEVKGVTYCGESSASNLTMANVPWHDEVVRFVEELADLLPDYEVACEHEHSNCMLIAHEKFKINGDWWTWIDYERFQELIRAFDESKGSQTFTAMDYVAKTPEWALFGSRERGFDPLDKRFQRKNK 558          
BLAST of S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase vs. Ensembl Mouse
Match: Tyw1 (tRNA-yW synthesizing protein 1 homolog (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:2141161])

HSP 1 Score: 671.389 bits (1731), Expect = 0.000e+0
Identity = 341/650 (52.46%), Postives = 433/650 (66.62%), Query Frame = 2
Query:  137 IKILYGSLTGKSKILAEKFSKECIHNNYDFKMMNMNTYDPEENLNKE---KSLLVIFVSTYENGTPPEDAKWFYNWLIDAKDDFRVDKNFLENLQFAVVGLGSSYYESNFNIVSKAIDEAFGSLSGKRLLEIGICDENVVNSKNGGLDYDYQEWSKKFWKTL---------TCTSETKNSNGDVXXXXXXXXXXXXXXXXXXXXXXXIEITEENSDDEVLTSDEEEEKNMDSGNELVDMEDLGMMM-------------------RKRKDIVENKTPREMLTPMLRTSLEKQGYKLIGSHSGVKMCRWTKSMLRGRGGCYKHAFYGIASHRCMEATPSLACANKCVFCWRHHSNPVGTEWKWIMDPPEMIVDEAVAKHIQMVKQFKGVPGVQEERFLEGLKPKHCALSLVGEPIMYPRINTLVGLLHSRQISTFLVTNAQFPDAIQQLVPVTQLYVSVDAGEKDALKKIDRPLFKDFWERFVASLTAVKDKKQRTVYRLTLVKAWNVDELDAYANLVDLGQPHFIEVKGVTYCGDSKASKLTMANVPWHEEVLSFVQQLADRLENYEIAAEHEHSNCVLLAQKKFKVNDEWNTWIDYEKFHELV----QTG--KDFDATEYMAPTPSWAAYGSNEKGFNPSDTRFRKLRK 1975
            +KI YGS TG +K  A   +K     +    ++N+  YDP+++L  E   K++    V+TY +G P E A+WF  WL ++ +DFR  K +L+ L++AV GLG S Y S+FN VS  +D+    L  +R+L  G  D N V SK+G ++ D+  W  KF   L          C    K    +   +                  E+ E  E +S+DE+ T D +      S   +VD+EDLG +M                   ++  +  E+   R M+TP LR +L KQGY+LIGSHSGVK+CRWTKSMLRGRGGCYKH FYGI SHRCMEATPSLACANKCVFCWRHH+NPVGTEW+W MD PE+I+ EA+  H  M+KQFKGVPG++ ERF EG++ KHCALSLVGEPIMYP IN L+ LLH   IS+FLVTNAQFP+ I++L PVTQLYVSVDA  +D LKKIDRPLFKDFW+RF+ SL A+  K+QRTVYRLTLVK WNVDEL AYA LV LG P FIEVKGVTYCG+S AS LTMANVPWHEEV+ FV++L D L +YE+A EHEHSNC+L+  KKFK++ EW TWI+Y +F ELV    ++G  K F + +YMA TP WA +G+ E+GF+P DTR+++  K
Sbjct:   71 VKIFYGSQTGTAKGFAVVLAKAVTSLDLPVAIINLKEYDPDDSLIGEITSKTVCAFLVATYTDGCPTESAEWFCKWLEESANDFRFGKTYLKGLRYAVFGLGDSAYRSHFNKVSTNVDKWLWMLGAQRVLTRGEGDCNAVQSKHGSIEADFTAWKTKFISRLQALQRGEKKACGGNCKRGKCESAQHGPGEARPHPQGELHPGDAEEEEPCESSSEDELGTQDYQ------SLTSVVDVEDLGNIMNPVKREKREKSHQDGKAAMQRNPEKTEDGEGRAMITPALREALTKQGYQLIGSHSGVKLCRWTKSMLRGRGGCYKHTFYGIESHRCMEATPSLACANKCVFCWRHHTNPVGTEWRWKMDQPELILKEAIENHQNMIKQFKGVPGLKAERFEEGMEVKHCALSLVGEPIMYPEINRLLKLLHQHGISSFLVTNAQFPEEIRKLTPVTQLYVSVDASTRDGLKKIDRPLFKDFWQRFLDSLKALSAKQQRTVYRLTLVKCWNVDELQAYAELVSLGNPDFIEVKGVTYCGESAASSLTMANVPWHEEVVRFVRELVDLLPDYEVACEHEHSNCLLIGHKKFKIDGEWWTWINYSRFQELVLQYEESGGSKTFSSRDYMARTPQWALFGARERGFDPKDTRYQRKNK 714          
BLAST of S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase vs. Ensembl Mouse
Match: Tyw1 (tRNA-yW synthesizing protein 1 homolog (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:2141161])

HSP 1 Score: 160.999 bits (406), Expect = 1.590e-42
Identity = 106/313 (33.87%), Postives = 155/313 (49.52%), Query Frame = 2
Query:  137 IKILYGSLTGKSKILAEKFSKECIHNNYDFKMMNMNTYDPEENLNKE---KSLLVIFVSTYENGTPPEDAKWFYNWLIDAKDDFRVDKNFLENLQFAVVGLGSSYYESNFNIVSKAIDEAFGSLSGKRLLEIGICDENVVNSKNGGLDYDYQEWSKKFWKTL---------TCTSETKNSNGDVXXXXXXXXXXXXXXXXXXXXXXXIEITEENSDDEVLTSDEEEEKNMDSGNELVDMEDLG-------------------MMMRKRKDIVENKTPREMLTPMLRTSLEKQGYKLIGSHSGVKMCRWTKSML 982
            +KI YGS TG +K  A   +K     +    ++N+  YDP+++L  E   K++    V+TY +G P E A+WF  WL ++ +DFR  K +L+ L++AV GLG S Y S+FN VS  +D+    L  +R+L  G  D N V SK+G ++ D+  W  KF   L          C    K    +   +                  E+ E  E +S+DE+ T D +      S   +VD+EDLG                     M++  +  E+   R M+TP LR +L KQGY+LIGSHSGVK+CRWTK  +
Sbjct:   71 VKIFYGSQTGTAKGFAVVLAKAVTSLDLPVAIINLKEYDPDDSLIGEITSKTVCAFLVATYTDGCPTESAEWFCKWLEESANDFRFGKTYLKGLRYAVFGLGDSAYRSHFNKVSTNVDKWLWMLGAQRVLTRGEGDCNAVQSKHGSIEADFTAWKTKFISRLQALQRGEKKACGGNCKRGKCESAQHGPGEARPHPQGELHPGDAEEEEPCESSSEDELGTQDYQ------SLTSVVDVEDLGNIMNPVKREKREKSHQDGKAAMQRNPEKTEDGEGRAMITPALREALTKQGYQLIGSHSGVKLCRWTKVFI 377          
BLAST of S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase vs. Ensembl Mouse
Match: Tyw1 (tRNA-yW synthesizing protein 1 homolog (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:2141161])

HSP 1 Score: 122.094 bits (305), Expect = 7.509e-31
Identity = 61/158 (38.61%), Postives = 92/158 (58.23%), Query Frame = 2
Query:  137 IKILYGSLTGKSKILAEKFSKECIHNNYDFKMMNMNTYDPEENLNKE---KSLLVIFVSTYENGTPPEDAKWFYNWLIDAKDDFRVDKNFLENLQFAVVGLGSSYYESNFNIVSKAIDEAFGSLSGKRLLEIGICDENVVNSKNGGLDYDYQEWSKKF 601
            +KI YGS TG +K  A   +K     +    ++N+  YDP+++L  E   K++    V+TY +G P E A+WF  WL ++ +DFR  K +L+ L++AV GLG S Y S+FN VS  +D+    L  +R+L  G  D N V SK+G ++ D+  W  KF
Sbjct:   48 VKIFYGSQTGTAKGFAVVLAKAVTSLDLPVAIINLKEYDPDDSLIGEITSKTVCAFLVATYTDGCPTESAEWFCKWLEESANDFRFGKTYLKGLRYAVFGLGDSAYRSHFNKVSTNVDKWLWMLGAQRVLTRGEGDCNAVQSKHGSIEADFTAWKTKF 205          
BLAST of S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase vs. Ensembl Mouse
Match: Tyw1 (tRNA-yW synthesizing protein 1 homolog (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:2141161])

HSP 1 Score: 123.25 bits (308), Expect = 7.432e-30
Identity = 61/158 (38.61%), Postives = 92/158 (58.23%), Query Frame = 2
Query:  137 IKILYGSLTGKSKILAEKFSKECIHNNYDFKMMNMNTYDPEENLNKE---KSLLVIFVSTYENGTPPEDAKWFYNWLIDAKDDFRVDKNFLENLQFAVVGLGSSYYESNFNIVSKAIDEAFGSLSGKRLLEIGICDENVVNSKNGGLDYDYQEWSKKF 601
            +KI YGS TG +K  A   +K     +    ++N+  YDP+++L  E   K++    V+TY +G P E A+WF  WL ++ +DFR  K +L+ L++AV GLG S Y S+FN VS  +D+    L  +R+L  G  D N V SK+G ++ D+  W  KF
Sbjct:   71 VKIFYGSQTGTAKGFAVVLAKAVTSLDLPVAIINLKEYDPDDSLIGEITSKTVCAFLVATYTDGCPTESAEWFCKWLEESANDFRFGKTYLKGLRYAVFGLGDSAYRSHFNKVSTNVDKWLWMLGAQRVLTRGEGDCNAVQSKHGSIEADFTAWKTKF 228          
BLAST of S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase vs. Ensembl Mouse
Match: Por (P450 (cytochrome) oxidoreductase [Source:MGI Symbol;Acc:MGI:97744])

HSP 1 Score: 82.4185 bits (202), Expect = 6.659e-17
Identity = 54/167 (32.34%), Postives = 91/167 (54.49%), Query Frame = 2
Query:  137 IKILYGSLTGKSKILAEKFSKECIHNNYDFKMMNMNTYDPEE----NLNK----EKSLLVIFVSTYENGTPPEDAKWFYNWLIDAKDDFRVDKNFLENLQFAVVGLGSSYYESNFNIVSKAIDEAFGSLSGKRLLEIGICDENVVNSKNGGLDYDYQEWSKKFWKTL 613
            I + YGS TG ++  A + SK+     + + M  M+  DPEE    +L+     +KSL+V  ++TY  G P ++A+ FY+WL +   D       L  ++FAV GLG+  YE +FN + K +D+    L  +R+ E+G+ D+      +G L+ D+  W ++FW  +
Sbjct:   80 IIVFYGSQTGTAEEFANRLSKDA----HRYGMRGMSA-DPEEYDLADLSSLPEIDKSLVVFCMATYGEGDPTDNAQDFYDWLQETDVD-------LTGVKFAVFGLGNKTYE-HFNAMGKYVDQRLEQLGAQRIFELGLGDD------DGNLEEDFITWREQFWPAV 227          
BLAST of S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase vs. UniProt/SwissProt
Match: sp|Q2KHP8|TYW1_XENLA (S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase TYW1 OS=Xenopus laevis OX=8355 GN=tyw1 PE=2 SV=1)

HSP 1 Score: 713.761 bits (1841), Expect = 0.000e+0
Identity = 356/646 (55.11%), Postives = 451/646 (69.81%), Query Frame = 2
Query:  137 IKILYGSLTGKSKILAEKFSKECIHNNYDFKMMNMNTYDPEENLNKE---KSLLVIFVSTYENGTPPEDAKWFYNWLIDAKDDFRVDKNFLENLQFAVVGLGSSYYESNFNIVSKAIDEAFGSLSGKRLLEIGICDENVVNSKNGGLDYDYQEWSKKFW---KTLTCTSETKNSNGDVXXXXXXXXXXXXXXXXXXXXXXXIEITEENSDDEVL--TSDEEEEKNMDSGNELVDMEDLGMMMRKRK-------------------DIVENKTPREMLTPMLRTSLEKQGYKLIGSHSGVKMCRWTKSMLRGRGGCYKHAFYGIASHRCMEATPSLACANKCVFCWRHHSNPVGTEWKWIMDPPEMIVDEAVAKHIQMVKQFKGVPGVQEERFLEGLKPKHCALSLVGEPIMYPRINTLVGLLHSRQISTFLVTNAQFPDAIQQLVPVTQLYVSVDAGEKDALKKIDRPLFKDFWERFVASLTAVKDKKQRTVYRLTLVKAWNVDELDAYANLVDLGQPHFIEVKGVTYCGDSKASKLTMANVPWHEEVLSFVQQLADRLENYEIAAEHEHSNCVLLAQKKFKVNDEWNTWIDYEKFHELVQT------GKDFDATEYMAPTPSWAAYGSNEKGFNPSDTRFRKLRK 1975
            +KI YGS TG SK  A   ++E        +++NM  YDP++NL +E   K++ V  V+TY +G PPE A+WF  WL +A +DFR  K +L+ +++AV GLG+S Y +++N V K ID+    LS  R++     D NVV SK+G ++ D++ W +KF    K L    +   S        KS    +  S     + E+     E+++D+    +SD E E++ + G+ L+D+EDLG  M   K                   +  E + PREM+TP L+ +L KQGY+LIGSHSGVK+CRWTKSMLRGRGGCYKH FYGI SHRCME TPSLACANKCVFCWRHH+NPVGTEW+W MD PEMI++EA+  H  M+KQFKGVPGV+ ERF EGL  KHCALSLVGEPIMYP INT + LLH++ IS+FLVTNAQFP+ I+ L PVTQLYVSVDA  KD+LKKIDRPLFKDFW+RF+ SL A+ +K+QRTVYRLTLVKAWNVDEL AYA+LV LG P FIEVKGVTYCG+S AS LTMANVPWHEEV+ FV++L D L +YE+A EHEHSNC+L+A KKFK+N EW TWIDYE+F EL+Q        + F A +Y+A TP WA +GS E+GF+P D RF++  K
Sbjct:   83 VKIFYGSQTGTSKGFAHLLAEEVTLLGLPVELINMKEYDPDDNLVEETTSKNICVFLVATYTDGKPPESAEWFCKWLEEASNDFRFGKTYLKGMRYAVFGLGNSVYSTHYNTVGKNIDKWLWMLSANRVMTRAEGDCNVVKSKHGSIESDFEAWKRKFLNRLKALLSGEKKPCSGKCKKGKCKSKKKSSIESVEEEEEEEEKHSEHEDTEDDTFETSSDSEPEEHGEPGSGLIDVEDLGKAMSNMKKSKREHDSNTELGKSLQGDEAKEKEEPREMITPALQEALTKQGYRLIGSHSGVKLCRWTKSMLRGRGGCYKHTFYGIESHRCMETTPSLACANKCVFCWRHHTNPVGTEWRWKMDQPEMILEEAILNHQNMIKQFKGVPGVKPERFEEGLAVKHCALSLVGEPIMYPEINTFLRLLHNQHISSFLVTNAQFPEEIRSLEPVTQLYVSVDASTKDSLKKIDRPLFKDFWQRFIDSLKALAEKQQRTVYRLTLVKAWNVDELKAYADLVALGLPDFIEVKGVTYCGESSASNLTMANVPWHEEVIRFVEELVDLLPDYEVACEHEHSNCMLIAHKKFKINGEWCTWIDYERFQELIQAFGESKGSRTFTALDYVAKTPEWALFGSRERGFDPLDKRFQRKNK 728          
BLAST of S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase vs. UniProt/SwissProt
Match: sp|Q08C92|TYW1_DANRE (S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase TYW1 OS=Danio rerio OX=7955 GN=tyw1 PE=2 SV=1)

HSP 1 Score: 699.508 bits (1804), Expect = 0.000e+0
Identity = 354/646 (54.80%), Postives = 445/646 (68.89%), Query Frame = 2
Query:  137 IKILYGSLTGKSKILAEKFSKECIHNNYDFKMMNMNTYDPEENLNKE---KSLLVIFVSTYENGTPPEDAKWFYNWLIDAKDDFRVDKNFLENLQFAVVGLGSSYYESNFNIVSKAIDEAFGSLSGKRLLEIGICDENVVNSKNGGLDYDYQEWSKKFWKTLTCTS--ETKNSNGDVXXXXXXXXXXXXXXXXXXXXXXXIEITEENSDDEVLTSDEEEEKNMDSGNELVDMEDLGMM---MRKRKDIVE-------------------NKTPREMLTPMLRTSLEKQGYKLIGSHSGVKMCRWTKSMLRGRGGCYKHAFYGIASHRCMEATPSLACANKCVFCWRHHSNPVGTEWKWIMDPPEMIVDEAVAKHIQMVKQFKGVPGVQEERFLEGLKPKHCALSLVGEPIMYPRINTLVGLLHSRQISTFLVTNAQFPDAIQQLVPVTQLYVSVDAGEKDALKKIDRPLFKDFWERFVASLTAVKDKKQRTVYRLTLVKAWNVDELDAYANLVDLGQPHFIEVKGVTYCGDSKASKLTMANVPWHEEVLSFVQQLADRLENYEIAAEHEHSNCVLLAQKKFKVNDEWNTWIDYEKFHELVQT------GKDFDATEYMAPTPSWAAYGSNEKGFNPSDTRFRKLRK 1975
            +K+ YGS TG +K  A++ +++ I      ++++M  +DPE+ L +E   K + V  V+TY +G P E A+WF  WL +A  DFR  K +L+ +++AV GLG+S Y  +FN VSK+ID+    LS  R++  G  D NVV S++G +  D+Q W  KF   L   +  E K  +G+       +  K            +   +EE   +     +   E     G+ ++DMEDLG +   M+K K  +E                    +  REM+TP LR SL KQGYKLIGSHSGVK+ RWTKSMLRGRGGCYKH FYGI SHRCME TPSLACANKCVFCWRHH+NPVGTEW+W MDP E I+ EA+  H  M++QF+GVPGV+ ERF EGL  KHCALSLVGEPIMYP IN+ + LLH + IS+FLVTNAQFP+ I+ LVPVTQLYVSVDA  KD+LKKIDRPLFKDFW+RF+ SL A+ +K+QRTVYRLTLVKAWNVDEL AYA+L+ LGQP FIEVKGVTYCG+S AS LTMANVPWHEEV+ FVQQLA+ L +YEIA EHEHSNC+LLA  KFKV+ EW TWIDYE+F EL+Q        K+F A +YMA TPSWA +G+ E+GF+P+DTRF++  K
Sbjct:   79 VKVFYGSQTGTAKGFAKELAEDVIAQGIQCEVIDMKDFDPEDRLAEECTSKIICVFLVATYTDGQPTESAEWFCKWLEEASTDFRYGKTYLKGMRYAVFGLGNSVYVGHFNTVSKSIDKWLWMLSAARIMTRGEGDCNVVKSRHGSVQADFQVWKGKFLNRLQALAKGEKKACSGNCKKASCKNKKKHKEEAEDNHSLAEKNNSEEELMESSSDEESSSEDEKSHGS-VIDMEDLGNVMNHMKKAKQRMEEDEEDSQRVKQNGERKSECEEERREMITPALRDSLTKQGYKLIGSHSGVKLRRWTKSMLRGRGGCYKHTFYGIESHRCMETTPSLACANKCVFCWRHHTNPVGTEWRWKMDPAEKIIQEAMENHRNMIRQFRGVPGVRPERFEEGLTVKHCALSLVGEPIMYPEINSFLKLLHQQNISSFLVTNAQFPEEIRSLVPVTQLYVSVDASTKDSLKKIDRPLFKDFWQRFLDSLRALGEKQQRTVYRLTLVKAWNVDELKAYADLIALGQPDFIEVKGVTYCGESSASSLTMANVPWHEEVIYFVQQLANLLPDYEIACEHEHSNCLLLANHKFKVDGEWWTWIDYERFQELIQQYEESGGTKNFSAMDYMAKTPSWAVFGAGERGFDPTDTRFQRKNK 723          
BLAST of S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase vs. UniProt/SwissProt
Match: sp|Q5REF9|TYW1_PONAB (S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase TYW1 OS=Pongo abelii OX=9601 GN=TYW1 PE=2 SV=1)

HSP 1 Score: 675.241 bits (1741), Expect = 0.000e+0
Identity = 347/647 (53.63%), Postives = 434/647 (67.08%), Query Frame = 2
Query:  137 IKILYGSLTGKSKILAEKFSKECIHNNYDFKMMNMNTYDPEENLNKE---KSLLVIFVSTYENGTPPEDAKWFYNWLIDAKDDFRVDKNFLENLQFAVVGLGSSYYESNFNIVSKAIDEAFGSLSGKRLLEIGICDENVVNSKNGGLDYDYQEWSKKFWKTLTCT--SETKNSNGDVXXXXXXXXXXXXXXXXXXXXXXXIEITEENSDDEVLTSDEEEE----KNMDSGNELVDMEDLGMMMR-------------------KRKDIVENKTPREMLTPMLRTSLEKQGYKLIGSHSGVKMCRWTKSMLRGRGGCYKHAFYGIASHRCMEATPSLACANKCVFCWRHHSNPVGTEWKWIMDPPEMIVDEAVAKHIQMVKQFKGVPGVQEERFLEGLKPKHCALSLVGEPIMYPRINTLVGLLHSRQISTFLVTNAQFPDAIQQLVPVTQLYVSVDAGEKDALKKIDRPLFKDFWERFVASLTAVKDKKQRTVYRLTLVKAWNVDELDAYANLVDLGQPHFIEVKGVTYCGDSKASKLTMANVPWHEEVLSFVQQLADRLENYEIAAEHEHSNCVLLAQKKFKVNDEWNTWIDYEKFHELVQ------TGKDFDATEYMAPTPSWAAYGSNEKGFNPSDTRFRKLRK 1975
            +KI YGS TG +K  A   ++     +    ++N+  YDP+++L +E   K++ V  V+TY +G P E A+WF  WL +A  DFR  K +L+ +++AV GLG+S Y S+FN V K +D+    L   R++  G  D +VV SK+G ++ D++ W  KF   L      E K S G  C   K    +  +       +E+ E+   ++++E       EE    K+  S N +VD+EDLG +M                    +     E+   R M+TP LR +L KQGY+LIGSHSGVK+CRWTKSMLRGRGGCYKH FYGI SHRCME TPSLACANKCVFCWRHH+NPVGTEW+W MD PEMI+ EA+  H  M+KQFKGVPGV+ ERF EG+  KHCALSLVGEPIMYP IN  + LLH  +IS+FLVTNAQFP  I+ L PVTQLYVSVDA  KD+LKKIDRPLFKDFW RF+ SL A+  K+QRTVYRLTLVKAWNVDEL AYA LV LG P FIEVKGVTYCG+S AS LTMA+VPWHEEV+ FV +L D + +YEIA EHEHSNC+L+A KKFK+  EW TWIDY +F EL+Q        K F A +YMA TP WA +G+NE+GF+P DTR ++  K
Sbjct:   79 VKIFYGSQTGTAKGFATVLAEAVTSLDLPVAIINLKEYDPDDHLIEEVTSKNVCVFLVATYTDGLPTESAEWFCKWLEEAAIDFRFGKTYLKGMRYAVFGLGNSAYASHFNKVGKNVDKWLWMLGAHRVMSRGEGDCDVVKSKHGSIEADFRAWKTKFISQLQALQKGERKKSCGGHCKKGKCESHQRGSEEREEGSHEQDELHHRDTEEEEPFESSSEEEFGGKDHQSLNSIVDVEDLGKIMDHVKKEKREKEQREEKSGLFRNMGRNEDGEIRAMITPALREALTKQGYQLIGSHSGVKLCRWTKSMLRGRGGCYKHTFYGIESHRCMETTPSLACANKCVFCWRHHTNPVGTEWRWKMDQPEMILKEAIENHQNMIKQFKGVPGVKAERFEEGMTVKHCALSLVGEPIMYPEINRFLKLLHQCKISSFLVTNAQFPAEIRNLEPVTQLYVSVDASTKDSLKKIDRPLFKDFWRRFLDSLKALAVKQQRTVYRLTLVKAWNVDELQAYAQLVSLGNPDFIEVKGVTYCGESSASSLTMAHVPWHEEVVQFVCELVDLIPDYEIACEHEHSNCLLIAHKKFKIGGEWWTWIDYNRFQELIQEYEDSSGSKTFSAKDYMARTPHWALFGANERGFDPKDTRHQRKNK 725          
BLAST of S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase vs. UniProt/SwissProt
Match: sp|Q9NV66|TYW1_HUMAN (S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase TYW1 OS=Homo sapiens OX=9606 GN=TYW1 PE=2 SV=2)

HSP 1 Score: 672.159 bits (1733), Expect = 0.000e+0
Identity = 346/647 (53.48%), Postives = 434/647 (67.08%), Query Frame = 2
Query:  137 IKILYGSLTGKSKILAEKFSKECIHNNYDFKMMNMNTYDPEENLNKE---KSLLVIFVSTYENGTPPEDAKWFYNWLIDAKDDFRVDKNFLENLQFAVVGLGSSYYESNFNIVSKAIDEAFGSLSGKRLLEIGICDENVVNSKNGGLDYDYQEWSKKFWKTLTCT--SETKNSNGDVXXXXXXXXXXXXXXXXXXXXXXXIEI----TEENSDDEVLTSDEEEEKNMDSGNELVDMEDLGMMMR-------------------KRKDIVENKTPREMLTPMLRTSLEKQGYKLIGSHSGVKMCRWTKSMLRGRGGCYKHAFYGIASHRCMEATPSLACANKCVFCWRHHSNPVGTEWKWIMDPPEMIVDEAVAKHIQMVKQFKGVPGVQEERFLEGLKPKHCALSLVGEPIMYPRINTLVGLLHSRQISTFLVTNAQFPDAIQQLVPVTQLYVSVDAGEKDALKKIDRPLFKDFWERFVASLTAVKDKKQRTVYRLTLVKAWNVDELDAYANLVDLGQPHFIEVKGVTYCGDSKASKLTMANVPWHEEVLSFVQQLADRLENYEIAAEHEHSNCVLLAQKKFKVNDEWNTWIDYEKFHELVQ------TGKDFDATEYMAPTPSWAAYGSNEKGFNPSDTRFRKLRK 1975
            +KI YGS TG +K  A   ++     +    ++N+  YDP+++L +E   K++ V  V+TY +G P E A+WF  WL +A  DFR  K +L+ +++AV GLG+S Y S+FN V K +D+    L   R++  G  D +VV SK+G ++ D++ W  KF   L      E K S G  C   K    +  +       +E+ E+    TEE    E  + +E   ++  S N +VD+EDLG +M                    +     E+   R M+TP LR +L KQGY+LIGSHSGVK+CRWTKSMLRGRGGCYKH FYGI SHRCME TPSLACANKCVFCWRHH+NPVGTEW+W MD PEMI+ EA+  H  M+KQFKGVPGV+ ERF EG+  KHCALSLVGEPIMYP IN  + LLH  +IS+FLVTNAQFP  I+ L PVTQLYVSVDA  KD+LKKIDRPLFKDFW+RF+ SL A+  K+QRTVYRLTLVKAWNVDEL AYA LV LG P FIEVKGVTYCG+S AS LTMA+VPWHEEV+ FV +L D +  YEIA EHEHSNC+L+A +KFK+  EW TWIDY +F EL+Q        K F A +YMA TP WA +G++E+GF+P DTR ++  K
Sbjct:   79 VKIFYGSQTGTAKGFATVLAEAVTSLDLPVAIINLKEYDPDDHLIEEVTSKNVCVFLVATYTDGLPTESAEWFCKWLEEASIDFRFGKTYLKGMRYAVFGLGNSAYASHFNKVGKNVDKWLWMLGAHRVMSRGEGDCDVVKSKHGSIEADFRAWKTKFISQLQALQKGERKKSCGGHCKKGKCESHQHGSEEREEGSHEQDELHHRDTEEEEPFESSSEEEFGGEDHQSLNSIVDVEDLGKIMDHVKKEKREKEQQEEKSGLFRNMGRNEDGERRAMITPALREALTKQGYQLIGSHSGVKLCRWTKSMLRGRGGCYKHTFYGIESHRCMETTPSLACANKCVFCWRHHTNPVGTEWRWKMDQPEMILKEAIENHQNMIKQFKGVPGVKAERFEEGMTVKHCALSLVGEPIMYPEINRFLKLLHQCKISSFLVTNAQFPAEIRNLEPVTQLYVSVDASTKDSLKKIDRPLFKDFWQRFLDSLKALAVKQQRTVYRLTLVKAWNVDELQAYAQLVSLGNPDFIEVKGVTYCGESSASSLTMAHVPWHEEVVQFVHELVDLIPEYEIACEHEHSNCLLIAHRKFKIGGEWWTWIDYNRFQELIQEYEDSGGSKTFSAKDYMARTPHWALFGASERGFDPKDTRHQRKNK 725          
BLAST of S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase vs. UniProt/SwissProt
Match: sp|Q8BJM7|TYW1_MOUSE (S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase TYW1 OS=Mus musculus OX=10090 GN=Tyw1 PE=1 SV=1)

HSP 1 Score: 671.389 bits (1731), Expect = 0.000e+0
Identity = 341/650 (52.46%), Postives = 433/650 (66.62%), Query Frame = 2
Query:  137 IKILYGSLTGKSKILAEKFSKECIHNNYDFKMMNMNTYDPEENLNKE---KSLLVIFVSTYENGTPPEDAKWFYNWLIDAKDDFRVDKNFLENLQFAVVGLGSSYYESNFNIVSKAIDEAFGSLSGKRLLEIGICDENVVNSKNGGLDYDYQEWSKKFWKTL---------TCTSETKNSNGDVXXXXXXXXXXXXXXXXXXXXXXXIEITEENSDDEVLTSDEEEEKNMDSGNELVDMEDLGMMM-------------------RKRKDIVENKTPREMLTPMLRTSLEKQGYKLIGSHSGVKMCRWTKSMLRGRGGCYKHAFYGIASHRCMEATPSLACANKCVFCWRHHSNPVGTEWKWIMDPPEMIVDEAVAKHIQMVKQFKGVPGVQEERFLEGLKPKHCALSLVGEPIMYPRINTLVGLLHSRQISTFLVTNAQFPDAIQQLVPVTQLYVSVDAGEKDALKKIDRPLFKDFWERFVASLTAVKDKKQRTVYRLTLVKAWNVDELDAYANLVDLGQPHFIEVKGVTYCGDSKASKLTMANVPWHEEVLSFVQQLADRLENYEIAAEHEHSNCVLLAQKKFKVNDEWNTWIDYEKFHELV----QTG--KDFDATEYMAPTPSWAAYGSNEKGFNPSDTRFRKLRK 1975
            +KI YGS TG +K  A   +K     +    ++N+  YDP+++L  E   K++    V+TY +G P E A+WF  WL ++ +DFR  K +L+ L++AV GLG S Y S+FN VS  +D+    L  +R+L  G  D N V SK+G ++ D+  W  KF   L          C    K    +   +                  E+ E  E +S+DE+ T D +      S   +VD+EDLG +M                   ++  +  E+   R M+TP LR +L KQGY+LIGSHSGVK+CRWTKSMLRGRGGCYKH FYGI SHRCMEATPSLACANKCVFCWRHH+NPVGTEW+W MD PE+I+ EA+  H  M+KQFKGVPG++ ERF EG++ KHCALSLVGEPIMYP IN L+ LLH   IS+FLVTNAQFP+ I++L PVTQLYVSVDA  +D LKKIDRPLFKDFW+RF+ SL A+  K+QRTVYRLTLVK WNVDEL AYA LV LG P FIEVKGVTYCG+S AS LTMANVPWHEEV+ FV++L D L +YE+A EHEHSNC+L+  KKFK++ EW TWI+Y +F ELV    ++G  K F + +YMA TP WA +G+ E+GF+P DTR+++  K
Sbjct:   71 VKIFYGSQTGTAKGFAVVLAKAVTSLDLPVAIINLKEYDPDDSLIGEITSKTVCAFLVATYTDGCPTESAEWFCKWLEESANDFRFGKTYLKGLRYAVFGLGDSAYRSHFNKVSTNVDKWLWMLGAQRVLTRGEGDCNAVQSKHGSIEADFTAWKTKFISRLQALQRGEKKACGGNCKRGKCESAQHGPGEARPHPQGELHPGDAEEEEPCESSSEDELGTQDYQ------SLTSVVDVEDLGNIMNPVKREKREKSHQDGKAAMQRNPEKTEDGEGRAMITPALREALTKQGYQLIGSHSGVKLCRWTKSMLRGRGGCYKHTFYGIESHRCMEATPSLACANKCVFCWRHHTNPVGTEWRWKMDQPELILKEAIENHQNMIKQFKGVPGLKAERFEEGMEVKHCALSLVGEPIMYPEINRLLKLLHQHGISSFLVTNAQFPEEIRKLTPVTQLYVSVDASTRDGLKKIDRPLFKDFWQRFLDSLKALSAKQQRTVYRLTLVKCWNVDELQAYAELVSLGNPDFIEVKGVTYCGESAASSLTMANVPWHEEVVRFVRELVDLLPDYEVACEHEHSNCLLIGHKKFKIDGEWWTWINYSRFQELVLQYEESGGSKTFSSRDYMARTPQWALFGARERGFDPKDTRYQRKNK 714          
BLAST of S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase vs. TrEMBL
Match: A0A1S3KHL1 (S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase OS=Lingula unguis OX=7574 GN=LOC106181776 PE=4 SV=1)

HSP 1 Score: 731.095 bits (1886), Expect = 0.000e+0
Identity = 351/657 (53.42%), Postives = 465/657 (70.78%), Query Frame = 2
Query:  110 ETNINEKNT------IKILYGSLTGKSKILAEKFSKECIHNNYDFKMMNMNTYDPEENLNKE---KSLLVIFVSTYENGTPPEDAKWFYNWLIDAKDDFRVDKNFLENLQFAVVGLGSSYYESNFNIVSKAIDEAFGSLSGKRLLEIGICDENVVNSKNGGLDYDYQEWSKKFWKTLTCTSETK--------NSNGDVXXXXXXXXXXXXXXXXXXXXXXXIEITEENSDDEVLTSDEEEEKNMDSGNELVDMEDLGMMM---------RKRKDIVENKTPREMLTPMLRTSLEKQGYKLIGSHSGVKMCRWTKSMLRGRGGCYKHAFYGIASHRCMEATPSLACANKCVFCWRHHSNPVGTEWKWIMDPPEMIVDEAVAKHIQMVKQFKGVPGVQEERFLEGLKPKHCALSLVGEPIMYPRINTLVGLLHSRQISTFLVTNAQFPDAIQQLVPVTQLYVSVDAGEKDALKKIDRPLFKDFWERFVASLTAVKDKKQRTVYRLTLVKAWNVDELDAYANLVDLGQPHFIEVKGVTYCGDSKASKLTMANVPWHEEVLSFVQQLADRLENYEIAAEHEHSNCVLLAQKKFKVNDEWNTWIDYEKFHELVQT------GKDFDATEYMAPTPSWAAYGSNEKGFNPSDTRF-RKLRKHI 1981
            E N+N+  +      +KI +G+ TG +K  A+   KE   ++   +++++ TYDPE+N+  E   K++ V  +STY  G+PP+DA WFY WL +A  DFR+ K  L+++++ VVGLG+S Y+  +N V++ ID  F  LS  R+L IG+ DENV +SKNGG++ D++ W  +FW  +  + + K         ++GD  +  ++S  +           +  ++ + N                     +VD+ED+G M+         RK +D  ++K PREM+TP+LRTSL+KQGY+LIGSHSGVK+CRWTKSMLRGRGGCYKH FYGI SHRCME TPSLACANKCVFCWRHH+NPVGTEW+W MD PE+I++ A+  H  M+KQFKGVPGV+ +RF EGL PKHCALSLVGEPIMYP IN    +LHS+ IS+FLVTNAQFPDAI+ L PVTQLYVSVDA  K++LKKIDRPLF+D+WERF+ SL A+ +K QRTVYRLTLVK +N ++++ YA+LV +G+P FIE+KGVTYCG+SKAS+LTM NVPWHEEV+ FVQ + DRL +Y IA+EHEHSNCVL+A KKF+VN +W TWIDY++FHELVQ        K F A +YMA TP WA +G++E+GF+P +TRF RK  K I
Sbjct:   58 ERNLNKAKSSKKETCLKIFFGTQTGTAKTFADIIKKEASEHSTKCEVIDLKTYDPEDNITDETDGKNICVFIISTYTEGSPPDDAAWFYKWLEEAASDFRIQKTMLQDMRYCVVGLGNSLYKERYNKVARNIDHWFHKLSANRVLGIGLLDENVASSKNGGIEADFEFWKNRFWSMVLGSPQNKKDVKPNCGTADGDTKEMYETSSEEDTEDEEEEGDGDGEKVQKANG--------------------VVDVEDIGKMVNNIKKAKAKRKVEDDNKSKEPREMITPLLRTSLQKQGYRLIGSHSGVKLCRWTKSMLRGRGGCYKHTFYGIESHRCMETTPSLACANKCVFCWRHHTNPVGTEWRWKMDDPELILEGALQNHCNMIKQFKGVPGVKSDRFTEGLTPKHCALSLVGEPIMYPEINKFAEMLHSKGISSFLVTNAQFPDAIRNLTPVTQLYVSVDASTKESLKKIDRPLFRDYWERFLDSLKALSEKGQRTVYRLTLVKNYNTEDIENYASLVSIGKPDFIEIKGVTYCGESKASRLTMDNVPWHEEVIKFVQDVVDRLPDYAIASEHEHSNCVLVAHKKFQVNGDWWTWIDYDRFHELVQMYKASEGQKTFSAADYMAQTPHWAVFGADERGFDPGETRFMRKKTKDI 694          
BLAST of S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase vs. TrEMBL
Match: A0A1S3H4E9 (S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase OS=Lingula unguis OX=7574 GN=LOC106151340 PE=4 SV=1)

HSP 1 Score: 729.554 bits (1882), Expect = 0.000e+0
Identity = 347/642 (54.05%), Postives = 459/642 (71.50%), Query Frame = 2
Query:  137 IKILYGSLTGKSKILAEKFSKECIHNNYDFKMMNMNTYDPEENLNKE---KSLLVIFVSTYENGTPPEDAKWFYNWLIDAKDDFRVDKNFLENLQFAVVGLGSSYYESNFNIVSKAIDEAFGSLSGKRLLEIGICDENVVNSKNGGLDYDYQEWSKKFWKTLTCTSETK--------NSNGDVXXXXXXXXXXXXXXXXXXXXXXXIEITEENSDDEVLTSDEEEEKNMDSGNELVDMEDLGMMM---------RKRKDIVENKTPREMLTPMLRTSLEKQGYKLIGSHSGVKMCRWTKSMLRGRGGCYKHAFYGIASHRCMEATPSLACANKCVFCWRHHSNPVGTEWKWIMDPPEMIVDEAVAKHIQMVKQFKGVPGVQEERFLEGLKPKHCALSLVGEPIMYPRINTLVGLLHSRQISTFLVTNAQFPDAIQQLVPVTQLYVSVDAGEKDALKKIDRPLFKDFWERFVASLTAVKDKKQRTVYRLTLVKAWNVDELDAYANLVDLGQPHFIEVKGVTYCGDSKASKLTMANVPWHEEVLSFVQQLADRLENYEIAAEHEHSNCVLLAQKKFKVNDEWNTWIDYEKFHELVQT------GKDFDATEYMAPTPSWAAYGSNEKGFNPSDTRF-RKLRKHI 1981
            +KI +G+ TG +K  A+   KE   ++   +++++ TYDPE+N+  E   K++ V  +STY  G+PP+DA WFY WL +A  DFR+ K  L+++++ VVGLG+S Y+  +N V++ ID  F  LS  R+L IG+ DENV +SKNGG++ D++ W  +FW  +  + + K         ++GD  +  ++S  +           +  ++ + N                     +VD+ED+G M+         RK +D  ++K PREM+TP+L+TSL+KQGY+LIGSHSGVK+CRWTKSMLRGRGGCYKH FYGI SHRCME TPSLACANKCVFCWRHH+NPVGTEW+W MD PE+I++ A+  H  M+KQFKGVPGV+ +RF EGL PKHCALSLVGEPIMYP IN    +LHS+ IS+FLVTNAQFPDAI+ L PVTQLYVSVDA  K++LKKIDRPLF+D+WERF+ SL A+ +K QRTVYRLTLVK +N ++++ YA+LV +G+P FIE+KGVTYCG+SKAS+LTM NVPWHEEV+ FVQ + DRL +Y IA+EHEHSNCVL+A KKF+VN +W TWIDY++FHELVQ        K F A +YMA TP WA +G++E+GF+P +TRF RK  K I
Sbjct:   73 VKIFFGTQTGTAKTFADIIKKEASEHSTKCEVIDLKTYDPEDNITDETDGKNICVFIISTYTEGSPPDDAAWFYKWLEEAASDFRIQKTMLQDMRYCVVGLGNSLYKERYNKVARNIDHWFHKLSANRVLGIGLLDENVASSKNGGIEADFEFWKNRFWSMVLGSPQNKKDVKPNCGTADGDTKEMYETSSEEDTEDEEEEGDGDGEKVQKANG--------------------VVDVEDIGKMVNNIKKAKAKRKVEDDNKSKEPREMITPLLKTSLQKQGYRLIGSHSGVKLCRWTKSMLRGRGGCYKHTFYGIESHRCMETTPSLACANKCVFCWRHHTNPVGTEWRWKMDDPELILEGALQNHCNMIKQFKGVPGVKSDRFTEGLTPKHCALSLVGEPIMYPEINKFAEMLHSKGISSFLVTNAQFPDAIRNLTPVTQLYVSVDASTKESLKKIDRPLFRDYWERFLDSLKALSEKGQRTVYRLTLVKNYNTEDIENYASLVSIGKPDFIEIKGVTYCGESKASRLTMDNVPWHEEVIKFVQDVVDRLPDYAIASEHEHSNCVLVANKKFQVNGDWWTWIDYDRFHELVQMYKASEGQKTFSAADYMAQTPHWAVFGADERGFDPGETRFMRKKTKDI 694          
BLAST of S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase vs. TrEMBL
Match: A0A2T7PHN4 (Flavodoxin-like domain-containing protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_08376 PE=4 SV=1)

HSP 1 Score: 726.472 bits (1874), Expect = 0.000e+0
Identity = 361/650 (55.54%), Postives = 455/650 (70.00%), Query Frame = 2
Query:  137 IKILYGSLTGKSKILAEKFSKECIHNNYDFKMMNMNTYDPEENLNKEK---SLLVIFVSTYENGTPPEDAKWFYNWLIDAKDDFRVDKNFLENLQFAVVGLGSSYYESNFNIVSKAIDEAFGSLSGKRLLEIGICDENVVNSKNGGLDYDYQEWSKKFWKTLTCT---SETKNSNGDVXXXXXXXXXXXXXXXXXXXXXXXIEITEENSDDEVLTSDEEEEKNMD-------------SGNELVDMEDLGMMM--------RKRKDIVE-NKTPREMLTPMLRTSLEKQGYKLIGSHSGVKMCRWTKSMLRGRGGCYKHAFYGIASHRCMEATPSLACANKCVFCWRHHSNPVGTEWKWIMDPPEMIVDEAVAKHIQMVKQFKGVPGVQEERFLEGLKPKHCALSLVGEPIMYPRINTLVGLLHSRQISTFLVTNAQFPDAIQQLVPVTQLYVSVDAGEKDALKKIDRPLFKDFWERFVASLTAVKDKKQRTVYRLTLVKAWNVDELDAYANLVDLGQPHFIEVKGVTYCGDSKASKLTMANVPWHEEVLSFVQQLADRLENYEIAAEHEHSNCVLLAQKKFKVNDEWNTWIDYEKFHELVQT------GKDFDATEYMAPTPSWAAYGSNEKGFNPSDTRF-RKLRKHI 1981
            +KI YG+ TGKSK  A++ + E     Y+ ++++M TYDPEENL +E    S+ V  VSTY  G PPED +WF+ WL D   DFRV K  L  + +AV GLG+S Y+ NFN+V + +D     LS   L+ +   DEN   S+NGG++ D+ EW K  WK L       + K+  GD C  K  +C       +        + T E++     +SDEE +                 + + LVD+EDLG +M        ++ K++ + N  PREM+TP+LR SLEKQGY+LIGSHSGVK+CRWTKSMLRGRGGCYKH FYGI SHRC+E TPSLACANKCVFCWRHH+NPVGTEWKW MD P+ I D A+  H+ +VKQFKGVPGV+ ER  E L+P+HCALSLVGEPIMYP IN  V +LH + IS+FLVTNAQFPDAI+ L+PVTQLYVSVDA  K++LKKIDRPLF+D+WERF+ SL A+ +K+QRTVYRLTLVK WN +ELD YA+L+ +G P FIEVKGVTYCG+SKAS LTM NVPWHEEV+ FV+QLA+RL  YE+A+EHEHSNC+LLA K+FKV+ EW TWI+Y KFH L+Q          F +T+YMA TP+WA YG+ E+GF+P +TRF RK +K I
Sbjct:  127 LKIFYGTQTGKSKAFAQRLAAEVKAYGYNVELVDMKTYDPEENLAEEAVDGSVCVFLVSTYTGGKPPEDTEWFFKWLEDTALDFRVQKTLLSGMCYAVFGLGNSLYKENFNVVGRNLDSWLQELSAIPLVSMMTGDENTAESRNGGIEEDFLEWKKALWKMLKPALDGRKVKHCKGDTCSKKCENCKSGKLGEAG-------DATHEHTKGGC-SSDEEIQFETSSEEEEEERETEGMTNSGLVDVEDLGKLMELAKTARTKEEKEMTQDNGEPREMITPLLRESLEKQGYRLIGSHSGVKLCRWTKSMLRGRGGCYKHTFYGIESHRCVETTPSLACANKCVFCWRHHTNPVGTEWKWKMDDPKTIFDGALKNHVNLVKQFKGVPGVKPERLAEALEPQHCALSLVGEPIMYPEINAFVTMLHEKGISSFLVTNAQFPDAIRALLPVTQLYVSVDAATKESLKKIDRPLFRDYWERFLDSLKALSEKQQRTVYRLTLVKGWNTEELDNYASLISIGNPDFIEVKGVTYCGESKASNLTMVNVPWHEEVVDFVKQLAERLPEYELASEHEHSNCLLLANKRFKVDGEWWTWINYPKFHALIQQYTSSNGAATFASTDYMAKTPAWAVYGATEQGFDPVETRFYRKKQKDI 768          
BLAST of S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase vs. TrEMBL
Match: A0A0L8FXJ3 (Flavodoxin-like domain-containing protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22005636mg PE=4 SV=1)

HSP 1 Score: 726.087 bits (1873), Expect = 0.000e+0
Identity = 369/647 (57.03%), Postives = 454/647 (70.17%), Query Frame = 2
Query:  128 KNTIKILYGSLTGKSKILAEKFSKECIHNNYDFKMMNMNTYDPEENLNKEKS---LLVIFVSTYENGTPPEDAKWFYNWLIDAKDDFRVDKNFLENLQFAVVGLGSSYYESNFNIVSKAIDEAFGSLSGKRLLEIGICDENVVNSKNGGLDYDYQEWSKKFWKT----LTCTSETKNSNGDVXXXXXXXXXXXXXXXXXXXXXXXIEITEENSDDEVLTSDEEEEKNMDSGNELVDMEDLGMMMRKRKDI----------------VENKTPREMLTPMLRTSLEKQGYKLIGSHSGVKMCRWTKSMLRGRGGCYKHAFYGIASHRCMEATPSLACANKCVFCWRHHSNPVGTEWKWIMDPPEMIVDEAVAKHIQMVKQFKGVPGVQEERFLEGLKPKHCALSLVGEPIMYPRINTLVGLLHSRQISTFLVTNAQFPDAIQQLVPVTQLYVSVDAGEKDALKKIDRPLFKDFWERFVASLTAVKDKKQRTVYRLTLVKAWNVDELDAYANLVDLGQPHFIEVKGVTYCGDSKASKLTMANVPWHEEVLSFVQQLADRLENYEIAAEHEHSNCVLLAQKKFKVNDEWNTWIDYEKFHELVQTGKD-----FDATEYMAPTPSWAAYGSNEKGFNPSDTR-FRKLRKHI 1981
            K ++ ILYGS TG SK LAE  ++         +++N+   DPE+++ + KS   + VI +STY  G+PP+DA WFY WL +   DFRV KNFLE + +AV   G+S Y+ NF++V K ID+    L   R+L +GI DE+   S +GGL  D+  W++KFWK     L   +    SN    +  +  CC  +NS+S+     +    EE  D + + S         +G  LVD+EDLG +M+  K                   +N+ P+ M+T + + SLEKQGY LIG+HSGVK+CRWTKSMLRGRGGCYKH FYGI SHRCME TPSLACANKCVFCWRHH+NPVGTEW+W+MD PE I + A+A H +M+KQF+GVPGV  ERF EG+ PKHCALSLVGEPIMYP IN  + LLH++ ISTFLVTNAQFPDAI  L+PVTQLYVSVDA  K++LKKIDRPLF+DFW+RF+ SL A+ +KKQRTVYRLTLVK WN DE++AYA+LVD G+P FIEVKGVTYCG+SKAS LTM NVPWHEEV  FVQQLAD L +YEIA EHEHSNC+L+A KKFKVN EW TWIDYEKFHELVQ  K+     F A +YMA TP WA YG+ E GF+PSD R FRK +K I
Sbjct:   66 KRSLHILYGSQTGHSKTLAESLAQNAEQQGVQVEVLNIKDCDPEDHIKQFKSPDRIYVIVISTYVQGSPPDDAVWFYKWLKETAVDFRVQKNFLEGMIYAVFSHGNSEYKENFSVVGKNIDDWLHQLEANRILPVGIGDEDTTQSSHGGLTEDFNAWNRKFWKKSIPLLKGGTLPVESNKCCKETCEKKCCDKDNSSSNQEVLMETSSEEEEEDGDNVESSGSLPVTQSNG--LVDLEDLGKVMKNVKKTKTKLKLNGYIVSTNKQTKNEEPKPMITEIFKKSLEKQGYSLIGTHSGVKLCRWTKSMLRGRGGCYKHTFYGIESHRCMETTPSLACANKCVFCWRHHTNPVGTEWRWLMDDPEYIFNGAIANHTKMIKQFRGVPGVLPERFNEGMSPKHCALSLVGEPIMYPEINKFIDLLHNKGISTFLVTNAQFPDAIHNLIPVTQLYVSVDASNKESLKKIDRPLFRDFWQRFLDSLQALAEKKQRTVYRLTLVKGWNTDEIEAYADLVDYGKPDFIEVKGVTYCGESKASTLTMKNVPWHEEVCGFVQQLADLLPDYEIACEHEHSNCLLVANKKFKVNGEWWTWIDYEKFHELVQNRKNNSEMIFTAEDYMAKTPDWAVYGAKEHGFDPSDKRFFRKKQKDI 710          
BLAST of S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase vs. TrEMBL
Match: V4CQI9 (Flavodoxin-like domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_135774 PE=4 SV=1)

HSP 1 Score: 717.613 bits (1851), Expect = 0.000e+0
Identity = 358/646 (55.42%), Postives = 437/646 (67.65%), Query Frame = 2
Query:  137 IKILYGSLTGKSKILAEKFSKECIHNNYDFKMMNMNTYDPEENL---NKEKSLLVIFVSTYENGTPPEDAKWFYNWLIDAKDDFRVDKNFLENLQFAVVGLGSSYYESNFNIVSKAIDEAFGSLSGKRLLEIGICDENVVNSKNGGLDYDYQEWSKKFWKTLTCT---SETKNSNGDVXXXXXXXXXXXXXXXXXXXXXXXIEITEENSDDEVLTSDEEEEKNMDSGNELVDMEDLGMMMRK------------------RKDIVENKTPREMLTPMLRTSLEKQGYKLIGSHSGVKMCRWTKSMLRGRGGCYKHAFYGIASHRCMEATPSLACANKCVFCWRHHSNPVGTEWKWIMDPPEMIVDEAVAKHIQMVKQFKGVPGVQEERFLEGLKPKHCALSLVGEPIMYPRINTLVGLLHSRQISTFLVTNAQFPDAIQQLVPVTQLYVSVDAGEKDALKKIDRPLFKDFWERFVASLTAVKDKKQRTVYRLTLVKAWNVDELDAYANLVDLGQPHFIEVKGVTYCGDSKASKLTMANVPWHEEVLSFVQQLADRLENYEIAAEHEHSNCVLLAQKKFKVNDEWNTWIDYEKFHELVQ------TGKDFDATEYMAPTPSWAAYGSNEKGFNPSDTR-FRKLRKHI 1981
            +K+ YG+ TG SK  AE  + E     Y  +++++ TYDPE+NL   N   ++ V  +STY +G PPE A WFY WL D  DDFRV K  L+ L + +VGLG+S Y+ N+  V+K +D++   LS  +  E   CDEN VNS NGGL+ D+  W + FWK         + K+           S    +   +  C +++    EEN  +    S   + K  +  + +VD+EDLG +M+K                   KDI E    REM+TP+LR SLEKQGYKLIGSHSGVK+CRWTKSMLRGRGGCYKH FYGI SHRCME TPSLACANKCVFCWRHH+NPVGTEWKW MD  E ++  A+  H +M+ +FKGVPGV  ERF EG+ P+HCALSLVGEPIMYP IN  + LLH + ISTFLVTNAQFPDAI++L P+TQLYVSVDA  K+ LKKIDRPLFKDFWERF+  L  + +K QRTVYRLTLVKAWN +E++ YA LVDLG+P FIEVKGVTYCGDSKAS LTM NVPWHEEV+ FV  L DRL +YEIA+EHEHSNC+LLA KK KV  EW TWIDY KFHEL+         K F   +YMA TP WA YG+ E+GF+P +TR  RK +K I
Sbjct:    1 MKVFYGTQTGNSKKFAEILAYEYELRGYGTEVVDLKTYDPEDNLVEENANGNICVFIISTYTDGQPPEGASWFYKWLTDTSDDFRVQKTLLKGLYYTIVGLGNSVYKDNYCTVAKKLDKSLHDLSATKFSETIFCDENTVNSLNGGLESDFAAWRENFWKKAQPALNGRKVKDCGKKCDGKCACSKPGVDGQEAGPCSSDEGSGEEENQFNSKNKSSPNKVKPANKTSGVVDLEDLGKIMKKAKICIILYKRKKLFFFQQNKDIEETGEVREMITPLLRQSLEKQGYKLIGSHSGVKLCRWTKSMLRGRGGCYKHTFYGIESHRCMETTPSLACANKCVFCWRHHTNPVGTEWKWKMDDAETLIAGALKNHTKMINEFKGVPGVIPERFQEGMNPQHCALSLVGEPIMYPEINKFIDLLHEKHISTFLVTNAQFPDAIRELTPITQLYVSVDANTKETLKKIDRPLFKDFWERFIECLKRLGEKGQRTVYRLTLVKAWNTEEIENYAKLVDLGRPDFIEVKGVTYCGDSKASSLTMENVPWHEEVIKFVTDLTDRLPDYEIASEHEHSNCLLLAHKKLKVKGEWWTWIDYPKFHELISEYTLSNGKKTFTTEDYMAKTPPWAVYGATERGFDPLETRHHRKKQKDI 646          
BLAST of S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase vs. Ensembl Cavefish
Match: tyw1 (S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase [Source:NCBI gene;Acc:103036157])

HSP 1 Score: 695.271 bits (1793), Expect = 0.000e+0
Identity = 350/646 (54.18%), Postives = 436/646 (67.49%), Query Frame = 2
Query:  137 IKILYGSLTGKSKILAEKFSKECIHNNYDFKMMNMNTYDPEENLNKE---KSLLVIFVSTYENGTPPEDAKWFYNWLIDAKDDFRVDKNFLENLQFAVVGLGSSYYESNFNIVSKAIDEAFGSLSGKRLLEIGICDENVVNSKNGGLDYDYQEWSKKFWKTLTCTS--ETKNSNGDVXXXXXXXXXXXXXXXXXXXXXXXIEITEENSDDEVLTSDEEEEKNMDSGNELVDMEDLGMMM---RKRKDIVENKT-------------------PREMLTPMLRTSLEKQGYKLIGSHSGVKMCRWTKSMLRGRGGCYKHAFYGIASHRCMEATPSLACANKCVFCWRHHSNPVGTEWKWIMDPPEMIVDEAVAKHIQMVKQFKGVPGVQEERFLEGLKPKHCALSLVGEPIMYPRINTLVGLLHSRQISTFLVTNAQFPDAIQQLVPVTQLYVSVDAGEKDALKKIDRPLFKDFWERFVASLTAVKDKKQRTVYRLTLVKAWNVDELDAYANLVDLGQPHFIEVKGVTYCGDSKASKLTMANVPWHEEVLSFVQQLADRLENYEIAAEHEHSNCVLLAQKKFKVNDEWNTWIDYEKFHELVQTGKD------FDATEYMAPTPSWAAYGSNEKGFNPSDTRFRKLRK 1975
            ++I YGS TG +K  A + + +     +  ++ +M  YDP++ L+ E   K + V  V+TY +G P E+A+WF  WL +A  DFR  K +L+ +++AV GLG+S Y  ++N V K +D+   +LS  R+L  G  D NVV S+NG +  D+Q W  KF   L   +  E K  +G    +   +  +         +    E        E  +  E   +   +   ++DMEDLG +M   +K K   E ++                    REM+TP LR +L KQGYKLIGSHSGVK+CRWTKSMLRGRGGCYKH FYGI SHRCME TPSLACANKCVFCWRHH+NPVGTEW+W MDP E I+ EAV  H  M++QF+GVPGV+ ERF EGL  KHCALSLVGEPIMYP IN  + LLH R IS+FLVTNAQFP+ I+ LVPVTQLYVSVDA  KD+LKKIDRPLFKDFW+RF+ SL A+ +K+QRTVYRLTLVKAWNVDEL AY+ L+ LGQP FIEVKGVTYCG+S AS LTMANVPWHEEV+ FVQQL + L +YEIA EHEHSNC+LLA  KFKV  EW TWIDYE+F EL+Q  +D      F A +Y+A TPSWA +G  E+GF+PSDTRF++  K
Sbjct:   79 VRIFYGSQTGTAKGFARELADDARAAGFHSEVFDMKDYDPDDRLSDECTSKMICVFLVATYTDGKPTENAEWFCKWLEEASTDFRYGKTYLKGMRYAVFGLGNSEYVGHYNTVGKNVDKWLWALSASRVLSRGEGDCNVVKSRNGSVQADFQAWKAKFLTRLQALARGEKKACSGKCKKSSCKNKKEHQQEAVDEHQ----EKHSSEELFESSSDSESAGEEEKAHGSVIDMEDLGNVMNHMKKAKKQSEEESQRGKLSKLNGVMKTEGEEEAREMITPALREALTKQGYKLIGSHSGVKLCRWTKSMLRGRGGCYKHTFYGIESHRCMETTPSLACANKCVFCWRHHTNPVGTEWRWKMDPAEKILQEAVENHQNMIRQFRGVPGVRPERFEEGLTVKHCALSLVGEPIMYPEINAFLRLLHQRHISSFLVTNAQFPEEIRSLVPVTQLYVSVDASTKDSLKKIDRPLFKDFWQRFLDSLRALGEKQQRTVYRLTLVKAWNVDELKAYSELIALGQPDFIEVKGVTYCGESSASSLTMANVPWHEEVIHFVQQLENLLPDYEIACEHEHSNCLLLAHHKFKVEGEWWTWIDYERFQELIQRYEDSGGAETFSALDYVAKTPSWALFGGRERGFDPSDTRFQRKNK 720          
BLAST of S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase vs. Ensembl Cavefish
Match: tyw1 (S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase [Source:NCBI gene;Acc:103036157])

HSP 1 Score: 681.404 bits (1757), Expect = 0.000e+0
Identity = 344/634 (54.26%), Postives = 427/634 (67.35%), Query Frame = 2
Query:  173 KILAEKFSKECIHNNYDFKMMNMNTYDPEENLNKE---KSLLVIFVSTYENGTPPEDAKWFYNWLIDAKDDFRVDKNFLENLQFAVVGLGSSYYESNFNIVSKAIDEAFGSLSGKRLLEIGICDENVVNSKNGGLDYDYQEWSKKFWKTLTCTS--ETKNSNGDVXXXXXXXXXXXXXXXXXXXXXXXIEITEENSDDEVLTSDEEEEKNMDSGNELVDMEDLGMMM---RKRKDIVENKT-------------------PREMLTPMLRTSLEKQGYKLIGSHSGVKMCRWTKSMLRGRGGCYKHAFYGIASHRCMEATPSLACANKCVFCWRHHSNPVGTEWKWIMDPPEMIVDEAVAKHIQMVKQFKGVPGVQEERFLEGLKPKHCALSLVGEPIMYPRINTLVGLLHSRQISTFLVTNAQFPDAIQQLVPVTQLYVSVDAGEKDALKKIDRPLFKDFWERFVASLTAVKDKKQRTVYRLTLVKAWNVDELDAYANLVDLGQPHFIEVKGVTYCGDSKASKLTMANVPWHEEVLSFVQQLADRLENYEIAAEHEHSNCVLLAQKKFKVNDEWNTWIDYEKFHELVQTGKD------FDATEYMAPTPSWAAYGSNEKGFNPSDTRFRKLRK 1975
            K  A + + +     +  ++ +M  YDP++ L+ E   K + V  V+TY +G P E+A+WF  WL +A  DFR  K +L+ +++AV GLG+S Y  ++N V K +D+   +LS  R+L  G  D NVV S+NG +  D+Q W  KF   L   +  E K  +G    +   +  +         +    E        E  +  E   +   +   ++DMEDLG +M   +K K   E ++                    REM+TP LR +L KQGYKLIGSHSGVK+CRWTKSMLRGRGGCYKH FYGI SHRCME TPSLACANKCVFCWRHH+NPVGTEW+W MDP E I+ EAV  H  M++QF+GVPGV+ ERF EGL  KHCALSLVGEPIMYP IN  + LLH R IS+FLVTNAQFP+ I+ LVPVTQLYVSVDA  KD+LKKIDRPLFKDFW+RF+ SL A+ +K+QRTVYRLTLVKAWNVDEL AY+ L+ LGQP FIEVKGVTYCG+S AS LTMANVPWHEEV+ FVQQL + L +YEIA EHEHSNC+LLA  KFKV  EW TWIDYE+F EL+Q  +D      F A +Y+A TPSWA +G  E+GF+PSDTRF++  K
Sbjct:   46 KGFARELADDARAAGFHSEVFDMKDYDPDDRLSDECTSKMICVFLVATYTDGKPTENAEWFCKWLEEASTDFRYGKTYLKGMRYAVFGLGNSEYVGHYNTVGKNVDKWLWALSASRVLSRGEGDCNVVKSRNGSVQADFQAWKAKFLTRLQALARGEKKACSGKCKKSSCKNKKEHQQEAVDEHQ----EKHSSEELFESSSDSESAGEEEKAHGSVIDMEDLGNVMNHMKKAKKQSEEESQRGKLSKLNGVMKTEGEEEAREMITPALREALTKQGYKLIGSHSGVKLCRWTKSMLRGRGGCYKHTFYGIESHRCMETTPSLACANKCVFCWRHHTNPVGTEWRWKMDPAEKILQEAVENHQNMIRQFRGVPGVRPERFEEGLTVKHCALSLVGEPIMYPEINAFLRLLHQRHISSFLVTNAQFPEEIRSLVPVTQLYVSVDASTKDSLKKIDRPLFKDFWQRFLDSLRALGEKQQRTVYRLTLVKAWNVDELKAYSELIALGQPDFIEVKGVTYCGESSASSLTMANVPWHEEVIHFVQQLENLLPDYEIACEHEHSNCLLLAHHKFKVEGEWWTWIDYERFQELIQRYEDSGGAETFSALDYVAKTPSWALFGGRERGFDPSDTRFQRKNK 675          
BLAST of S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase vs. Ensembl Cavefish
Match: porb (NADPH--cytochrome P450 reductase-like [Source:NCBI gene;Acc:103023972])

HSP 1 Score: 75.485 bits (184), Expect = 9.172e-14
Identity = 51/167 (30.54%), Postives = 85/167 (50.90%), Query Frame = 2
Query:  137 IKILYGSLTGKSKILAEKFSKECIHNNYDFKMMNMNTYDPEE----NLNKEK----SLLVIFVSTYENGTPPEDAKWFYNWLIDAKDDFRVDKNFLENLQFAVVGLGSSYYESNFNIVSKAIDEAFGSLSGKRLLEIGICDENVVNSKNGGLDYDYQEWSKKFWKTL 613
            I + YGS TG  +  A + SK+     Y  K M     DPEE     L++ K    SL +  ++TY  G P ++A+ FY+WL ++  D       L+ + F V  LG+  YE ++N + K +D+    L  KR+ ++G+ D+      +G L+ D+  W ++FW  +
Sbjct:   79 IVVFYGSQTGTGEEFANRLSKDA--QRYGMKGM---AADPEEYDMSELSRLKEIDNSLAIFCMATYGEGDPTDNAQDFYDWLQESDAD-------LDGVNFTVFALGNKTYE-HYNAMGKYVDKRLSELGAKRIFDLGMGDD------DGNLEEDFVSWREQFWPAV 226          
BLAST of S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase vs. Ensembl Cavefish
Match: pora (NADPH--cytochrome P450 reductase [Source:NCBI gene;Acc:103023494])

HSP 1 Score: 69.3218 bits (168), Expect = 8.321e-12
Identity = 49/170 (28.82%), Postives = 81/170 (47.65%), Query Frame = 2
Query:  128 KNTIKILYGSLTGKSKILAEKFSKECIHNNYDFKMMNMNTYDPEENLNKE--------KSLLVIFVSTYENGTPPEDAKWFYNWLIDAKDDFRVDKNFLENLQFAVVGLGSSYYESNFNIVSKAIDEAFGSLSGKRLLEIGICDENVVNSKNGGLDYDYQEWSKKFWKTL 613
            +N I + YGS TG ++  A +  K+     Y  K M     DPEE    E         SL V  ++TY  G P ++A+ FY+W+       +V    LE + F+V GLG+  Y+ ++N + K  D     L   ++ ++G+ D+      +G L+ D+  W  +FW  +
Sbjct:   35 RNVI-VFYGSQTGTAEEFATRLVKDA--QRYGIKGM---VADPEEYDMSELPRLTEVVNSLAVFCMATYGEGEPTDNAQGFYDWM-------QVTDVSLEGVHFSVFGLGNKTYD-HYNAMGKYTDRRLAELGATQIFDLGLGDD------DGNLEEDFISWKAQFWPAV 184          
BLAST of S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase vs. Ensembl Cavefish
Match: mtrr (5-methyltetrahydrofolate-homocysteine methyltransferase reductase [Source:NCBI gene;Acc:103046907])

HSP 1 Score: 61.6178 bits (148), Expect = 1.882e-9
Identity = 43/157 (27.39%), Postives = 76/157 (48.41%), Query Frame = 2
Query:  143 ILYGSLTGKSKILAEKFSKECIHNNYDFKMMNMNTYDPEENLNKEKSLLVIFVSTYENGTPPEDAKWFYNWLIDAKDDFRVDKNFLENLQFAVVGLGSSYYESNFNIVSKAIDEAFGSLSGKRLLEIGICDENVVNSKNGGLDYDYQEWSKKFWKTL 613
            ILYGS  G+++ +AE+ S++   + +  K+  ++  D + NL++E   +V  VST  +G PP+ A  F   + +      +  +   +L +A++GLG + Y +NF    K ID+    L  K     G  D+        GL+     W +  W+ L
Sbjct:   11 ILYGSQRGQAQSIAEEISEQATEHGFLAKISCLSKGD-KYNLDREHGPVVFVVSTTGDGEPPDTALKFVKKIKNKS----LPGDHYSHLHYALLGLGDTNY-ANFCNCGKTIDKRLQELGAKHFYATGHADDGT------GLEVVVDPWIEGLWEAL 155          
BLAST of S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008170.1 (pep scaffold:Pmarinus_7.0:GL479645:6967:26481:1 gene:ENSPMAG00000007386.1 transcript:ENSPMAT00000008170.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 115.161 bits (287), Expect = 9.548e-29
Identity = 87/302 (28.81%), Postives = 139/302 (46.03%), Query Frame = 2
Query:  170 SKILAEKFSKECIHNNYDFKMMNMNTYDPEENLNKE---KSLLVIFVSTYENGTPPEDAKWFYNWLIDAKDDFRVDKNFLENLQFAVVGLGSSYYESNFNIVSKAIDEAFGSLSGKRLLEIGICDENVVNSKNGGLDYDYQEWSKKFWKTLTCTSETKNSNGDVXXXXXXXXXXXXXXXXXXXXXXXIEITEENSDDEVLTSDEEEEK--------NMDSGNELVDMEDLGMMM----------------RKRKDIVENKT-------PREMLTPMLRTSLEKQGYKLIGSHSGVKMCRWTK 973
            +K+LAE+    C+   +   + ++ ++DPE++L +E        I    Y +    +  +    WL +A  DFR  K  L  +++AV GLG S Y+ ++N V K +D+    L  +R+L  G  D NVV S++G  D D++ W     +             D      +         S    + + E+ E+ ++    TS   EE               +LVD+EDLG ++                ++R+ +   K        PREM+TP LR +L KQGY+LIG+HSGVK+CRWTK
Sbjct:    2 AKLLAEELG--CL--GFTSSVSDLRSFDPEDSLLEEVPQPRSQYIRSPYYPHLRVGKHNECHCKWLEEAASDFRYGKTHLRGVRYAVFGLGDSVYQEHYNTVGKNMDKWLWQLGARRVLPRGDGDFNVVRSRHGSADADFEAWKGHLVRLRALA--------DPGTAAGAGVGGQQRQRSDSEGSCRDELEEDRTNPNENTSKASEEFETTSEEEGGTADAADLVDVEDLGRIVTEARRSQKSHVDEDDVKRRRRVAAGKGRATSTEEPREMITPALREALTKQGYRLIGTHSGVKLCRWTK 291          
BLAST of S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008175.1 (pep scaffold:Pmarinus_7.0:GL479645:6967:26481:1 gene:ENSPMAG00000007386.1 transcript:ENSPMAT00000008175.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.9442 bits (180), Expect = 9.969e-15
Identity = 44/143 (30.77%), Postives = 75/143 (52.45%), Query Frame = 2
Query:  170 SKILAEKFSKECIHNNYDFKMMNMNTYDPEENLNKE---KSLLVIFVSTYENGTPPEDAKWFYNWLIDAKDDFRVDKNFLENLQFAVVGLGSSYYESNFNIVSKAIDEAFGSLSGKRLLEIGICDENVVNSKNGGLDYDYQEW 589
            +K+LAE+    C+   +   + ++ ++DPE++L +E        I    Y +    +  +    WL +A  DFR  K  L  +++AV GLG S Y+ ++N V K +D+    L  +R+L  G  D NVV S++G  D D++ W
Sbjct:    2 AKLLAEELG--CL--GFTSSVSDLRSFDPEDSLLEEVPQPRSQYIRSPYYPHLRVGKHNECHCKWLEEAASDFRYGKTHLRGVRYAVFGLGDSVYQEHYNTVGKNMDKWLWQLGARRVLPRGDGDFNVVRSRHGSADADFEAW 140          

HSP 2 Score: 69.3218 bits (168), Expect = 3.163e-13
Identity = 35/79 (44.30%), Postives = 47/79 (59.49%), Query Frame = 2
Query:  803 ELVDMEDLG----------------MMMRKRK------DIVENKTPREMLTPMLRTSLEKQGYKLIGSHSGVKMCRWTK 973
            +LVD+EDLG                ++ R+R+           + PREM+TP LR +L KQGY+LIG+HSGVK+CRWTK
Sbjct:  211 DLVDVEDLGRIVTEARRSQNQEDESLLTRRRRVAAGKGRATSTEEPREMITPALREALTKQGYRLIGTHSGVKLCRWTK 289          
BLAST of S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase vs. Ensembl Sea Lamprey
Match: porb (P450 (cytochrome) oxidoreductase b [Source:ZFIN;Acc:ZDB-GENE-030131-5767])

HSP 1 Score: 57.3806 bits (137), Expect = 8.170e-9
Identity = 34/113 (30.09%), Postives = 60/113 (53.10%), Query Frame = 2
Query:  275 EKSLLVIFVSTYENGTPPEDAKWFYNWLIDAKDDFRVDKNFLENLQFAVVGLGSSYYESNFNIVSKAIDEAFGSLSGKRLLEIGICDENVVNSKNGGLDYDYQEWSKKFWKTL 613
            E SL V  ++TY  G P ++A+ FY+ L +   +       L  +++AV GLG+  YE +FN + K +D+    L  +R+ E+G  D++        L+ D+  W ++FW  +
Sbjct:  135 ENSLAVFCMATYGEGDPTDNAQEFYDLLQEGSLE-------LAGVKYAVFGLGNKTYE-HFNAMGKYLDKRLEELGAERIFELGSGDDDAT------LEEDFITWKERFWPAV 233          
BLAST of S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase vs. Ensembl Yeast
Match: TYW1 (Iron-sulfer protein required for synthesis of Wybutosine modified tRNA; Wybutosine is a modified guanosine found at the 3'-position adjacent to the anticodon of phenylalanine tRNA which supports reading frame maintenance by stabilizing codon-anticodon interactions; induction by Yap5p in response to iron provides protection from high iron toxicity; overexpression results in increased cellular iron [Source:SGD;Acc:S000006128])

HSP 1 Score: 454.907 bits (1169), Expect = 1.472e-150
Identity = 266/636 (41.82%), Postives = 372/636 (58.49%), Query Frame = 2
Query:  137 IKILYGSLTGKSKILAEKFS---KECIHNNYDFKMMNMNTY----DPEENLNKEKSLLVIFVSTYENGTPPEDAKWFYNWLIDAKDDFRVDKNFLENL-QFAVVGLGSS-YYESNFNIVSKAIDEAFGSLSGKRLLEIG-ICDENVVNSKNGGLDYDYQEWSKKFWKTLTCTSETKNSNGDVXXXXXXXXXXXXXXXXXXXXXXXIEITEENSDDEVLTSDEEEEKNMDSGNELVDMEDLGMMMRKRK----DIVENKTPREMLTPMLRTSLEKQGYKLIGSHSGVKMCRWTKSMLRGRGGCYKHAFYGIASHRCMEATPSLACANKCVFCWRHHSNPVGTEWKWIMDPPEMIVDEAVAKHIQMVKQFKGVPGVQEERFLEGLKPKHCALSLVGEPIMYPRINTLVGLLHSRQISTFLVTNAQFPDAIQQLVPVTQLYVSVDAGEKDALKKIDRPLFKDFWERFVASLTAVK--DKKQRTVYRLTLVKAWNVDELDAYANLVDLGQPHFIEVKGVTYCG--DSKASKLTMANVPWHEEVLSFVQQLADRLE----NYEIAAEHEHSNCVLLAQKKFKVNDEWNTWIDYEKFHELVQTGKDFDATEYMAPTPSWAAYGSNEKGFNPSDTR-FRKLRK 1975
            I +LY SL G +   A+      KE      + K++N++      D   N+  E +L V+ + +Y+   P +   +F   L +  +DFRVD   L  L  + V+GLG S  +   F   +K  D     L G+R+  +G +C       K GG      EW+    +TL                                    I   +EN+D E    ++EEE N    +EL D+ED+G      K    D ++    ++  +P  + +L KQGYK+IGSHSGVK+CRWTK+ LRG+G CYK + + IAS RCME TPSLAC++KCVFCWRH +NPV   W+W +D PE I++ A+  H  M+KQ +GVPGV  ERF +  + +HCALSLVGEPI+YP IN  + LLH + I++FLV NAQ P+A++ +V VTQLYVS+DA  K  LKK+DRPL+KDFWER V  L  +K     QRTV+RLTLVK +N+ ++ AYA+LV  G P FIEVKG T+ G  D   + LTM N+P++EE + FV+     L+    +Y++AAEH HSNC+L+A  KFK+N EW+T ID++KF  L+ +GKDF   +Y+  TP WA +G+   GF P +TR +RK +K
Sbjct:  205 IYVLYSSLQGAASKAAKSVYDKLKELDELTNEPKLLNLDDLSDFDDYFINVPVENALYVLVLPSYDIDCPLD---YFLQTLEENANDFRVDSFPLRKLVGYTVLGLGDSESWPEKFCYQAKRADHWISRLGGRRIFPLGKVC------MKTGG-SAKIDEWTSLLAETL------------------------------KDDEPIIYEYDENADSE----EDEEEGN--GSDELGDVEDIGGKGSNGKFSGADEIKQMVAKD--SPTYK-NLTKQGYKVIGSHSGVKICRWTKNELRGKGSCYKKSLFNIASSRCMELTPSLACSSKCVFCWRHGTNPVSKNWRWEVDEPEYILENALKGHYSMIKQMRGVPGVIAERFAKAFEVRHCALSLVGEPILYPHINKFIQLLHQKGITSFLVCNAQHPEALRNIVKVTQLYVSIDAPTKTELKKVDRPLYKDFWERMVECLEILKTVQNHQRTVFRLTLVKGFNMGDVSAYADLVQRGLPGFIEVKGATFSGSSDGNGNPLTMQNIPFYEECVKFVKAFTTELQRRGLHYDLAAEHAHSNCLLIADTKFKINGEWHTHIDFDKFFVLLNSGKDFTYMDYLEKTPEWALFGNG--GFAPGNTRVYRKDKK 789          
BLAST of S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase vs. Ensembl Yeast
Match: NCP1 (NADP-cytochrome P450 reductase; involved in ergosterol biosynthesis; associated and coordinately regulated with Erg11p [Source:SGD;Acc:S000001084])

HSP 1 Score: 64.3142 bits (155), Expect = 3.190e-11
Identity = 52/165 (31.52%), Postives = 83/165 (50.30%), Query Frame = 2
Query:  122 NEKNTIKILYGSLTGKSKILAEKFSKECIHN-NYDFKMMNMNTYDPEENLNKEKSLLVIFVSTYENGTPPEDAKWFYNWLIDAKDDFRVDKNFLENLQFAVVGLGSSYYESNFNIVSKAIDEAFGSLSGKRLLEIGICDENVVNSKNGGLDYDYQEWSKKFWKTL 613
            N KN + +LY S TG ++  A+KFSKE +   N +    ++  YD  E+LN    ++ IF+STY  G  P+ A  F +++ +A      +   L NL++ + GLG+S YE  FN  +K  ++   +    RL ++G  D+       G  D DY  W     + L
Sbjct:   57 NNKNYL-VLYASQTGTAEDYAKKFSKELVAKFNLNVMCADVENYD-FESLNDVPVIVSIFISTYGEGDFPDGAVNFEDFICNA------EAGALSNLRYNMFGLGNSTYEF-FNGAAKKAEKHLSAAGAIRLGKLGEADDGA-----GTTDEDYMAWKDSILEVL 207          
BLAST of S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase vs. Ensembl Yeast
Match: MET5 (Sulfite reductase beta subunit; involved in amino acid biosynthesis, transcription repressed by methionine [Source:SGD;Acc:S000003898])

HSP 1 Score: 50.8322 bits (120), Expect = 6.904e-7
Identity = 46/168 (27.38%), Postives = 74/168 (44.05%), Query Frame = 2
Query:  137 IKILYGSLTGKSKILAEKFSKECIHNNYDFKMMNMNTYDPEENLNKEKSLLVIFVSTYENGTPPEDAKWFYNWLIDAKDDFRVDKNFLENLQFAVVGLGSSYY------ESNFNIVSKAIDEAFGSLSGKRLLEIGICDENVVNSKNGGLDYDYQEWSKKFWKTLTCT 622
            + + Y S  G +  LA++ +           +++M+    EE   +E   +V   ST   G  P+D K F+  L   K+D  +D   L +L  AV GLG S Y      +  FN  S+ + +    LS K L+ +G+ D+   +    G    Y EW  K W+ L  +
Sbjct:  682 LHVYYASDGGNAANLAKRLAARASARGLKATVLSMDDIILEELPGEEN--VVFITSTAGQGEFPQDGKSFWEAL---KNDTDLD---LASLNVAVFGLGDSEYWPRKEDKHYFNKPSQDLFKRLELLSAKALIPLGLGDDQDAD----GFQTAYSEWEPKLWEALGVS 837          
BLAST of S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase vs. Ensembl Nematostella
Match: EDO44602 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RV91])

HSP 1 Score: 703.745 bits (1815), Expect = 0.000e+0
Identity = 345/612 (56.37%), Postives = 438/612 (71.57%), Query Frame = 2
Query:  206 IHNNYDFKMMNMNTYDPEENLNKE---KSLLVIFVSTYENGTPPEDAKWFYNWLIDAKDDFRVDKNFLENLQFAVVGLGSSYYESNFNIVSKAIDEAFGSLSGKRLLEIGICDENVVNSKNGGLDYDYQEWSKKFWKTLTCTSETKNSNGDVXXXXXXXXXXXXXXXXXXXXXXXIEITEENSDDEVLTSDEEEEKNMDSGNELVDMEDLGMMMRKRK----------DIVENKTPREMLTPMLRTSLEKQGYKLIGSHSGVKMCRWTKSMLRGRGGCYKHAFYGIASHRCMEATPSLACANKCVFCWRHHSNPVGTEWKWIMDPPEMIVDEAVAKHIQMVKQFKGVPGVQEERFLEGLKPKHCALSLVGEPIMYPRINTLVGLLHSRQISTFLVTNAQFPDAIQQLVPVTQLYVSVDAGEKDALKKIDRPLFKDFWERFVASLTAVKDKKQRTVYRLTLVKAWNVDELDAYANLVDLGQPHFIEVKGVTYCGDSKASKLTMANVPWHEEVLSFVQQLADRLENYEIAAEHEHSNCVLLAQKKFKVNDEWNTWIDYEKFHELVQTGKD------FDATEYMAPTPSWAAYGSNEKGFNPSDTR-FRKLRKHI 1981
            +    D    N+  Y+ E+NL  E   KS  V  V TY +G PP  A+WFY+WL D+ +D RV K+ L  + +AV GLG+S YE  FN+V+K ID+   SLS KR++ + + DEN VNS++GGL+ D+Q W K F+  +   +  +    + C     S                 E T +  D E  TSD + E + D+ + LVDMEDLG  ++K K          D  +N   +EM+TP++R SL KQGYK+IGSHSGVK+CRWTKSMLRGRGGCYKH FYGI SHRCME TPSLACANKCVFCWRHH+NPVGTEW+W MD P+MIV+ A+  H  M+KQF+GVPGV+ ERF EG+K KHCALSLVGEPIMYP+IN L+ LLH   IS+FLVTNAQFPDAI+ L+PVTQLYVSVDAG K++LKKIDRPLF+DFW RF+ SL A+ DK QRTVYRLTLVK+WNV+E+ +Y  LV LG+P FIEVKGVTYCG+SKAS LTMAN+PWH+EV+ FV++L D+L +YE+A+EHEHSNCVLLA KKFKVN EW+TWIDY KFH+L++  ++      F + +YM   P W+ +G +++GF+P +TR +RK RK I
Sbjct:    5 MQQGMDCSCENLQGYEAEDNLANEVCTKSTCVFIVPTYTDGKPPRGAEWFYSWLEDSTNDCRVSKSLLSQINYAVFGLGNSSYEGQFNLVAKNIDKWLSSLSAKRVMPVTLGDENTVNSRHGGLEADFQVWCKTFFSLVKSHTLCECGKQETCQETSKSQ----------------EETSQACDYES-TSDGDSE-DEDTADGLVDMEDLGPAVQKIKKAKKQREIEEDSHKNTVAKEMVTPVIRQSLTKQGYKIIGSHSGVKICRWTKSMLRGRGGCYKHTFYGIESHRCMETTPSLACANKCVFCWRHHTNPVGTEWRWQMDDPQMIVEGAMQNHYNMIKQFRGVPGVKPERFEEGMKIKHCALSLVGEPIMYPKINELIKLLHGHGISSFLVTNAQFPDAIKDLLPVTQLYVSVDAGTKESLKKIDRPLFRDFWPRFLDSLKALADKGQRTVYRLTLVKSWNVEEIQSYVELVSLGKPDFIEVKGVTYCGESKASTLTMANIPWHQEVVGFVRKLEDQLPDYELASEHEHSNCVLLAHKKFKVNGEWHTWIDYTKFHQLIEKYEESNGEETFTSADYMERNPEWSVFGHSQRGFDPEETRWYRKNRKDI 598          
BLAST of S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase vs. Ensembl Nematostella
Match: EDO28992 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T4X1])

HSP 1 Score: 81.6481 bits (200), Expect = 2.066e-16
Identity = 51/167 (30.54%), Postives = 86/167 (51.50%), Query Frame = 2
Query:  137 IKILYGSLTGKSKILAEKFSKECIHNNYDFKMMNMNTYDPEENLNKE--------KSLLVIFVSTYENGTPPEDAKWFYNWLIDAKDDFRVDKNFLENLQFAVVGLGSSYYESNFNIVSKAIDEAFGSLSGKRLLEIGICDENVVNSKNGGLDYDYQEWSKKFWKTL 613
            + I YGS TG ++  A + +K+     Y  K M    +DPEEN  +E         S  +  ++TY  G P ++A+ FY WL + +DD       L++L FAV GLG+  YE ++N + + +D+    L G R+ + G  D+      +G ++ D+  W ++FW  +
Sbjct:    4 LAIFYGSQTGTAEEFASRLAKDA--QRYGIKAM---VFDPEENDMEELTRMGEIDNSFAIFVMATYGEGDPTDNAQEFYEWLQNDRDD-------LDSLNFAVFGLGNKTYE-HYNSMGRYVDKRLEELGGNRIYQRGEGDD------DGNIEEDFVRWREEFWPAV 151          
BLAST of S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase vs. Ensembl Nematostella
Match: EDO39434 (NADPH--cytochrome P450 reductase [Source:UniProtKB/TrEMBL;Acc:A7SA55])

HSP 1 Score: 78.9518 bits (193), Expect = 2.466e-15
Identity = 51/167 (30.54%), Postives = 85/167 (50.90%), Query Frame = 2
Query:  137 IKILYGSLTGKSKILAEKFSKECIHNNYDFKMMNMNTYDPEENLNKE--------KSLLVIFVSTYENGTPPEDAKWFYNWLIDAKDDFRVDKNFLENLQFAVVGLGSSYYESNFNIVSKAIDEAFGSLSGKRLLEIGICDENVVNSKNGGLDYDYQEWSKKFWKTL 613
            + I YGS TG ++  A + +K+     Y  K M    +DPEEN  +E         S  +  ++TY  G P ++A+ FY WL + +DD       L+ L FAV GLG+  YE ++N + + +D+    L G R+ + G  D+      +G ++ D+  W ++FW  +
Sbjct:   72 LAIFYGSQTGTAEEFASRLAKDA--QRYGIKAM---VFDPEENDMEELTRMGEIDNSFAIFVMATYGEGDPTDNAQEFYEWLQNDRDD-------LDCLNFAVFGLGNKTYE-HYNSMGRYVDKRLEELGGYRIYQRGEGDD------DGNIEEDFVRWREEFWPAV 219          
BLAST of S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase vs. Ensembl Nematostella
Match: EDO40246 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7T0])

HSP 1 Score: 63.929 bits (154), Expect = 1.169e-10
Identity = 46/161 (28.57%), Postives = 77/161 (47.83%), Query Frame = 2
Query:  131 NTIKILYGSLTGKSKILAEKFSKECIHNNYDFKMMNMNTYDPEENLNKEKSLLVIFVSTYENGTPPEDAKWFYNWLIDAKDDFRVDKNFLENLQFAVVGLGSSYYESNFNIVSKAIDEAFGSLSGKRLLEIGICDENVVNSKNGGLDYDYQEWSKKFWKTL 613
            N+  ILY S TG++K +A++  ++   N  + K+  ++  + +  L KE S +V  VST   G PP+    F+  L        +  N L++LQ+ ++ LG S Y +NF +  K +D     L  K+  + G  D+ V      GL+   + W    W  L
Sbjct:    5 NSFTILYASQTGQAKAIADEIHEKSASNGLNSKLFCLSLTEKKFMLEKE-SAVVFVVSTTGEGDPPDTMLKFFRRLKKKT----LPGNHLKDLQYGLLALGDSNY-TNFCVNGKNLDRRLNELGAKKFYDTGHADDAV------GLELVVEPWIDGLWGPL 153          
BLAST of S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase vs. Ensembl Nematostella
Match: EDO39440 (Nitric oxide synthase [Source:UniProtKB/TrEMBL;Acc:A7SA75])

HSP 1 Score: 56.9954 bits (136), Expect = 2.589e-8
Identity = 48/168 (28.57%), Postives = 82/168 (48.81%), Query Frame = 2
Query:  143 ILYGSLTGKSKILAEKFSKECIHNNYDFKMMNMNTYDPEENLNKEKSLLVIFVSTYENGTPPEDAKWFYNWLIDAKDDFRVDKNFLENLQFAVVGLGSSYYESNFNIVSKAIDEAFGSLSGKRLLEIGICDENVVNSKNGGLDYDYQEWSKKFWKTLT---CTSETKN 637
            ILY + TGKS+  A   +   +H  +D K+M M+ Y   E  N++  L++I  ST+ NG PPE+ +      +D+    R+    +E+  F   GLGS  Y  NF   ++++D+    L  +++ + G  DE        G +  ++ W+K+ +K      C  E  N
Sbjct:  485 ILYATETGKSESYARMLADLFLHA-FDPKVMRMDEYPHPEMENEQ--LILIVTSTFGNGDPPENGEVSTINPLDSASQQRI----IEDQMF---GLGSRAY-PNFCAFARSLDKIIQELGAEQIHKCGEGDE------LAGQEESFKTWAKQVFKAACDTFCVGEMVN 635          
BLAST of S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase vs. Ensembl Medaka
Match: tyw1 (S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase [Source:NCBI gene;Acc:101161427])

HSP 1 Score: 705.286 bits (1819), Expect = 0.000e+0
Identity = 353/648 (54.48%), Postives = 444/648 (68.52%), Query Frame = 2
Query:  137 IKILYGSLTGKSKILAEKFSKECIHNNYDFKMMNMNTYDPEENLNKE---KSLLVIFVSTYENGTPPEDAKWFYNWLIDAKDDFRVDKNFLENLQFAVVGLGSSYYESNFNIVSKAIDEAFGSLSGKRLLEIGICDENVVNSKNGGLDYDYQEWSKKFWKTLTC--TSETKNSNGDVXXXXXXXXXXXXXXXXXXXXXXXIEITEENSDDEVLTSDEEEEKNMDSGNELVDMEDLGMMMRKR------------------------KDIVENKTPREMLTPMLRTSLEKQGYKLIGSHSGVKMCRWTKSMLRGRGGCYKHAFYGIASHRCMEATPSLACANKCVFCWRHHSNPVGTEWKWIMDPPEMIVDEAVAKHIQMVKQFKGVPGVQEERFLEGLKPKHCALSLVGEPIMYPRINTLVGLLHSRQISTFLVTNAQFPDAIQQLVPVTQLYVSVDAGEKDALKKIDRPLFKDFWERFVASLTAVKDKKQRTVYRLTLVKAWNVDELDAYANLVDLGQPHFIEVKGVTYCGDSKASKLTMANVPWHEEVLSFVQQLADRLENYEIAAEHEHSNCVLLAQKKFKVNDEWNTWIDYEKFHELVQTGKD------FDATEYMAPTPSWAAYGSNEKGFNPSDTRFRKLRK 1975
            +KI YGS TG +K  A+  S+E     +  ++++M  YDP++ L  E    S+ V  V+TY +G P E A+WF  WL DA  DFR  + +L+ L++AV GLG+S Y  ++N V K +D+    LS KRL+  G  D NVV S++G +  D+Q W  KF   L    T E K  +G  C    S   K     +S     ++E+ E        +SDE+E         +VD+EDLG +M+                          K I ++   REM+T  LR +L KQGYKLIGSHSGVK+CRWTKSMLRGRGGCYKH FYGI SHRCME TPSLACANKCVFCWRHH+NPVGTEW+W MDP E I+ +A+ KH  M++QF+GVPGV+ ER+ EGL  KHCALSLVGEPIMYP IN  + LLHSR+IS+FLVTNAQFP+ I+ L PVTQLYVSVDA  KD+LKKIDRPLFKDFW RF+ SL A+ +K+QRTVYRLTLVKAWNV+E+ AYA L+ LGQP FIEVKGVTYCG+S AS LTMANVPWH+EV++FVQQLA  L  YE+A EHEHSNC+L+A +KFK++ +W TWIDYE+F +LVQ  +D      F A +YMA TPSWA +G+ E+GF+P+DTRF++  K
Sbjct:   94 VKIFYGSQTGTAKGFAKVLSEELEALGFPAEVIDMKDYDPDDRLADECVSGSVCVFLVATYTDGQPTESAEWFCKWLEDASTDFRYGRTYLKGLRYAVFGLGNSVYVGHYNTVCKNVDKWLWMLSAKRLMTRGEGDCNVVKSRHGSVQADFQAWKGKFLSRLQALATGEKKTCSGKNCKTGSSCKSKKEEEEASKETGSEVELVES-------SSDEDESGLTGEKRSVVDLEDLGNLMKNAKKAKGKNGPQRDGEVVKFSKLNGVKKIDDDGERREMITAALREALTKQGYKLIGSHSGVKLCRWTKSMLRGRGGCYKHTFYGIESHRCMETTPSLACANKCVFCWRHHTNPVGTEWRWKMDPAEKILQDALDKHQDMIRQFRGVPGVKPERYEEGLAVKHCALSLVGEPIMYPEINAFIRLLHSRRISSFLVTNAQFPEEIRSLEPVTQLYVSVDASTKDSLKKIDRPLFKDFWPRFLDSLKALGEKRQRTVYRLTLVKAWNVEEMQAYAELIALGQPDFIEVKGVTYCGESSASTLTMANVPWHQEVVAFVQQLAAMLPEYEVACEHEHSNCLLIAHEKFKLDGDWWTWIDYERFQDLVQAQQDSGGRQTFSALDYMAKTPSWALFGAREQGFDPADTRFQRRNK 734          
BLAST of S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase vs. Ensembl Medaka
Match: tyw1 (S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase [Source:NCBI gene;Acc:101161427])

HSP 1 Score: 691.034 bits (1782), Expect = 0.000e+0
Identity = 347/624 (55.61%), Postives = 436/624 (69.87%), Query Frame = 2
Query:  137 IKILYGSLTGKSKILAEKFSKECIHNNYDFKMMNMNTYDPEENLNKE---KSLLVIFVSTYENGTPPEDAKWFYNWLIDAKDDFRVDKNFLENLQFAVVGLGSSYYESNFNIVSKAIDEAFGSLSGKRLLEIGICDENVVNSKNGGLDYDYQEWSKKFWKTLTC--TSETKNSNGDVXXXXXXXXXXXXXXXXXXXXXXXIEITEENSDDEVLTSDEEEEKNMDSGNELVDMEDLGMMMRKRKDIVENKTPREMLTPMLRTSLEKQGYKLIGSHSGVKMCRWTKSMLRGRGGCYKHAFYGIASHRCMEATPSLACANKCVFCWRHHSNPVGTEWKWIMDPPEMIVDEAVAKHIQMVKQFKGVPGVQEERFLEGLKPKHCALSLVGEPIMYPRINTLVGLLHSRQISTFLVTNAQFPDAIQQLVPVTQLYVSVDAGEKDALKKIDRPLFKDFWERFVASLTAVKDKKQRTVYRLTLVKAWNVDELDAYANLVDLGQPHFIEVKGVTYCGDSKASKLTMANVPWHEEVLSFVQQLADRLENYEIAAEHEHSNCVLLAQKKFKVNDEWNTWIDYEKFHELVQTGKD------FDATEYMAPTPSWAAYGSNEKGFNPSDTRFRKLRK 1975
            +KI YGS TG +K  A+  S+E     +  ++++M  YDP++ L  E    S+ V  V+TY +G P E A+WF  WL DA  DFR  + +L+ L++AV GLG+S Y  ++N V K +D+    LS KRL+  G  D NVV S++G +  D+Q W  KF   L    T E K  +G  C    S   K     +S     ++   EE     +LT  +  +       E+V    L  +    K I ++   REM+T  LR +L KQGYKLIGSHSGVK+CRWTKSMLRGRGGCYKH FYGI SHRCME TPSLACANKCVFCWRHH+NPVGTEW+W MDP E I+ +A+ KH  M++QF+GVPGV+ ER+ EGL  KHCALSLVGEPIMYP IN  + LLHSR+IS+FLVTNAQFP+ I+ L PVTQLYVSVDA  KD+LKKIDRPLFKDFW RF+ SL A+ +K+QRTVYRLTLVKAWNV+E+ AYA L+ LGQP FIEVKGVTYCG+S AS LTMANVPWH+EV++FVQQLA  L  YE+A EHEHSNC+L+A +KFK++ +W TWIDYE+F +LVQ  +D      F A +YMA TPSWA +G+ E+GF+P+DTRF++  K
Sbjct:   79 VKIFYGSQTGTAKGFAKVLSEELEALGFPAEVIDMKDYDPDDRLADECVSGSVCVFLVATYTDGQPTESAEWFCKWLEDASTDFRYGRTYLKGLRYAVFGLGNSVYVGHYNTVCKNVDKWLWMLSAKRLMTRGEGDCNVVKSRHGSVQADFQAWKGKFLSRLQALATGEKKTCSGKNCKTGSSCKSKKEEEEASKETGSEVRRREEGV---LLTVTKLRD------GEVVKFSKLNGV----KKIDDDGERREMITAALREALTKQGYKLIGSHSGVKLCRWTKSMLRGRGGCYKHTFYGIESHRCMETTPSLACANKCVFCWRHHTNPVGTEWRWKMDPAEKILQDALDKHQDMIRQFRGVPGVKPERYEEGLAVKHCALSLVGEPIMYPEINAFIRLLHSRRISSFLVTNAQFPEEIRSLEPVTQLYVSVDASTKDSLKKIDRPLFKDFWPRFLDSLKALGEKRQRTVYRLTLVKAWNVEEMQAYAELIALGQPDFIEVKGVTYCGESSASTLTMANVPWHQEVVAFVQQLAAMLPEYEVACEHEHSNCLLIAHEKFKLDGDWWTWIDYERFQDLVQAQQDSGGRQTFSALDYMAKTPSWALFGAREQGFDPADTRFQRRNK 689          
BLAST of S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase vs. Ensembl Medaka
Match: POR (NADPH--cytochrome P450 reductase [Source:NCBI gene;Acc:101166486])

HSP 1 Score: 71.2478 bits (173), Expect = 1.697e-12
Identity = 50/167 (29.94%), Postives = 85/167 (50.90%), Query Frame = 2
Query:  137 IKILYGSLTGKSKILAEKFSKECIHNNYDFKMMNMNTYDPEE-------NLNKEKSLLVIF-VSTYENGTPPEDAKWFYNWLIDAKDDFRVDKNFLENLQFAVVGLGSSYYESNFNIVSKAIDEAFGSLSGKRLLEIGICDENVVNSKNGGLDYDYQEWSKKFWKTL 613
            I + YGS TG ++  A + SK+     Y  K M     DPEE        +++ K+ L IF ++TY  G P ++A+ FY+WL +  D+       L  L + V  LG+  YE ++N + K +D+    L  KR+ ++G+ D+      +  L+ D+  W ++FW  +
Sbjct:   74 IIVFYGSQTGTAEEFANRLSKDA--QRYGMKGM---AADPEEYTMGELARMSEIKNSLAIFCMATYGEGDPTDNAQDFYDWLQENDDE------DLSGLNYTVFALGNKTYE-HYNAMGKYVDKRLEELGAKRIFDLGLGDD------DSNLEEDFVSWREQFWPAV 222          
BLAST of S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase vs. Ensembl Medaka
Match: mtrr (5-methyltetrahydrofolate-homocysteine methyltransferase reductase [Source:NCBI gene;Acc:101167253])

HSP 1 Score: 59.3066 bits (142), Expect = 1.025e-8
Identity = 44/166 (26.51%), Postives = 79/166 (47.59%), Query Frame = 2
Query:  128 KNTIKILYGSLTGKSKILAEKFSKECIHNNYDFKMMNMNTYDPEENLNKEKSLLVIFVSTYENGTPPEDAKWFYNWLIDAKDDFRVDKN----FLENLQFAVVGLGSSYYESNFNIVSKAIDEAFGSLSGKRLLEIGICDENVVNSKNGGLDYDYQEWSKKFWKTL 613
            K+   +LYGS  G+++ +AE  ++E   +    ++  +N  D + NL KE + +V  VST  +G PP++A  F           R++KN      ++L + ++ LG + Y +NF    K I+    +L  ++    G  D+ V      GL+     W +  WK +
Sbjct:    6 KSRFVVLYGSQKGQAQSIAEGIAEEAEDHGLVAELSCLNQ-DEKYNLEKEIAPVVFVVSTTGDGEPPDNALQFVK---------RINKNQSPDHYKHLSYTLLALGDTNY-ANFCNCGKTIERRLQALGARQFYPAGFADDGV------GLELVVDPWLEGLWKAV 154          
BLAST of S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase vs. Ensembl Medaka
Match: mtrr (5-methyltetrahydrofolate-homocysteine methyltransferase reductase [Source:NCBI gene;Acc:101167253])

HSP 1 Score: 58.9214 bits (141), Expect = 1.522e-8
Identity = 44/166 (26.51%), Postives = 79/166 (47.59%), Query Frame = 2
Query:  128 KNTIKILYGSLTGKSKILAEKFSKECIHNNYDFKMMNMNTYDPEENLNKEKSLLVIFVSTYENGTPPEDAKWFYNWLIDAKDDFRVDKN----FLENLQFAVVGLGSSYYESNFNIVSKAIDEAFGSLSGKRLLEIGICDENVVNSKNGGLDYDYQEWSKKFWKTL 613
            K+   +LYGS  G+++ +AE  ++E   +    ++  +N  D + NL KE + +V  VST  +G PP++A  F           R++KN      ++L + ++ LG + Y +NF    K I+    +L  ++    G  D+ V      GL+     W +  WK +
Sbjct:   34 KSRFVVLYGSQKGQAQSIAEGIAEEAEDHGLVAELSCLNQ-DEKYNLEKEIAPVVFVVSTTGDGEPPDNALQFVK---------RINKNQSPDHYKHLSYTLLALGDTNY-ANFCNCGKTIERRLQALGARQFYPAGFADDGV------GLELVVDPWLEGLWKAV 182          
BLAST of S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase vs. Planmine SMEST
Match: SMESG000054804.1 (SMESG000054804.1)

HSP 1 Score: 1253.81 bits (3243), Expect = 0.000e+0
Identity = 625/628 (99.52%), Postives = 627/628 (99.84%), Query Frame = 2
Query:   98 KFKTETNINEKNTIKILYGSLTGKSKILAEKFSKECIHNNYDFKMMNMNTYDPEENLNKEKSLLVIFVSTYENGTPPEDAKWFYNWLIDAKDDFRVDKNFLENLQFAVVGLGSSYYESNFNIVSKAIDEAFGSLSGKRLLEIGICDENVVNSKNGGLDYDYQEWSKKFWKTLTCTSETKNSNGDVXXXXXXXXXXXXXXXXXXXXXXXIEITEENSDDEVLTSDEEEEKNMDSGNELVDMEDLGMMMRKRKDIVENKTPREMLTPMLRTSLEKQGYKLIGSHSGVKMCRWTKSMLRGRGGCYKHAFYGIASHRCMEATPSLACANKCVFCWRHHSNPVGTEWKWIMDPPEMIVDEAVAKHIQMVKQFKGVPGVQEERFLEGLKPKHCALSLVGEPIMYPRINTLVGLLHSRQISTFLVTNAQFPDAIQQLVPVTQLYVSVDAGEKDALKKIDRPLFKDFWERFVASLTAVKDKKQRTVYRLTLVKAWNVDELDAYANLVDLGQPHFIEVKGVTYCGDSKASKLTMANVPWHEEVLSFVQQLADRLENYEIAAEHEHSNCVLLAQKKFKVNDEWNTWIDYEKFHELVQTGKDFDATEYMAPTPSWAAYGSNEKGFNPSDTRFRKLRKHI 1981
            KFKTETNINEKNTIKILYGSLTGKSKILAEKFSKECIHNNYDFKMMNMNTYDPEENLNKEKSLLVIFVSTYENGTPPEDAKWFYNWLIDAKDDFRVDKNFLENLQFAVVGLGSSYYESNFN+VSKAIDEAF SLSGKRLLEIGICDENVVNSKNGGLDYDYQEWSKKFWKTLTCTSETKNSNGDVCDNKKSSCCKTNNSNSSCCKNEKIEITEENSDDEVLTSDEEEEKNMDSGNELVDMEDLGMMMRKRKDIVENKTPREMLTPMLRTSLEKQGYKLIGSHSGVKMCRWTKSMLRGRGGCYKHAFYGIASHRCMEATPSLACANKCVFCWRHHSNPVGTEWKWIMDPPEMIVDEAVAKHIQMVKQFKGVPGVQEERFLEGLKPKHCALSLVGEPIMYPRINTLVGLLHSRQISTFLVTNAQFPDAIQQLVPVTQLYVSVDAGEKDALKKIDRPLFKDFWERFVASLTAVKDKKQRTVYRLTLVKAWNVDELDAYANLVDLGQPHFIE+KGVTYCGDSKASKLTMANVPWHEEVLSFVQQLADRLENYEIAAEHEHSNCVLLAQKKFKVNDEWNTWIDYEKFHELVQTGKDFDATEYMAPTPSWAAYGSNEKGFNPSDTRFRKLRKHI
Sbjct:   10 KFKTETNINEKNTIKILYGSLTGKSKILAEKFSKECIHNNYDFKMMNMNTYDPEENLNKEKSLLVIFVSTYENGTPPEDAKWFYNWLIDAKDDFRVDKNFLENLQFAVVGLGSSYYESNFNVVSKAIDEAFWSLSGKRLLEIGICDENVVNSKNGGLDYDYQEWSKKFWKTLTCTSETKNSNGDVCDNKKSSCCKTNNSNSSCCKNEKIEITEENSDDEVLTSDEEEEKNMDSGNELVDMEDLGMMMRKRKDIVENKTPREMLTPMLRTSLEKQGYKLIGSHSGVKMCRWTKSMLRGRGGCYKHAFYGIASHRCMEATPSLACANKCVFCWRHHSNPVGTEWKWIMDPPEMIVDEAVAKHIQMVKQFKGVPGVQEERFLEGLKPKHCALSLVGEPIMYPRINTLVGLLHSRQISTFLVTNAQFPDAIQQLVPVTQLYVSVDAGEKDALKKIDRPLFKDFWERFVASLTAVKDKKQRTVYRLTLVKAWNVDELDAYANLVDLGQPHFIEIKGVTYCGDSKASKLTMANVPWHEEVLSFVQQLADRLENYEIAAEHEHSNCVLLAQKKFKVNDEWNTWIDYEKFHELVQTGKDFDATEYMAPTPSWAAYGSNEKGFNPSDTRFRKLRKHI 637          
BLAST of S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase vs. Planmine SMEST
Match: SMESG000022047.1 (SMESG000022047.1)

HSP 1 Score: 72.0182 bits (175), Expect = 7.671e-13
Identity = 51/167 (30.54%), Postives = 81/167 (48.50%), Query Frame = 2
Query:  137 IKILYGSLTGKSKILAEKFSKECIHNNYDFKMMNMNTYDPEE-------NLNK-EKSLLVIFVSTYENGTPPEDAKWFYNWLIDAKDDFRVDKNFLENLQFAVVGLGSSYYESNFNIVSKAIDEAFGSLSGKRLLEIGICDENVVNSKNGGLDYDYQEWSKKFWKTL 613
            + + YGS TG ++  A + +KE +   Y  K M     DPEE       NL   E SL +  ++TY  G P ++A+ FYNWL +A  +       +  L++ V GLG+  YE NFN + K  D     L   R+ E+GI D+      +  ++  +  W +  W ++
Sbjct:   92 VVVFYGSQTGTAEDFANRLAKEAVR--YGLKGM---AADPEECDMEELLNLKSIENSLAIFCMATYGEGDPTDNAQEFYNWLQNATVN-------MNGLRYTVFGLGNKTYE-NFNAMGKYFDRRLSELGATRIHELGIGDD------DSNIEDHFITWKEDMWTSV 239          
BLAST of S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase vs. Planmine SMEST
Match: SMESG000056879.1 (SMESG000056879.1)

HSP 1 Score: 60.077 bits (144), Expect = 4.211e-9
Identity = 49/162 (30.25%), Postives = 75/162 (46.30%), Query Frame = 2
Query:  137 IKILYGSLTGKSKILAEK---FSKECIHNNYDFKMMNMNTYDPEENLNKEKSLLVIFVSTYENGTPPEDAKWFYNWLIDAKDDFRVDKNFLENLQFAVVGLGSSYYESNFNIVSKAIDEAFGSLSGKRLLEIGICDENVVNSKNGGLDYDYQEWSKKFWKTL 613
            +KI YGS TG ++ +AEK   FS+         K+  MN  D   +   +  + +   ST   G PP++ K F  W    K  F  +   L  L FAV GLG S Y + +N ++K +      L    ++ IG+ D+      + G+D ++  W K  WK L
Sbjct:    4 LKIFYGSQTGNAQDVAEKVYRFSQNLPPKYASVKIGEMN--DVAFDSLSQNDIFIFICSTTGQGDPPDNMKHF--WQCVMKRSFNPN---LSCLDFAVFGLGDSKY-NKYNFIAKKLYRRLIQLKANSMINIGLADD----QHSLGIDGEFSLWIKLLWKVL 153          
The following BLAST results are available for this feature:
BLAST of S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TYW10.000e+053.48tRNA-yW synthesizing protein 1 homolog [Source:HGN... [more]
TYW10.000e+050.16tRNA-yW synthesizing protein 1 homolog [Source:HGN... [more]
TYW1B0.000e+047.97tRNA-yW synthesizing protein 1 homolog B [Source:H... [more]
TYW1B2.288e-13458.92tRNA-yW synthesizing protein 1 homolog B [Source:H... [more]
TYW11.391e-2932.53tRNA-yW synthesizing protein 1 homolog [Source:HGN... [more]
back to top
BLAST of S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
emb-89.856e-1129.09NADPH--cytochrome P450 reductase [Source:UniProtK... [more]
emb-89.856e-1129.09NADPH--cytochrome P450 reductase [Source:UniProtK... [more]
mtrr-11.019e-926.38Methionine synthase reductase [Source:UniProtKB/S... [more]
mtrr-11.019e-926.38Methionine synthase reductase [Source:UniProtKB/S... [more]
fre-16.353e-926.06NADPH-dependent diflavin oxidoreductase 1 [Source... [more]
back to top
BLAST of S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cpr8.042e-1228.22gene:FBgn0015623 transcript:FBtr0331224[more]
Cpr8.042e-1228.22gene:FBgn0015623 transcript:FBtr0331223[more]
Cpr8.042e-1228.22gene:FBgn0015623 transcript:FBtr0079250[more]
CG136675.465e-1027.65gene:FBgn0035890 transcript:FBtr0076611[more]
CG136675.465e-1027.65gene:FBgn0035890 transcript:FBtr0076610[more]
back to top
BLAST of S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tyw10.000e+054.80tRNA-yW synthesizing protein 1 homolog (S. cerevis... [more]
pora9.855e-1632.14P450 (cytochrome) oxidoreductase a [Source:ZFIN;Ac... [more]
porb8.664e-1429.94P450 (cytochrome) oxidoreductase b [Source:ZFIN;Ac... [more]
ndor14.129e-1232.12NADPH dependent diflavin oxidoreductase 1 [Source:... [more]
ndor14.129e-1232.12NADPH dependent diflavin oxidoreductase 1 [Source:... [more]
back to top
BLAST of S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
large20.000e+053.95LARGE xylosyl- and glucuronyltransferase 2 [Source... [more]
large20.000e+053.95LARGE xylosyl- and glucuronyltransferase 2 [Source... [more]
large20.000e+053.99LARGE xylosyl- and glucuronyltransferase 2 [Source... [more]
large20.000e+054.09LARGE xylosyl- and glucuronyltransferase 2 [Source... [more]
large20.000e+053.05LARGE xylosyl- and glucuronyltransferase 2 [Source... [more]
back to top
BLAST of S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tyw10.000e+052.46tRNA-yW synthesizing protein 1 homolog (S. cerevis... [more]
Tyw11.590e-4233.87tRNA-yW synthesizing protein 1 homolog (S. cerevis... [more]
Tyw17.509e-3138.61tRNA-yW synthesizing protein 1 homolog (S. cerevis... [more]
Tyw17.432e-3038.61tRNA-yW synthesizing protein 1 homolog (S. cerevis... [more]
Por6.659e-1732.34P450 (cytochrome) oxidoreductase [Source:MGI Symbo... [more]
back to top
BLAST of S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q2KHP8|TYW1_XENLA0.000e+055.11S-adenosyl-L-methionine-dependent tRNA 4-demethylw... [more]
sp|Q08C92|TYW1_DANRE0.000e+054.80S-adenosyl-L-methionine-dependent tRNA 4-demethylw... [more]
sp|Q5REF9|TYW1_PONAB0.000e+053.63S-adenosyl-L-methionine-dependent tRNA 4-demethylw... [more]
sp|Q9NV66|TYW1_HUMAN0.000e+053.48S-adenosyl-L-methionine-dependent tRNA 4-demethylw... [more]
sp|Q8BJM7|TYW1_MOUSE0.000e+052.46S-adenosyl-L-methionine-dependent tRNA 4-demethylw... [more]
back to top
BLAST of S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3KHL10.000e+053.42S-adenosyl-L-methionine-dependent tRNA 4-demethylw... [more]
A0A1S3H4E90.000e+054.05S-adenosyl-L-methionine-dependent tRNA 4-demethylw... [more]
A0A2T7PHN40.000e+055.54Flavodoxin-like domain-containing protein OS=Pomac... [more]
A0A0L8FXJ30.000e+057.03Flavodoxin-like domain-containing protein OS=Octop... [more]
V4CQI90.000e+055.42Flavodoxin-like domain-containing protein OS=Lotti... [more]
back to top
BLAST of S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tyw10.000e+054.18S-adenosyl-L-methionine-dependent tRNA 4-demethylw... [more]
tyw10.000e+054.26S-adenosyl-L-methionine-dependent tRNA 4-demethylw... [more]
porb9.172e-1430.54NADPH--cytochrome P450 reductase-like [Source:NCBI... [more]
pora8.321e-1228.82NADPH--cytochrome P450 reductase [Source:NCBI gene... [more]
mtrr1.882e-927.395-methyltetrahydrofolate-homocysteine methyltransf... [more]
back to top
BLAST of S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000008170.19.548e-2928.81pep scaffold:Pmarinus_7.0:GL479645:6967:26481:1 ge... [more]
ENSPMAT00000008175.19.969e-1530.77pep scaffold:Pmarinus_7.0:GL479645:6967:26481:1 ge... [more]
porb8.170e-930.09P450 (cytochrome) oxidoreductase b [Source:ZFIN;Ac... [more]
back to top
BLAST of S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
TYW11.472e-15041.82Iron-sulfer protein required for synthesis of Wybu... [more]
NCP13.190e-1131.52NADP-cytochrome P450 reductase; involved in ergost... [more]
MET56.904e-727.38Sulfite reductase beta subunit; involved in amino ... [more]
back to top
BLAST of S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO446020.000e+056.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO289922.066e-1630.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO394342.466e-1530.54NADPH--cytochrome P450 reductase [Source:UniProtK... [more]
EDO402461.169e-1028.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO394402.589e-828.57Nitric oxide synthase [Source:UniProtKB/TrEMBL;Ac... [more]
back to top
BLAST of S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tyw10.000e+054.48S-adenosyl-L-methionine-dependent tRNA 4-demethylw... [more]
tyw10.000e+055.61S-adenosyl-L-methionine-dependent tRNA 4-demethylw... [more]
POR1.697e-1229.94NADPH--cytochrome P450 reductase [Source:NCBI gene... [more]
mtrr1.025e-826.515-methyltetrahydrofolate-homocysteine methyltransf... [more]
mtrr1.522e-826.515-methyltetrahydrofolate-homocysteine methyltransf... [more]
back to top
BLAST of S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000054804.10.000e+099.52SMESG000054804.1[more]
SMESG000022047.17.671e-1330.54SMESG000022047.1[more]
SMESG000056879.14.211e-930.25SMESG000056879.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024454 ID=SMED30024454|Name=S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase|organism=Schmidtea mediterranea sexual|type=transcript|length=2024bp
ATTTAAAACTTTTTTTTTAAAGTAAAGCATGTTTGAGGTTTTAGCCCTAA
GCTTGATTTTACCTATTATTTTGTATTATTTTATAATCCATTTTTTAAAG
TTCAAAACTGAAACAAATATTAATGAAAAAAATACAATAAAGATCCTTTA
TGGTAGTTTAACTGGAAAATCAAAAATTCTTGCTGAGAAATTTTCCAAAG
AATGTATTCATAATAATTATGATTTTAAAATGATGAACATGAACACTTAT
GATCCAGAAGAAAATTTGAATAAAGAAAAATCTTTACTTGTTATTTTTGT
TTCTACATATGAAAATGGTACTCCACCTGAAGATGCAAAGTGGTTTTATA
ATTGGTTAATTGATGCTAAAGATGATTTCCGAGTTGATAAAAATTTCCTT
GAAAATCTTCAATTTGCTGTAGTTGGATTGGGTAGTTCGTATTATGAATC
AAACTTTAACATAGTGTCTAAAGCAATCGATGAAGCTTTTGGGTCATTAT
CGGGAAAAAGATTACTAGAAATAGGCATATGCGATGAAAATGTAGTTAAT
AGCAAAAATGGGGGATTAGATTATGATTATCAAGAGTGGTCAAAAAAGTT
TTGGAAGACTTTGACATGTACTTCAGAGACAAAAAATTCAAACGGAGATG
TATGTGATAACAAAAAATCTTCATGTTGTAAAACTAATAATTCTAATTCT
TCATGCTGTAAAAACGAGAAAATCGAAATAACCGAAGAAAATTCAGATGA
TGAAGTGTTAACCTCAGATGAAGAGGAAGAAAAAAATATGGATTCCGGAA
ATGAATTGGTAGATATGGAAGACCTTGGAATGATGATGAGAAAACGAAAA
GATATCGTAGAAAATAAAACTCCAAGAGAAATGTTAACTCCAATGCTAAG
AACATCTTTAGAAAAACAGGGCTATAAACTGATTGGGTCTCATAGTGGAG
TCAAAATGTGCCGTTGGACTAAGTCTATGTTAAGAGGTCGTGGAGGATGT
TATAAGCACGCCTTTTACGGAATCGCTAGTCATAGATGTATGGAAGCTAC
CCCAAGTTTAGCTTGTGCTAACAAATGCGTATTCTGTTGGCGACATCATT
CGAATCCAGTAGGCACTGAATGGAAATGGATTATGGATCCACCAGAAATG
ATTGTCGACGAAGCAGTTGCAAAACACATTCAGATGGTGAAACAATTTAA
AGGAGTTCCAGGTGTTCAAGAGGAGAGATTTCTAGAAGGTCTGAAACCAA
AACACTGTGCTTTATCACTGGTTGGTGAGCCAATTATGTATCCACGAATC
AATACCCTCGTTGGTTTGCTTCATTCTCGACAGATTTCCACTTTCCTCGT
GACAAACGCCCAGTTCCCTGATGCGATTCAGCAATTAGTTCCTGTTACTC
AACTCTATGTTAGTGTCGACGCTGGTGAAAAAGACGCTTTGAAAAAAATC
GATAGACCACTTTTTAAAGATTTCTGGGAGAGATTTGTTGCCAGTTTAAC
AGCTGTCAAAGACAAAAAGCAAAGAACAGTTTATCGATTAACTCTAGTTA
AAGCATGGAATGTCGATGAATTGGATGCTTACGCTAATCTAGTGGATCTT
GGTCAACCGCATTTTATCGAGGTTAAAGGAGTCACATATTGTGGGGATTC
AAAAGCCAGCAAATTGACTATGGCTAATGTGCCATGGCATGAGGAAGTTT
TGAGTTTTGTGCAACAGCTCGCTGATCGATTGGAAAATTACGAAATTGCA
GCTGAACATGAGCATTCGAATTGTGTTTTGCTTGCACAGAAAAAGTTCAA
GGTTAATGACGAATGGAATACTTGGATTGATTATGAAAAATTCCATGAGT
TGGTTCAAACTGGAAAGGATTTCGATGCTACAGAATATATGGCTCCCACT
CCAAGTTGGGCGGCATACGGATCAAATGAAAAAGGATTCAATCCTTCTGA
TACCCGTTTCAGGAAACTGAGAAAGCATATTTAACTCTATTTTAATATAT
GGGTCTTTAAATTTTATTTTCGAG
back to top

protein sequence of SMED30024454-orf-1

>SMED30024454-orf-1 ID=SMED30024454-orf-1|Name=SMED30024454-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=652bp
MFEVLALSLILPIILYYFIIHFLKFKTETNINEKNTIKILYGSLTGKSKI
LAEKFSKECIHNNYDFKMMNMNTYDPEENLNKEKSLLVIFVSTYENGTPP
EDAKWFYNWLIDAKDDFRVDKNFLENLQFAVVGLGSSYYESNFNIVSKAI
DEAFGSLSGKRLLEIGICDENVVNSKNGGLDYDYQEWSKKFWKTLTCTSE
TKNSNGDVCDNKKSSCCKTNNSNSSCCKNEKIEITEENSDDEVLTSDEEE
EKNMDSGNELVDMEDLGMMMRKRKDIVENKTPREMLTPMLRTSLEKQGYK
LIGSHSGVKMCRWTKSMLRGRGGCYKHAFYGIASHRCMEATPSLACANKC
VFCWRHHSNPVGTEWKWIMDPPEMIVDEAVAKHIQMVKQFKGVPGVQEER
FLEGLKPKHCALSLVGEPIMYPRINTLVGLLHSRQISTFLVTNAQFPDAI
QQLVPVTQLYVSVDAGEKDALKKIDRPLFKDFWERFVASLTAVKDKKQRT
VYRLTLVKAWNVDELDAYANLVDLGQPHFIEVKGVTYCGDSKASKLTMAN
VPWHEEVLSFVQQLADRLENYEIAAEHEHSNCVLLAQKKFKVNDEWNTWI
DYEKFHELVQTGKDFDATEYMAPTPSWAAYGSNEKGFNPSDTRFRKLRKH
I*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR023993TYW1_archaea
IPR034556tRNA_wybutosine-synthase
IPR008254Flavodoxin/NO_synth
IPR029039Flavoprotein-like_sf
IPR013785Aldolase_TIM
IPR007197rSAM
IPR001094Flavdoxin-like
IPR013917tRNA_wybutosine-synth
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
GO:0008033tRNA processing
Vocabulary: molecular function
TermDefinition
GO:0010181FMN binding
GO:0003824catalytic activity
GO:0051536iron-sulfur cluster binding
GO:0000166nucleotide binding
GO:0016829lyase activity
GO:0046872metal ion binding
GO:00515394 iron, 4 sulfur cluster binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 561..581
NoneNo IPR availableSFLDSFLDG01071tRNA_wybutosine-synthesizingcoord: 280..589
e-value: 0.0
score: 488.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 237..255
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 237..256
NoneNo IPR availablePANTHERPTHR13930:SF0S-ADENOSYL-L-METHIONINE-DEPENDENT TRNA 4-DEMETHYLWYOSINE SYNTHASEcoord: 30..650
NoneNo IPR availablePANTHERPTHR13930RSAFD1-RELATEDcoord: 30..650
NoneNo IPR availableCDDcd01335Radical_SAMcoord: 342..534
e-value: 7.488E-7
score: 48.0986
NoneNo IPR availableSUPERFAMILYSSF102114Radical SAM enzymescoord: 343..522
NoneNo IPR availableTMHMMTMhelixcoord: 5..22
IPR001094Flavodoxin-likePRINTSPR00369FLAVODOXINcoord: 126..136
score: 51.42
coord: 38..51
score: 38.39
coord: 151..170
score: 29.06
coord: 88..99
score: 37.63
IPR013917tRNA wybutosine-synthesisPFAMPF08608Wyosine_formcoord: 525..587
e-value: 2.7E-29
score: 101.3
IPR008254Flavodoxin/nitric oxide synthasePFAMPF00258Flavodoxin_1coord: 39..171
e-value: 1.3E-21
score: 77.4
IPR008254Flavodoxin/nitric oxide synthasePROSITEPS50902FLAVODOXIN_LIKEcoord: 37..192
score: 25.118
IPR013785Aldolase-type TIM barrelGENE3DG3DSA:3.20.20.70coord: 268..599
e-value: 6.1E-153
score: 511.0
IPR029039Flavoprotein-like superfamilyGENE3DG3DSA:3.40.50.360coord: 19..208
e-value: 4.0E-42
score: 145.7
IPR029039Flavoprotein-like superfamilySUPERFAMILYSSF52218Flavoproteinscoord: 36..195
IPR007197Radical SAMPFAMPF04055Radical_SAMcoord: 342..522
e-value: 2.0E-22
score: 80.4
IPR023993S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase, archaeaTIGRFAMTIGR03972TIGR03972coord: 292..585
e-value: 7.5E-96
score: 318.7
IPR034556S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthaseSFLDSFLDF00284tRNA_wybutosine-synthesizingcoord: 280..589
e-value: 0.0
score: 488.1