Serine/threonine kinase

Overview
NameSerine/threonine kinase
Smed IDSMED30024442
Length (bp)5530
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Serine/threonine kinase (SMED30024442) t-SNE clustered cells

Violin plots show distribution of expression levels for Serine/threonine kinase (SMED30024442) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Serine/threonine kinase (SMED30024442) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Serine/threonine kinase (SMED30024442) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024442

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30024442h1SMcG0009644 Contig5077GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30024442h1SMcG0009180 Contig5077GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
Smed sexual biotypeSMED30024442h1SMcG0009180 Contig37802newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30024442h1SMcG0009180 Contig37802uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
protonephridiaSMED30024442h1SMcG0009180 dd_Smed_v4_2586_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30024442h1SMcG0009180 dd_Smed_v4_2586_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30024442h1SMcG0009180 dd_Smed_v4_2586_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30024442h1SMcG0009180 dd_Smed_v4_2586_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30024442h1SMcG0009180 dd_Smed_v4_2586_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30024442h1SMcG0009180 dd_Smed_v4_2586_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30024442h1SMcG0009180 dd_Smed_v4_2586_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Serine/threonine kinase vs. Ensembl Human
Match: CDC42BPA (CDC42 binding protein kinase alpha [Source:HGNC Symbol;Acc:HGNC:1737])

HSP 1 Score: 675.241 bits (1741), Expect = 0.000e+0
Identity = 501/1606 (31.20%), Postives = 803/1606 (50.00%), Query Frame = 2
Query:   32 MSIKLTLKQRHENLIKEFLLNYKSSV-PDSVTLEFLIDSLFCTYYECRLPFHKDEKNVAQFIKSIKGTVDKIESLRIRRSDFDTIRVIGRGAFGKVSVVRFKEKGEIYAMKSLHKYDILKKIDAACFQEERDVLFQAMKIKSPWITRLHYAFQDEFYLYFVMDFYNGGDMLTLLSKFNDRLPEEITKFYIAEVVMSIDVVHKLGYLHRDIKPDNLLLDSLGHIVLADFGSCVKLRPNGTTITERAVGTPDYISPEILRSAE-GHGPYGVECDWWSLGIVIHEMLYGELPFYNEDFSETYWQIMNFETCFQIPTEYDDVSDEAEDLIKQLICKKECRLGNKGIDDFKNHPFFREIDWDNLRSYNAPFIPEVSSAEDTSNFEFDD---FNANHEGPPLSSNFKGCHLPCIGFTFTKDFIFNEMGSEESSVRLKSLMENIGAPALLNGNHNESNSDALLEEVNQLKITCSQLEKQLNECRTNSVQRIFSHPVYQQLVTDKEKLLTQCQNYDYSLREKEQKMDDLIETNRLLNKERDELTSDRLQILQKKQDIEEDLKVMTENFNQLKSTNKAINRXXXXXXXXXXXXXXXXXXXXXXXXHLSIQKNQSQPDIQVEKQRFEEVMLQLRSENDQMLEKMRLKCSNLTNSLEQSDQTIFNIKEEIKSLKEIFTNKEKNLKLS-HDNEIEQLKISV-------AEEQSR----------ILASNTQLKSQVKSLSEENVELRSSLQEISN--KNMKFHFRLKTILDKEIVKTSENSELLTELDREV-ELLKTLCVDNDG-----------DQKAQGERQDNNGNES----WRLRKCVKADKIEISNLNLTLQSERRARADLEKKLTQQK---------------------SEICDISKQLEKYKQD-----VNEKDNLIANLKSASQNLEPHVPKEIPSNPVTLSEFNSILSGSLDKTVVNCNQ--HVFSHSTFNRPIKCDYCTSHMLGQYYQGVKCKECSFSCHHYCLSNVLNDKCYTRKSAGKGA---NLKNGIGTMYENFIKVPKPGGIRRGWKRQFMALCDLKLFFFDVKEGSTGTQMPDISRNPCRVIDLKYTEFKVVKVSRDEVMHAPKKDVEFIIKIS---IENSSTMLPIYVLFESVDNKEDCIKVIEEARSYIKKDPHY-RMIFTEKSCLNNLDISMNYRQILSAAIIDQSTLLFGTEEGL--LKVTDSGYNKIGEKKPVYIIESLDQQELQLVAVIQSKQRVLKLLLSGILDGAHDWEPIIVENGKSCTTFVVGKSYVSPGNQFAPYADTMLANSTFHIKSPSNDRIWIMCAAFKNSVEVYHLNLKLTRHEKLRQILCNTSVTSLQIAGHGEQLLIGMHDSVAIYSLWETGSPXXXXXXXXXXXXXNFQYIFQTNFESMLIVEISFNEYLILFECAGIFINRNHRQTR-PDLQWPDKPTRFTYRAPYLLCFTEMAGLFAYEITEHSCNLVQALPLRSSKPLDRSGHILTTANEFIQAIDLIYVHLVSANEEKISIGKTIDKTSSSNTLSIFKFLNKRKPSYNKQEDSFDTNDAISPNPAGNSTKSTGLKYRDKPTLKSNRQISVPQNFRHLSHMGPDVPCQLI 4612
            MS ++ L+Q     +++F+L+  +       ++E L+D L C Y EC     + EKN+ ++++  K    K++ +R+ R DF+ ++VIGRGAFG+V+VV+ K   +++AMK L+K+++LK+ + ACF+EERDVL       + WIT LHYAFQD+  LY VMD+Y GGD+LTLLSKF DRLPE++ +FY+AE+V++ID VH+L Y+HRDIKPDN+L+D  GHI LADFGSC+KL  +GT  +  AVGTPDYISPEIL++ E G G YG ECDWWSLG+ ++EMLYGE PFY E   ETY +IMN +  FQ P +  DVS+ A+DLI++LIC +E RLG  GI+DFK HPFF  IDWDN+R+  AP+IPEVSS  DTSNF+ DD    N+    PP  + F G HLP +GFT+T   + ++      +    SL  ++     L+ N      +  ++ + Q K+   +L ++L E  T +VQ +    V   L   K+  +   +     LR++  +   L +     N  R EL     QI   ++ I+  L+   E+ N+L+   +A+                +  K +E+ +H S Q       ++ ++  +   +  +  E+ Q + K++         LE+  ++IF  +EE+   + I  N+ KNLK   HD+E +QL ++          E++R                Q + +   L+EEN +L S L +++   +N+  H      L++E+   ++  E +   + ++ E+++ +  + D             ++ +  R  + G  +    W++R+  K D      L   L +E RA+  ++++L + K                     SEI  + K  E+ + +      + + + +A L + +  L+    + + S P+++        G    T     +  H F   +F  P KC  CTS M+G   QG  C+ C FSCH  C+ N     C       KG    + + GIGT YE  +++PKP G+++GW+R    +CD KLF +D+ EG        IS    +VID++  EF V  V   +V+HA +KD+  I +++   +  S+    I +L ++ + K   + V+ E    +KK+    R ++  K   ++    +   Q  +AAIID   +  G EEGL  + VT     ++G+ K ++ IE +     QLVAVI  + R ++L     LDG  + +   +   K C T   GK                            +  +  +C A K  V  Y L    TRH K ++I    +V  + I    EQL +G       Y L   G+P    +  L   D    +I     +++  VEIS  EYL+ F   GI+ +   R++R  +L WP  P+   Y APYL  ++E A +  +++  +S   +Q LPL+  +PL+  G +       ++ I LIY     A  +++ + +T D +      +I    NKR+ S+                P     +      RD P ++ N+ IS P NF H++HMGP    Q++
Sbjct:    1 MSGEVRLRQ-----LEQFILDGPAQTNGQCFSVETLLDILICLYDECNNSPLRREKNILEYLEWAKPFTSKVKQMRLHREDFEILKVIGRGAFGEVAVVKLKNADKVFAMKILNKWEMLKRAETACFREERDVLVNG---DNKWITTLHYAFQDDNNLYLVMDYYVGGDLLTLLSKFEDRLPEDMARFYLAEMVIAIDSVHQLHYVHRDIKPDNILMDMNGHIRLADFGSCLKLMEDGTVQSSVAVGTPDYISPEILQAMEDGKGRYGPECDWWSLGVCMYEMLYGETPFYAESLVETYGKIMNHKERFQFPAQVTDVSENAKDLIRRLICSREHRLGQNGIEDFKKHPFFSGIDWDNIRNCEAPYIPEVSSPTDTSNFDVDDDCLKNSETMPPPTHTAFSGHHLPFVGFTYTSSCVLSDRSCLRVTAGPTSLDLDVNVQRTLDNNLATEAYERRIKRLEQEKL---ELSRKLQES-TQTVQALQYSTVDGPLTASKDLEIKNLKEEIEKLRKQVTESSHLEQQLEEANAVRQELDDAFRQIKAYEKQIK-TLQQEREDLNKLEVHTEAL-----------AAEASKDRKLREQSEHYSKQLENELEGLKQKQISYSPGVCSI--EHQQEITKLK-------TDLEK--KSIF-YEEELSKREGIHANEIKNLKKELHDSEGQQLALNKEIMILKDKLEKTRRESQSEREEFESEFKQQYEREKVLLTEENKKLTSELDKLTTLYENLSIH---NQQLEEEVKDLADKKESVAHWEAQITEIIQWVSDEKDARGYLQALASKMTEELEALRNSSLGTRATDMPWKMRRFAKLDMSARLELQSALDAEIRAKQAIQEELNKVKASNIITECKLKDSEKKNLELLSEIEQLIKDTEELRSEKGIEHQDSQHSFLAFLNTPTDALDQF--ETVDSTPLSVHTPTLRKKGCPGSTGFPPKRKTHQFFVKSFTTPTKCHQCTSLMVGLIRQGCSCEVCGFSCHITCV-NKAPTTCPVPPEQTKGPLGIDPQKGIGTAYEGHVRIPKPAGVKKGWQRALAIVCDFKLFLYDIAEGKASQPSVVIS----QVIDMRDEEFSVSSVLASDVIHASRKDIPCIFRVTASQLSASNNKCSILMLADTENEKNKWVGVLSELHKILKKNKFRDRSVYVPKEAYDSTLPLIKTTQ--AAAIIDHERIALGNEEGLFVVHVTKDEIIRVGDNKKIHQIELIPND--QLVAVISGRNRHVRLFPMSALDG-RETDFYKLSETKGCQTVTSGKV--------------------------RHGALTCLCVAMKRQVLCYELFQSKTRHRKFKEIQVPYNVQWMAI--FSEQLCVGFQSGFLRYPLNGEGNP----YSMLHSNDHTLSFIAHQPMDAICAVEISSKEYLLCFNSIGIYTDCQGRRSRQQELMWPANPSSCCYNAPYLSVYSENA-VDIFDV--NSMEWIQTLPLKKVRPLNNEGSLNLLG---LETIRLIYFKNKMAEGDELVVPETSDNSRKQMVRNIN---NKRRYSFRV--------------PEEERMQQRREMLRD-PEMR-NKLISNPTNFNHIAHMGPGDGIQIL 1498          
BLAST of Serine/threonine kinase vs. Ensembl Human
Match: CDC42BPB (CDC42 binding protein kinase beta [Source:HGNC Symbol;Acc:HGNC:1738])

HSP 1 Score: 629.017 bits (1621), Expect = 0.000e+0
Identity = 502/1703 (29.48%), Postives = 823/1703 (48.33%), Query Frame = 2
Query:   32 MSIKLTLKQRHENLIKEFLLNYKSSVPDSVTLEFLIDSLFCTYYECRLPFHKDEKNVAQFIKSIKGTVDKIESLRIRRSDFDTIRVIGRGAFGKVSVVRFKEKGEIYAMKSLHKYDILKKIDAACFQEERDVLFQAMKIKSPWITRLHYAFQDEFYLYFVMDFYNGGDMLTLLSKFNDRLPEEITKFYIAEVVMSIDVVHKLGYLHRDIKPDNLLLDSLGHIVLADFGSCVKLRPNGTTITERAVGTPDYISPEILRSAE-GHGPYGVECDWWSLGIVIHEMLYGELPFYNEDFSETYWQIMNFETCFQIPTEYDDVSDEAEDLIKQLICKKECRLGNKGIDDFKNHPFFREIDWDNLRSYNAPFIPEVSSAEDTSNFEFDD--FNANHEGPPLS-SNFKGCHLPCIGFTFTKDFIFNEMGSEES-------------------SVRLKSLMENI-------------------------GAPALLNGNHNESNSDALLEEVNQLK---ITCSQLEKQLNEC------RTNSVQRIFS----HPVYQQLVTDKEKLLTQCQNYDYSLREKEQKMDDLIETNRL-------LNKERDELTSDRLQILQKKQDIEEDLKVMTENFNQLKSTNKAINRXXXXXXXXXXXXXXXXXXXXXXXXH--------------LSIQKN--------QSQPDIQVEKQRFEEVMLQLRSENDQMLEKMRLKCSNLTNSLEQSDQTIFNIKEEIKSLKEIFTNKEKNLKLSHDNEIEQL-----------KISVAEEQSRILASNTQLKSQVKSLSEENVELRSSLQEISNKNMKF-HFRLKTILDKEIVKTSENSE-----LLTELDREVELLKTLCVDNDGDQKAQGERQDNNGNESWRLRKCVKADKIEISNLNLTLQSERRARA--------------DLEKKLTQQKSEICDISKQLEKYKQDVNEKDNLIANLK---------------------------SASQNLEPHVPKEIPSNPVTLSEFNSILS--------------GSLDKTVVNCNQHVFSHSTFNRPIKCDYCTSHMLGQYYQGVKCKECSFSCHHYCLSNVLNDKCYTRKSAGK---GANLKNGIGTMYENFIKVPKPGGIRRGWKRQFMALCDLKLFFFDVKEGSTGTQMPDISRNPCRVIDLKYTEFKVVKVSRDEVMHAPKKDVEFIIKIS---IENSSTMLPIYVLFESVDNKEDCIKVIEEARSYIKKDPHYRMIFTEKSCLNNLDISMNY-RQILSAAIIDQSTLLFGTEEGL--LKVTDSGYNKIGEKKPVYIIESLDQQELQLVAVIQSKQRVLKLLLSGILDGAHDWEPIIVENGKSCTTFVVGKSYVSPGNQFAPYADTMLANSTFHIKSPSNDRIWIMCAAFKNSVEVYHLNLKLTRHEKLRQILCNTSVTSLQIAGHGEQLLIGMHDSVAIYSLWETGSPXXXXXXXXXXXXXNFQYIFQTNFESMLIVEISFNEYLILFECAGIFINRNHRQTRP-DLQWPDKPTRFTYRAPYLLCFTEMAGLFAYEITEHSCNLVQALPLRSSKPLDRSGHILTTANEFIQAIDLIYVHLVSANEEKISIGK-TIDKTSSSNTLSIFKFLNKRKPSYNKQEDSFDTNDAISPNPAGNSTKSTGLKYRDKPTLKSNRQISVPQNFRHLSHMGPDVPCQ-LIDL 4618
            MS K+ LK+     +++ LL+       ++++E L+D L C Y EC     + +K VA+F++  K     ++ +++ R DF+ I+VIGRGAFG+V+VV+ K    IYAMK L+K+++LK+ + ACF+EERDVL         WIT LHYAFQDE +LY VMD+Y GGD+LTLLSKF D+LPE++ +FYI E+V++ID +H+L Y+HRDIKPDN+LLD  GHI LADFGSC+K+  +GT  +  AVGTPDYISPEIL++ E G G YG ECDWWSLG+ ++EMLYGE PFY E   ETY +IMN E  FQ P+   DVS+EA+DLI++LIC +E RLG  GI+DFK H FF  ++W+N+R+  AP+IP+VSS  DTSNF+ DD         PP S + F G HLP IGFTFT +  F++ GS +S                   S+++++    I                         G+   L+ ++ +     L EE+ +LK      ++LE+QL +       R +S QR+      H V +Q   +KE+L  Q       L+ + +++ D  +  +L       LN+   EL + + ++ ++ +D EE+++V T+  + ++   +   + +  LE +LD    +  KE++  +H              L +++         + Q +I   K   E+ +L    E  +      L+  N+   +  S+     +++EI  LK+     EK+ +  H NE+E+            +  + +E  ++ A N +L S V  L+ +N +L   LQ+++ K     H+  +     + V   +++      L +++  E+E L++  +         G R     +  W++R+  K D      L   L++E RA+                LE KL   +++  ++ +++E  K+ + EK      LK                           ++ Q  +   P+  PS  V  SE    ++               +L         H FS  +F+ P +C +CTS M+G   QG  C+ CSF+CH  C        C       K   G +++ GIGT Y+  +KVPKP G+++GW+R +  +CD KLF +D+ EG + TQ   I+    +V+DL+  EF V  V   +V+HA ++D+  I +++   +   S    + +L E+ + K   + ++E  +S + K+     +      L   D S+   + IL+AAI+D   +  G EEGL  ++VT     +  + K V+ IE   ++  ++V ++  +   + L     LDGA     I +   K C                      ++A +T    S +      +  A K  +  Y +      H K  +I+   SV  L +    ++L +G      + S+   G P       +   D +  ++ Q +F+++  VE+   EYL+ F   G++++   R+ R  +L WP  P   +    ++  ++E  G+  +++   +   VQ + LR  +PL+  G  L   N   +   LIY       + K S     +  TS ++   + +  +KR+  +                P     +      RD P L+S + IS P NF H++HMGP    Q L+DL
Sbjct:    1 MSAKVRLKK-----LEQLLLDGPWRNESALSVETLLDVLVCLYTECSHSALRRDKYVAEFLEWAKPFTQLVKEMQLHREDFEIIKVIGRGAFGEVAVVKMKNTERIYAMKILNKWEMLKRAETACFREERDVLVNG---DCQWITALHYAFQDENHLYLVMDYYVGGDLLTLLSKFEDKLPEDMARFYIGEMVLAIDSIHQLHYVHRDIKPDNVLLDVNGHIRLADFGSCLKMNDDGTVQSSVAVGTPDYISPEILQAMEDGMGKYGPECDWWSLGVCMYEMLYGETPFYAESLVETYGKIMNHEERFQFPSHVTDVSEEAKDLIQRLICSRERRLGQNGIEDFKKHAFFEGLNWENIRNLEAPYIPDVSSPSDTSNFDVDDDVLRNTEILPPGSHTGFSGLHLPFIGFTFTTESCFSDRGSLKSIMQSNTLTKDEDVQRDLEHSLQMEAYERRIRRLEQEKLELSRKLQESTQTVQSLHGSSRALSNSNRDKEIKKLNEEIERLKNKIADSNRLERQLEDTVALRQEREDSTQRLRGLEKQHRVVRQ---EKEELHKQLVEASERLKSQAKELKDAHQQRKLALQEFSELNERMAELRAQKQKVSRQLRDKEEEMEVATQKVDAMRQEMRRAEKLRKELEAQLDDAVAEASKERKLREHSENFCKQMESELEALKVKQGGRGAGATLEHQQEISKIKSELEKKVLFYEEELVRREASHVLEVKNVKKEVHDSESHQLALQKEILMLKDKL---EKSKRERH-NEMEEAVGTIKDKYERERAMLFDENKKLTAENEKLCSFVDKLTAQNRQLEDELQDLAAKKESVAHWEAQIAEIIQWVSDEKDARGYLQALASKMTEELEALRSSSL---------GSR---TLDPLWKVRRSQKLDMSARLELQSALEAEIRAKQLVQEELRKVKDANLTLESKLKDSEAKNRELLEEMEILKKKMEEKFRADTGLKLPDFQDSIFEYFNTAPLAHDLTFRTSSASEQETQAPKPEASPSMSVAASEQQEDMARPPQRPSAVPLPTTQALALAGPKPKAHQFSIKSFSSPTQCSHCTSLMVGLIRQGYACEVCSFACHVSCKDGA-PQVCPIPPEQSKRPLGVDVQRGIGTAYKGHVKVPKPTGVKKGWQRAYAVVCDCKLFLYDLPEGKS-TQPGVIA---SQVLDLRDDEFSVSSVLASDVIHATRRDIPCIFRVTASLLGAPSKTSSLLILTENENEKRKWVGILEGLQSILHKNRLRNQVV--HVPLEAYDSSLPLIKAILTAAIVDADRIAVGLEEGLYVIEVTRDVIVRAADCKKVHQIELAPRE--KIVILLCGRNHHVHLYPWSSLDGAEGSFDIKLPETKGC---------------------QLMATATLKRNSGT-----CLFVAVKRLILCYEIQRTKPFHRKFNEIVAPGSVQCLAVL--RDRLCVGYPSGFCLLSIQGDGQP----LNLVNPNDPSLAFLSQQSFDALCAVELESEEYLLCFSHMGLYVDPQGRRARAQELMWPAAPVACSCSPTHVTVYSEY-GVDVFDV--RTMEWVQTIGLRRIRPLNSEG-TLNLLN--CEPPRLIYF------KSKFSGAVLNVPDTSDNSKKQMLRTRSKRRFVFKV--------------PEEERLQQRREMLRD-PELRS-KMISNPTNFNHVAHMGPGDGMQVLMDL 1607          
BLAST of Serine/threonine kinase vs. Ensembl Human
Match: CDC42BPA (CDC42 binding protein kinase alpha [Source:HGNC Symbol;Acc:HGNC:1737])

HSP 1 Score: 464.537 bits (1194), Expect = 6.784e-135
Identity = 247/578 (42.73%), Postives = 362/578 (62.63%), Query Frame = 2
Query:   32 MSIKLTLKQRHENLIKEFLLNYKSSV-PDSVTLEFLIDSLFCTYYECRLPFHKDEKNVAQFIKSIKGTVDKIESLRIRRSDFDTIRVIGRGAFGKVSVVRFKEKGEIYAMKSLHKYDILKKIDAACFQEERDVLFQAMKIKSPWITRLHYAFQDEFYLYFVMDFYNGGDMLTLLSKFNDRLPEEITKFYIAEVVMSIDVVHKLGYLHRDIKPDNLLLDSLGHIVLADFGSCVKLRPNGTTITERAVGTPDYISPEILRSAE-GHGPYGVECDWWSLGIVIHEMLYGELPFYNEDFSETYWQIMNFETCFQIPTEYDDVSDEAEDLIKQLICKKECRLGNKGIDDFKNHPFFREIDWDNLRSYNAPFIPEVSSAEDTSNFEFDD---FNANHEGPPLSSNFKGCHLPCIGFTFTKDFIFNEMGSEESSVRLKSLMENIGAPALLNGNHNESNSDALLEEVNQLKITCSQLEKQLNECRTNSVQRIFSHPVYQQLVTDKE--------------KLLTQCQNYDYSLREK---EQKMDDLI-------ETNRLLNKERDELTSDRLQILQKKQDIEEDLK 1678
            MS ++ L+Q     +++F+L+  +       ++E L+D L C Y EC     + EKN+ ++++  K    K++ +R+ R DF+ ++VIGRGAFG+V+VV+ K   +++AMK L+K+++LK+ + ACF+EERDVL       + WIT LHYAFQD+  LY VMD+Y GGD+LTLLSKF DRLPE++ +FY+AE+V++ID VH+L Y+HRDIKPDN+L+D  GHI LADFGSC+KL  +GT  +  AVGTPDYISPEIL++ E G G YG ECDWWSLG+ ++EMLYGE PFY E   ETY +IMN +  FQ P +  DVS+ A+DLI++LIC +E RLG  GI+DFK HPFF  IDWDN+R+  AP+IPEVSS  DTSNF+ DD    N+    PP  + F G HLP +GFT+T   + ++      +    SL  ++     L+ N      +  ++ + Q K+   +L ++L E  T +VQ +    V   L   K+              K +T+  + +  L E     Q++DD         +  + L +ER++L  + +Q  ++ ++  ++LK
Sbjct:    1 MSGEVRLRQ-----LEQFILDGPAQTNGQCFSVETLLDILICLYDECNNSPLRREKNILEYLEWAKPFTSKVKQMRLHREDFEILKVIGRGAFGEVAVVKLKNADKVFAMKILNKWEMLKRAETACFREERDVLVNG---DNKWITTLHYAFQDDNNLYLVMDYYVGGDLLTLLSKFEDRLPEDMARFYLAEMVIAIDSVHQLHYVHRDIKPDNILMDMNGHIRLADFGSCLKLMEDGTVQSSVAVGTPDYISPEILQAMEDGKGRYGPECDWWSLGVCMYEMLYGETPFYAESLVETYGKIMNHKERFQFPAQVTDVSENAKDLIRRLICSREHRLGQNGIEDFKKHPFFSGIDWDNIRNCEAPYIPEVSSPTDTSNFDVDDDCLKNSETMPPPTHTAFSGHHLPFVGFTYTSSCVLSDRSCLRVTAGPTSLDLDVNVQRTLDNNLATEAYERRIKRLEQEKL---ELSRKLQES-TQTVQALQYSTVDGPLTASKDLEIKNLKEEIEKLRKQVTESSHLEQQLEEANAVRQELDDAFRQIKAYEKQIKTLQQEREDLNKELVQASERLKNQSKELK 566          

HSP 2 Score: 243.817 bits (621), Expect = 4.379e-64
Identity = 245/946 (25.90%), Postives = 419/946 (44.29%), Query Frame = 2
Query: 1931 SNLTNSLEQSDQTIFNIKEEIKSLKEIFTNKEKNLKLS-HDNEIEQLKISV-------AEEQSR----------ILASNTQLKSQVKSLSEENVELRSSLQEISN--KNMKFHFRLKTILDKEIVKTSENSELLTELDREV-ELLKTLCVDNDG-----------DQKAQGERQDNNGNES----WRLRKCVKADKIEISNLNLTLQSERRARADLEKKLTQQKSE----ICDISKQLEKYKQDVNEKDNLIANLKSASQNLEPHVPKEIPSNPVTLSEFNSILSGSLDKTVVNCNQ--HVFSHSTFNRPIKCDYCTSHMLGQYYQGVKCKECSFSCHHYCLSNVLNDKCYTRKSAGKGA---NLKNGIGTMYENFIKVPKPGGIRRGWKRQFMALCDLKLFFFDVKEGSTGTQMPDISRNPCRVIDLKYTEFKVVKVSRDEVMHAPKKDVEFIIKIS---IENSSTMLPIYVLFESVDNKEDCIKVIEEARSYIKKDPHY-RMIFTEKSCLNNLDISMNYRQILSAAIIDQSTLLFGTEEGL--LKVTDSGYNKIGEKKPVYIIESLDQQELQLVAVIQSKQRVLKLLLSGILDGAHDWEPIIVENGKSCTTFVVGKSYVSPGNQFAPYADTMLANSTFHIKSPSNDRIWIMCAAFKNSVEVYHLNLKLTRHEKLRQILCNTSVTSLQIAGHGEQLLIGMHDSVAIYSLWETGSPXXXXXXXXXXXXXNFQYIFQTNFESMLIVEISFNEYLILFECAGIFINRNHRQTR-PDLQWPDKPTRFTYRAPYLLCFTEMAGLFAYEITEHSCNLVQALPLRSSKPLDRSGHILTTANEFIQAIDLIYVHLVSANEEKISIGKTIDKTSSSNTLSIFKFLNKRKPSYNKQEDSFDTNDAISPNPAGNSTKSTGLKYRDKPTLKSNRQISVPQNFRHLSHMGPDVPCQLI 4612
            + L   LE+  ++IF  +EE+   + I  N+ KNLK   HD+E +QL ++          E++R                Q + +   L+EEN +L S L +++   +N+  H      L++E+   ++  E +   + ++ E+++ +  + D             ++ +  R  + G  +    W++R+  K D      L   L +E RA+  ++++L + K+      C +    +K  + ++E + LI + +           + + S P+++        G    T     +  H F   +F  P KC  CTS M+G   QG  C+ C FSCH  C+ N     C       KG    + + GIGT YE  +++PKP G+++GW+R    +CD KLF +D+ EG        IS    +VID++  EF V  V   +V+HA +KD+  I +++   +  S+    I +L ++ + K   + V+ E    +KK+    R ++  K   ++    +   Q  +AAIID   +  G EEGL  + VT     ++G+ K ++ IE +     QLVAVI  + R ++L     LDG  + +   +   K C T   GK  V  G                         +  +C A K  V  Y L    TRH K ++I    +V  + I    EQL +G       Y L   G+P    +  L   D    +I     +++  VEIS  EYL+ F   GI+ +   R++R  +L WP  P+   Y APYL  ++E A +  +++  +S   +Q LPL+  +PL+  G +       ++ I LIY     A  +++ + +T D +      +I    NKR+ S+                P     +      RD P ++ N+ IS P NF H++HMGP    Q++
Sbjct:  687 TKLKTDLEK--KSIF-YEEELSKREGIHANEIKNLKKELHDSEGQQLALNKEIMILKDKLEKTRRESQSEREEFESEFKQQYEREKVLLTEENKKLTSELDKLTTLYENLSIH---NQQLEEEVKDLADKKESVAHWEAQITEIIQWVSDEKDARGYLQALASKMTEELEALRNSSLGTRATDMPWKMRRFAKLDMSARLELQSALDAEIRAKQAIQEELNKVKASNIITECKLKDSEKKNLELLSEIEQLIKDTEELRSEKASKGRRTVDSTPLSVHTPTLRKKGCPGSTGFPPKRKTHQFFVKSFTTPTKCHQCTSLMVGLIRQGCSCEVCGFSCHITCV-NKAPTTCPVPPEQTKGPLGIDPQKGIGTAYEGHVRIPKPAGVKKGWQRALAIVCDFKLFLYDIAEGKASQPSVVIS----QVIDMRDEEFSVSSVLASDVIHASRKDIPCIFRVTASQLSASNNKCSILMLADTENEKNKWVGVLSELHKILKKNKFRDRSVYVPKEAYDSTLPLIKTTQ--AAAIIDHERIALGNEEGLFVVHVTKDEIIRVGDNKKIHQIELIPND--QLVAVISGRNRHVRLFPMSALDG-RETDFYKLSETKGCQTVTSGK--VRHGA------------------------LTCLCVAMKRQVLCYELFQSKTRHRKFKEIQVPYNVQWMAI--FSEQLCVGFQSGFLRYPLNGEGNP----YSMLHSNDHTLSFIAHQPMDAICAVEISSKEYLLCFNSIGIYTDCQGRRSRQQELMWPANPSSCCYNAPYLSVYSENA-VDIFDV--NSMEWIQTLPLKKVRPLNNEGSLNLLG---LETIRLIYFKNKMAEGDELVVPETSDNSRKQMVRNIN---NKRRYSFRV--------------PEEERMQQRREMLRD-PEMR-NKLISNPTNFNHIAHMGPGDGIQIL 1559          
BLAST of Serine/threonine kinase vs. Ensembl Human
Match: CDC42BPA (CDC42 binding protein kinase alpha [Source:HGNC Symbol;Acc:HGNC:1737])

HSP 1 Score: 464.151 bits (1193), Expect = 1.047e-134
Identity = 247/578 (42.73%), Postives = 362/578 (62.63%), Query Frame = 2
Query:   32 MSIKLTLKQRHENLIKEFLLNYKSSV-PDSVTLEFLIDSLFCTYYECRLPFHKDEKNVAQFIKSIKGTVDKIESLRIRRSDFDTIRVIGRGAFGKVSVVRFKEKGEIYAMKSLHKYDILKKIDAACFQEERDVLFQAMKIKSPWITRLHYAFQDEFYLYFVMDFYNGGDMLTLLSKFNDRLPEEITKFYIAEVVMSIDVVHKLGYLHRDIKPDNLLLDSLGHIVLADFGSCVKLRPNGTTITERAVGTPDYISPEILRSAE-GHGPYGVECDWWSLGIVIHEMLYGELPFYNEDFSETYWQIMNFETCFQIPTEYDDVSDEAEDLIKQLICKKECRLGNKGIDDFKNHPFFREIDWDNLRSYNAPFIPEVSSAEDTSNFEFDD---FNANHEGPPLSSNFKGCHLPCIGFTFTKDFIFNEMGSEESSVRLKSLMENIGAPALLNGNHNESNSDALLEEVNQLKITCSQLEKQLNECRTNSVQRIFSHPVYQQLVTDKE--------------KLLTQCQNYDYSLREK---EQKMDDLI-------ETNRLLNKERDELTSDRLQILQKKQDIEEDLK 1678
            MS ++ L+Q     +++F+L+  +       ++E L+D L C Y EC     + EKN+ ++++  K    K++ +R+ R DF+ ++VIGRGAFG+V+VV+ K   +++AMK L+K+++LK+ + ACF+EERDVL       + WIT LHYAFQD+  LY VMD+Y GGD+LTLLSKF DRLPE++ +FY+AE+V++ID VH+L Y+HRDIKPDN+L+D  GHI LADFGSC+KL  +GT  +  AVGTPDYISPEIL++ E G G YG ECDWWSLG+ ++EMLYGE PFY E   ETY +IMN +  FQ P +  DVS+ A+DLI++LIC +E RLG  GI+DFK HPFF  IDWDN+R+  AP+IPEVSS  DTSNF+ DD    N+    PP  + F G HLP +GFT+T   + ++      +    SL  ++     L+ N      +  ++ + Q K+   +L ++L E  T +VQ +    V   L   K+              K +T+  + +  L E     Q++DD         +  + L +ER++L  + +Q  ++ ++  ++LK
Sbjct:    1 MSGEVRLRQ-----LEQFILDGPAQTNGQCFSVETLLDILICLYDECNNSPLRREKNILEYLEWAKPFTSKVKQMRLHREDFEILKVIGRGAFGEVAVVKLKNADKVFAMKILNKWEMLKRAETACFREERDVLVNG---DNKWITTLHYAFQDDNNLYLVMDYYVGGDLLTLLSKFEDRLPEDMARFYLAEMVIAIDSVHQLHYVHRDIKPDNILMDMNGHIRLADFGSCLKLMEDGTVQSSVAVGTPDYISPEILQAMEDGKGRYGPECDWWSLGVCMYEMLYGETPFYAESLVETYGKIMNHKERFQFPAQVTDVSENAKDLIRRLICSREHRLGQNGIEDFKKHPFFSGIDWDNIRNCEAPYIPEVSSPTDTSNFDVDDDCLKNSETMPPPTHTAFSGHHLPFVGFTYTSSCVLSDRSCLRVTAGPTSLDLDVNVQRTLDNNLATEAYERRIKRLEQEKL---ELSRKLQES-TQTVQALQYSTVDGPLTASKDLEIKNLKEEIEKLRKQVTESSHLEQQLEEANAVRQELDDAFRQIKAYEKQIKTLQQEREDLNKELVQASERLKNQSKELK 566          

HSP 2 Score: 237.654 bits (605), Expect = 4.049e-62
Identity = 188/647 (29.06%), Postives = 295/647 (45.60%), Query Frame = 2
Query: 2702 HVFSHSTFNRPIKCDYCTSHMLGQYYQGVKCKECSFSCHHYCLSNVLNDKCYTRKSAGKGA---NLKNGIGTMYENFIKVPKPGGIRRGWKRQFMALCDLKLFFFDVKEGSTGTQMPDISRNPCRVIDLKYTEFKVVKVSRDEVMHAPKKDVEFIIKIS---IENSSTMLPIYVLFESVDNKEDCIKVIEEARSYIKKDPHY-RMIFTEKSCLNNLDISMNYRQILSAAIIDQSTLLFGTEEGL--LKVTDSGYNKIGEKKPVYIIESLDQQELQLVAVIQSKQRVLKLLLSGILDGAHDWEPIIVENGKSCTTFVVGKSYVSPGNQFAPYADTMLANSTFHIKSPSNDRIWIMCAAFKNSVEVYHLNLKLTRHEKLRQILCNTSVTSLQIAGHGEQLLIGMHDSVAIYSLWETGSPXXXXXXXXXXXXXNFQYIFQTNFESMLIVEISFNEYLILFECAGIFINRNHRQTR-PDLQWPDKPTRFTYRAPYLLCFTEMAGLFAYEITEHSCNLVQALPLRSSKPLDRSGHILTTANEFIQAIDLIYVHLVSANEEKISIGKTIDKTSSSNTLSIFKFLNKRKPSYNKQEDSFDTNDAISPNPAGNSTKSTGLKYRDKPTLKSNRQISVPQNFRHLSHMGPDVPCQLI 4612
            H F   +F  P KC  CTS M+G   QG  C+ C FSCH  C+ N     C       KG    + + GIGT YE  +++PKP G+++GW+R    +CD KLF +D+ EG        IS    +VID++  EF V  V   +V+HA +KD+  I +++   +  S+    I +L ++ + K   + V+ E    +KK+    R ++  K   ++    +   Q  +AAIID   +  G EEGL  + VT     ++G+ K ++ IE +     QLVAVI  + R ++L     LDG  + +   +   K C T   GK  V  G                         +  +C A K  V  Y L    TRH K ++I    +V  + I    EQL +G       Y L   G+P    +  L   D    +I     +++  VEIS  EYL+ F   GI+ +   R++R  +L WP  P+   Y APYL  ++E A +  +++  +S   +Q LPL+  +PL+  G +       ++ I LIY     A  +++ + +T D +      +I    NKR+ S+                P     +      RD P ++ N+ IS P NF H++HMGP    Q++
Sbjct: 1000 HQFFVKSFTTPTKCHQCTSLMVGLIRQGCSCEVCGFSCHITCV-NKAPTTCPVPPEQTKGPLGIDPQKGIGTAYEGHVRIPKPAGVKKGWQRALAIVCDFKLFLYDIAEGKASQPSVVIS----QVIDMRDEEFSVSSVLASDVIHASRKDIPCIFRVTASQLSASNNKCSILMLADTENEKNKWVGVLSELHKILKKNKFRDRSVYVPKEAYDSTLPLIKTTQ--AAAIIDHERIALGNEEGLFVVHVTKDEIIRVGDNKKIHQIELIPND--QLVAVISGRNRHVRLFPMSALDG-RETDFYKLSETKGCQTVTSGK--VRHGA------------------------LTCLCVAMKRQVLCYELFQSKTRHRKFKEIQVPYNVQWMAI--FSEQLCVGFQSGFLRYPLNGEGNP----YSMLHSNDHTLSFIAHQPMDAICAVEISSKEYLLCFNSIGIYTDCQGRRSRQQELMWPANPSSCCYNAPYLSVYSENA-VDIFDV--NSMEWIQTLPLKKVRPLNNEGSLNLLG---LETIRLIYFKNKMAEGDELVVPETSDNSRKQMVRNIN---NKRRYSFRV--------------PEEERMQQRREMLRD-PEMR-NKLISNPTNFNHIAHMGPGDGIQIL 1579          
BLAST of Serine/threonine kinase vs. Ensembl Human
Match: CDC42BPA (CDC42 binding protein kinase alpha [Source:HGNC Symbol;Acc:HGNC:1737])

HSP 1 Score: 464.151 bits (1193), Expect = 1.453e-134
Identity = 247/578 (42.73%), Postives = 362/578 (62.63%), Query Frame = 2
Query:   32 MSIKLTLKQRHENLIKEFLLNYKSSV-PDSVTLEFLIDSLFCTYYECRLPFHKDEKNVAQFIKSIKGTVDKIESLRIRRSDFDTIRVIGRGAFGKVSVVRFKEKGEIYAMKSLHKYDILKKIDAACFQEERDVLFQAMKIKSPWITRLHYAFQDEFYLYFVMDFYNGGDMLTLLSKFNDRLPEEITKFYIAEVVMSIDVVHKLGYLHRDIKPDNLLLDSLGHIVLADFGSCVKLRPNGTTITERAVGTPDYISPEILRSAE-GHGPYGVECDWWSLGIVIHEMLYGELPFYNEDFSETYWQIMNFETCFQIPTEYDDVSDEAEDLIKQLICKKECRLGNKGIDDFKNHPFFREIDWDNLRSYNAPFIPEVSSAEDTSNFEFDD---FNANHEGPPLSSNFKGCHLPCIGFTFTKDFIFNEMGSEESSVRLKSLMENIGAPALLNGNHNESNSDALLEEVNQLKITCSQLEKQLNECRTNSVQRIFSHPVYQQLVTDKE--------------KLLTQCQNYDYSLREK---EQKMDDLI-------ETNRLLNKERDELTSDRLQILQKKQDIEEDLK 1678
            MS ++ L+Q     +++F+L+  +       ++E L+D L C Y EC     + EKN+ ++++  K    K++ +R+ R DF+ ++VIGRGAFG+V+VV+ K   +++AMK L+K+++LK+ + ACF+EERDVL       + WIT LHYAFQD+  LY VMD+Y GGD+LTLLSKF DRLPE++ +FY+AE+V++ID VH+L Y+HRDIKPDN+L+D  GHI LADFGSC+KL  +GT  +  AVGTPDYISPEIL++ E G G YG ECDWWSLG+ ++EMLYGE PFY E   ETY +IMN +  FQ P +  DVS+ A+DLI++LIC +E RLG  GI+DFK HPFF  IDWDN+R+  AP+IPEVSS  DTSNF+ DD    N+    PP  + F G HLP +GFT+T   + ++      +    SL  ++     L+ N      +  ++ + Q K+   +L ++L E  T +VQ +    V   L   K+              K +T+  + +  L E     Q++DD         +  + L +ER++L  + +Q  ++ ++  ++LK
Sbjct:    1 MSGEVRLRQ-----LEQFILDGPAQTNGQCFSVETLLDILICLYDECNNSPLRREKNILEYLEWAKPFTSKVKQMRLHREDFEILKVIGRGAFGEVAVVKLKNADKVFAMKILNKWEMLKRAETACFREERDVLVNG---DNKWITTLHYAFQDDNNLYLVMDYYVGGDLLTLLSKFEDRLPEDMARFYLAEMVIAIDSVHQLHYVHRDIKPDNILMDMNGHIRLADFGSCLKLMEDGTVQSSVAVGTPDYISPEILQAMEDGKGRYGPECDWWSLGVCMYEMLYGETPFYAESLVETYGKIMNHKERFQFPAQVTDVSENAKDLIRRLICSREHRLGQNGIEDFKKHPFFSGIDWDNIRNCEAPYIPEVSSPTDTSNFDVDDDCLKNSETMPPPTHTAFSGHHLPFVGFTYTSSCVLSDRSCLRVTAGPTSLDLDVNVQRTLDNNLATEAYERRIKRLEQEKL---ELSRKLQES-TQTVQALQYSTVDGPLTASKDLEIKNLKEEIEKLRKQVTESSHLEQQLEEANAVRQELDDAFRQIKAYEKQIKTLQQEREDLNKELVQASERLKNQSKELK 566          

HSP 2 Score: 237.269 bits (604), Expect = 5.431e-62
Identity = 188/647 (29.06%), Postives = 295/647 (45.60%), Query Frame = 2
Query: 2702 HVFSHSTFNRPIKCDYCTSHMLGQYYQGVKCKECSFSCHHYCLSNVLNDKCYTRKSAGKGA---NLKNGIGTMYENFIKVPKPGGIRRGWKRQFMALCDLKLFFFDVKEGSTGTQMPDISRNPCRVIDLKYTEFKVVKVSRDEVMHAPKKDVEFIIKIS---IENSSTMLPIYVLFESVDNKEDCIKVIEEARSYIKKDPHY-RMIFTEKSCLNNLDISMNYRQILSAAIIDQSTLLFGTEEGL--LKVTDSGYNKIGEKKPVYIIESLDQQELQLVAVIQSKQRVLKLLLSGILDGAHDWEPIIVENGKSCTTFVVGKSYVSPGNQFAPYADTMLANSTFHIKSPSNDRIWIMCAAFKNSVEVYHLNLKLTRHEKLRQILCNTSVTSLQIAGHGEQLLIGMHDSVAIYSLWETGSPXXXXXXXXXXXXXNFQYIFQTNFESMLIVEISFNEYLILFECAGIFINRNHRQTR-PDLQWPDKPTRFTYRAPYLLCFTEMAGLFAYEITEHSCNLVQALPLRSSKPLDRSGHILTTANEFIQAIDLIYVHLVSANEEKISIGKTIDKTSSSNTLSIFKFLNKRKPSYNKQEDSFDTNDAISPNPAGNSTKSTGLKYRDKPTLKSNRQISVPQNFRHLSHMGPDVPCQLI 4612
            H F   +F  P KC  CTS M+G   QG  C+ C FSCH  C+ N     C       KG    + + GIGT YE  +++PKP G+++GW+R    +CD KLF +D+ EG        IS    +VID++  EF V  V   +V+HA +KD+  I +++   +  S+    I +L ++ + K   + V+ E    +KK+    R ++  K   ++    +   Q  +AAIID   +  G EEGL  + VT     ++G+ K ++ IE +     QLVAVI  + R ++L     LDG  + +   +   K C T   GK  V  G                         +  +C A K  V  Y L    TRH K ++I    +V  + I    EQL +G       Y L   G+P    +  L   D    +I     +++  VEIS  EYL+ F   GI+ +   R++R  +L WP  P+   Y APYL  ++E A +  +++  +S   +Q LPL+  +PL+  G +       ++ I LIY     A  +++ + +T D +      +I    NKR+ S+                P     +      RD P ++ N+ IS P NF H++HMGP    Q++
Sbjct: 1013 HQFFVKSFTTPTKCHQCTSLMVGLIRQGCSCEVCGFSCHITCV-NKAPTTCPVPPEQTKGPLGIDPQKGIGTAYEGHVRIPKPAGVKKGWQRALAIVCDFKLFLYDIAEGKASQPSVVIS----QVIDMRDEEFSVSSVLASDVIHASRKDIPCIFRVTASQLSASNNKCSILMLADTENEKNKWVGVLSELHKILKKNKFRDRSVYVPKEAYDSTLPLIKTTQ--AAAIIDHERIALGNEEGLFVVHVTKDEIIRVGDNKKIHQIELIPND--QLVAVISGRNRHVRLFPMSALDG-RETDFYKLSETKGCQTVTSGK--VRHGA------------------------LTCLCVAMKRQVLCYELFQSKTRHRKFKEIQVPYNVQWMAI--FSEQLCVGFQSGFLRYPLNGEGNP----YSMLHSNDHTLSFIAHQPMDAICAVEISSKEYLLCFNSIGIYTDCQGRRSRQQELMWPANPSSCCYNAPYLSVYSENA-VDIFDV--NSMEWIQTLPLKKVRPLNNEGSLNLLG---LETIRLIYFKNKMAEGDELVVPETSDNSRKQMVRNIN---NKRRYSFRV--------------PEEERMQQRREMLRD-PEMR-NKLISNPTNFNHIAHMGPGDGIQIL 1592          
BLAST of Serine/threonine kinase vs. Ensembl Celegans
Match: mrck-1 (Serine/threonine-protein kinase mrck-1 [Source:UniProtKB/Swiss-Prot;Acc:O01583])

HSP 1 Score: 626.32 bits (1614), Expect = 0.000e+0
Identity = 488/1629 (29.96%), Postives = 806/1629 (49.48%), Query Frame = 2
Query:   74 IKEFLLNYKSSVPDSVTLEFLIDSLFCTYYECRLPFHKDEKNVAQFIKSIKGTVDKIESLRIRRSDFDTIRVIGRGAFGKVSVVRFKEKGEIYAMKSLHKYDILKKIDAACFQEERDVLFQAMKIKSPWITRLHYAFQDEFYLYFVMDFYNGGDMLTLLSKFNDRLPEEITKFYIAEVVMSIDVVHKLGYLHRDIKPDNLLLDSLGHIVLADFGSCVKLRPNGTTITERAVGTPDYISPEILRSAE-GHGPYGVECDWWSLGIVIHEMLYGELPFYNEDFSETYWQIMNFETCFQIPTEYDD--VSDEAEDLIKQLICKKECRLGNKGIDDFKNHPFFREIDWDNLRSYNAPFIPEVSSAEDTSNFEFD----DFNANHEGPP-LSSNFKGCHLPCIGFTFTKDFIFNEMGSEESSVRLKSLMENIGAPALLNGNHNESNSDALLEEVNQLKITCSQLEKQLNECRTNSVQRIFSHPVYQQLVTDKEKLLTQCQNY---------DYSLREKEQKMDDLIETNRLLNKERDELTSDRLQILQKKQDIEEDLKVMTENFNQLKSTNKAINRXXXXXXXXXXXXXXXXXXXXXXXXHLSIQKNQSQP----------DIQVEK----QRFEEVMLQLRS--ENDQMLEKMRLKCSNLTNSLEQSDQTIFNIKEEIKSLKEIFTNKEKNLKLSHDNEIEQLKISVAEEQSRILASNTQ--------LKSQVKSLSEENVEL-RSSLQEISNKNMKFHFRLKTILDKEIVKTSENSELLTELDREVELLKT---LCVDN--DGDQKAQGERQDNN--GNESWRLRKCVKAD-------KIEISNLNLTLQSERRARADLEKKLTQQKSEICDISKQL-------EKYKQDVNEKDNLIANLKSASQNLEPHVPKEIPSNPVTLSEFNSIL-----------------------SGSLDKTVVNCNQ--HVFSHSTFNRPIKCDYCTSHMLGQYYQGVKCKECSFSCHHYCLSNVLNDKCYTRKSAGK--GANLKNGIGTMYENFIKVPKPGGIRRGWKRQFMALCDLKLFFFDVKEGSTGTQMPDISRNPCRVIDLKYTEFKVVKVSRDEVMHAPKKDVEFIIKISIEN-------SSTMLPIYVLF--ESVDNKEDCIKVIEEARSYIKKDPHY-RMIFTEKSCLNNLDISMNYRQILSAAIIDQSTLLFG-TEEGLLKVTDS-------GYNKIGEKKPVYIIESLDQQELQLVAVIQSKQRVLKLLLSGILDGAHDWEPIIVENGKSCTTFVVGKSYVSPGNQFAPYADTMLANSTFHIKSPSNDRIWIMCAAFKNSVEVYHLNLKLTRHEKLRQILCNTSVTSLQIAGHGEQLLIGMHDSVAIYSLW-----ETGSPXXXXXXXXXXXXXN-----FQYI-FQTNFESMLIVEI--SFNEYLILFECAGIFINRNHRQTR-PDLQWPDKPTRFTYRAPYLLCFTE-MAGLFAYEITEHSCNLVQALPLRSSKPLDRSGHILTTANEFIQAIDLIYVHLVSANEEKISIGKTIDKTSSSNTLSIFKFLNKRKPSYNKQEDSFDTNDAISPNPAGNSTKSTGLKYRDKPTLKSNRQISVPQNFRHLSHMGP 4591
            ++   ++  S  P++++ E LIDSL C Y EC     + EK +A+F++S+K  + K + LR+ R DF+ ++VIG+GAFG+V+VVR +  GEIYAMK L+K++++K+ + ACF+EERDVL    +    WIT LHYAFQDE  LYFVMD+Y GGDMLTLLSKF D +PE + KFYIAE+V++ID +H+LGY+HRD+KPDN+LLD  GHI LADFGSC+++  +G+  +  AVGTPDYISPEILR+ E G G YG ECDWWSLGI ++EMLYG  PFY+E   +TY +IM+ +     P +  D  VS+EA+DLI+QLIC  + R G  G+ DF+ HPFF  IDW+ +R  N P++PEVSS EDTSNF+ D    DF      PP + + F G HLP +GF++T   + ++  S    +R  ++ +     A L     E + D  + E+   K   ++L ++L E +T   Q +  +P  ++   + E  + Q ++          D +L +++QK  D I       K+  EL     Q++ +K +I+ +L  + ++ +Q+      + +++D ++ EL  +    + EK+ +K L  +  +++           +I+ EK    ++ EEV ++ R   E D  L +  +   N   SL+ +++     + EIK LK+    +  +     + E++QL+    E   ++L  N +        L+ +++ LS++   L R  L E      + H  +   + +E     E   L  ++  EVE LK    L   N         G R+ NN    +   L++ ++A+       K E+ N      +      D EK++     E+  + +Q          +   +   D +I+       +    + +E+ S   T S  N+IL                       SG      ++  +  H F       P KC +CTS ++G   QG+ C+ C ++CH  C   V +  C   +   +  G +   G+GT YE  +K P+ GG+R+GW+  ++ +CD KL+ +D        +M D+      V+D++  +F V  VS  +V+HA K D+  I +++           S+    Y LF  E+ + K   +  + E ++ +++     R  F  K   +   +  + R     AIID+S ++ G ++ GL  +  S       G  K  +++ V  +E  + ++L ++ V  +K R ++++ S  LDG  D + I V + K C    VG +  +PG +   +A                        AFK SV ++ ++    RH+K + +    +  S+ I     +L +G   S   +SL        GS             +N      Q++  QT++E+ LIV +  S +EYL++F   G+++N   R++R P++ +P +   F Y  PYL  F+E    +F   + E     VQ + LRS+KPL   G IL+T    +     I+V L +  +++ SI   ++  S S      + + +RK ++                      ++ G   R     +S+ QIS P +F H+ HMGP
Sbjct:   17 LENIYMDGPSKKPEALSFETLIDSLICLYDECCNSTLRKEKCIAEFVESVKTVISKAKKLRLSRDDFEVLKVIGKGAFGEVAVVRMRGVGEIYAMKILNKWEMVKRAETACFREERDVLVYGDR---RWITNLHYAFQDEKNLYFVMDYYIGGDMLTLLSKFVDHIPESMAKFYIAEMVLAIDSLHRLGYVHRDVKPDNVLLDMQGHIRLADFGSCLRILADGSVASNVAVGTPDYISPEILRAMEDGRGRYGKECDWWSLGICMYEMLYGTTPFYSERLVDTYGKIMSHQDMLDFPDDEIDWVVSEEAKDLIRQLICSSDVRFGRNGLSDFQLHPFFEGIDWNTIRDSNPPYVPEVSSPEDTSNFDVDVCEDDFTPCETQPPRVLAAFTGNHLPFVGFSYTHGSLLSDARSLTDEIR--AIAQRCQGDAELM----EKSVDGFMVELENEK---AELVQKLKEAQTIIAQHVAENPRSEE-DRNYESTIAQLKDEIQILNKRLEDEALAQQQQKPKDEIVAES--EKKLKELKERNKQLVMEKSEIQRELDNINDHLDQVLVEKATVVQQRDDMQAELADVGDSLLTEKDSVKRLQDEAEKAKKQVADFEEKLKEIETEKIALIKKQEEVTIEARKSVETDDHLSEEVVAAKNTIASLQATNE---ERETEIKKLKQRMDEERASHTAQSEQEMKQLEAHY-ERAQKMLQDNVEQMNVENRGLRDEIEKLSQQMAALPRGGLNE-----QQLH-EIFNWVSEEKATREEMENLTRKITGEVESLKNNSPLTTSNYIQNTPSGWGSRRMNNVARKDGLDLQRQLQAEIDAKLKLKAELKNSQEQYLTSAARLDDTEKRMASLMREVAMLKQQKNIENSSDSAFSSTMGRGDLMISMNNDYEMSNSSLMRQEMISRQSTPSYENAILLHDHQVPKRVDDLRYKQKPMKTASGIFSPVSISAMERGHNFERMKIKTPTKCGHCTSILIGLDRQGLFCQSCQYACHVSCAERV-SQSCPVPEEERRPLGIDPTRGVGTAYEGLVKTPRAGGVRKGWQTAYVVVCDFKLYLYDCTVDRQ-NKMQDVKNEIRLVLDMRDPDFTVCGVSEADVIHAQKGDIPKIFRVTTTQILNSSSEYSSSSKFYTLFMAETEEEKRKWVVALSELKTLLRRSKLADRKAFLVKEVFDVTTLP-SIRVAQCCAIIDRSKIVIGFSDHGLYCIEISRQLLIPVGGEKENKQRCVETVEYDEAEQLLMMIVGPAKDRHVRIVPSAALDG-RDLKWIKVNDTKGCHLLAVGTN--NPGGRAGFFA-----------------------VAFKKSVTIFQIDRSEKRHKKWKDLAMPGTPQSIAI--FNGRLYVGFSHSFRSWSLVGVDSSPVGSGDASGAVLQHISLVNMEDTSLQFLNQQTSYEAKLIVNVPGSPDEYLLVFNMIGLYVNEMGRRSRLPEVMFPTQAKYFAYHEPYLCVFSENEVDIFNVTLAE----WVQTINLRSAKPLSGDG-ILSTC---LCNDSPIFVLLQNVLQDQDSIEVPVNLASGSTD---GRKVTRRKFTF----------------------RTIGKDDRSASERRSHIQISTPSDFMHIVHMGP 1556          
BLAST of Serine/threonine kinase vs. Ensembl Celegans
Match: mrck-1 (Serine/threonine-protein kinase mrck-1 [Source:UniProtKB/Swiss-Prot;Acc:O01583])

HSP 1 Score: 626.32 bits (1614), Expect = 0.000e+0
Identity = 488/1629 (29.96%), Postives = 806/1629 (49.48%), Query Frame = 2
Query:   74 IKEFLLNYKSSVPDSVTLEFLIDSLFCTYYECRLPFHKDEKNVAQFIKSIKGTVDKIESLRIRRSDFDTIRVIGRGAFGKVSVVRFKEKGEIYAMKSLHKYDILKKIDAACFQEERDVLFQAMKIKSPWITRLHYAFQDEFYLYFVMDFYNGGDMLTLLSKFNDRLPEEITKFYIAEVVMSIDVVHKLGYLHRDIKPDNLLLDSLGHIVLADFGSCVKLRPNGTTITERAVGTPDYISPEILRSAE-GHGPYGVECDWWSLGIVIHEMLYGELPFYNEDFSETYWQIMNFETCFQIPTEYDD--VSDEAEDLIKQLICKKECRLGNKGIDDFKNHPFFREIDWDNLRSYNAPFIPEVSSAEDTSNFEFD----DFNANHEGPP-LSSNFKGCHLPCIGFTFTKDFIFNEMGSEESSVRLKSLMENIGAPALLNGNHNESNSDALLEEVNQLKITCSQLEKQLNECRTNSVQRIFSHPVYQQLVTDKEKLLTQCQNY---------DYSLREKEQKMDDLIETNRLLNKERDELTSDRLQILQKKQDIEEDLKVMTENFNQLKSTNKAINRXXXXXXXXXXXXXXXXXXXXXXXXHLSIQKNQSQP----------DIQVEK----QRFEEVMLQLRS--ENDQMLEKMRLKCSNLTNSLEQSDQTIFNIKEEIKSLKEIFTNKEKNLKLSHDNEIEQLKISVAEEQSRILASNTQ--------LKSQVKSLSEENVEL-RSSLQEISNKNMKFHFRLKTILDKEIVKTSENSELLTELDREVELLKT---LCVDN--DGDQKAQGERQDNN--GNESWRLRKCVKAD-------KIEISNLNLTLQSERRARADLEKKLTQQKSEICDISKQL-------EKYKQDVNEKDNLIANLKSASQNLEPHVPKEIPSNPVTLSEFNSIL-----------------------SGSLDKTVVNCNQ--HVFSHSTFNRPIKCDYCTSHMLGQYYQGVKCKECSFSCHHYCLSNVLNDKCYTRKSAGK--GANLKNGIGTMYENFIKVPKPGGIRRGWKRQFMALCDLKLFFFDVKEGSTGTQMPDISRNPCRVIDLKYTEFKVVKVSRDEVMHAPKKDVEFIIKISIEN-------SSTMLPIYVLF--ESVDNKEDCIKVIEEARSYIKKDPHY-RMIFTEKSCLNNLDISMNYRQILSAAIIDQSTLLFG-TEEGLLKVTDS-------GYNKIGEKKPVYIIESLDQQELQLVAVIQSKQRVLKLLLSGILDGAHDWEPIIVENGKSCTTFVVGKSYVSPGNQFAPYADTMLANSTFHIKSPSNDRIWIMCAAFKNSVEVYHLNLKLTRHEKLRQILCNTSVTSLQIAGHGEQLLIGMHDSVAIYSLW-----ETGSPXXXXXXXXXXXXXN-----FQYI-FQTNFESMLIVEI--SFNEYLILFECAGIFINRNHRQTR-PDLQWPDKPTRFTYRAPYLLCFTE-MAGLFAYEITEHSCNLVQALPLRSSKPLDRSGHILTTANEFIQAIDLIYVHLVSANEEKISIGKTIDKTSSSNTLSIFKFLNKRKPSYNKQEDSFDTNDAISPNPAGNSTKSTGLKYRDKPTLKSNRQISVPQNFRHLSHMGP 4591
            ++   ++  S  P++++ E LIDSL C Y EC     + EK +A+F++S+K  + K + LR+ R DF+ ++VIG+GAFG+V+VVR +  GEIYAMK L+K++++K+ + ACF+EERDVL    +    WIT LHYAFQDE  LYFVMD+Y GGDMLTLLSKF D +PE + KFYIAE+V++ID +H+LGY+HRD+KPDN+LLD  GHI LADFGSC+++  +G+  +  AVGTPDYISPEILR+ E G G YG ECDWWSLGI ++EMLYG  PFY+E   +TY +IM+ +     P +  D  VS+EA+DLI+QLIC  + R G  G+ DF+ HPFF  IDW+ +R  N P++PEVSS EDTSNF+ D    DF      PP + + F G HLP +GF++T   + ++  S    +R  ++ +     A L     E + D  + E+   K   ++L ++L E +T   Q +  +P  ++   + E  + Q ++          D +L +++QK  D I       K+  EL     Q++ +K +I+ +L  + ++ +Q+      + +++D ++ EL  +    + EK+ +K L  +  +++           +I+ EK    ++ EEV ++ R   E D  L +  +   N   SL+ +++     + EIK LK+    +  +     + E++QL+    E   ++L  N +        L+ +++ LS++   L R  L E      + H  +   + +E     E   L  ++  EVE LK    L   N         G R+ NN    +   L++ ++A+       K E+ N      +      D EK++     E+  + +Q          +   +   D +I+       +    + +E+ S   T S  N+IL                       SG      ++  +  H F       P KC +CTS ++G   QG+ C+ C ++CH  C   V +  C   +   +  G +   G+GT YE  +K P+ GG+R+GW+  ++ +CD KL+ +D        +M D+      V+D++  +F V  VS  +V+HA K D+  I +++           S+    Y LF  E+ + K   +  + E ++ +++     R  F  K   +   +  + R     AIID+S ++ G ++ GL  +  S       G  K  +++ V  +E  + ++L ++ V  +K R ++++ S  LDG  D + I V + K C    VG +  +PG +   +A                        AFK SV ++ ++    RH+K + +    +  S+ I     +L +G   S   +SL        GS             +N      Q++  QT++E+ LIV +  S +EYL++F   G+++N   R++R P++ +P +   F Y  PYL  F+E    +F   + E     VQ + LRS+KPL   G IL+T    +     I+V L +  +++ SI   ++  S S      + + +RK ++                      ++ G   R     +S+ QIS P +F H+ HMGP
Sbjct:   17 LENIYMDGPSKKPEALSFETLIDSLICLYDECCNSTLRKEKCIAEFVESVKTVISKAKKLRLSRDDFEVLKVIGKGAFGEVAVVRMRGVGEIYAMKILNKWEMVKRAETACFREERDVLVYGDR---RWITNLHYAFQDEKNLYFVMDYYIGGDMLTLLSKFVDHIPESMAKFYIAEMVLAIDSLHRLGYVHRDVKPDNVLLDMQGHIRLADFGSCLRILADGSVASNVAVGTPDYISPEILRAMEDGRGRYGKECDWWSLGICMYEMLYGTTPFYSERLVDTYGKIMSHQDMLDFPDDEIDWVVSEEAKDLIRQLICSSDVRFGRNGLSDFQLHPFFEGIDWNTIRDSNPPYVPEVSSPEDTSNFDVDVCEDDFTPCETQPPRVLAAFTGNHLPFVGFSYTHGSLLSDARSLTDEIR--AIAQRCQGDAELM----EKSVDGFMVELENEK---AELVQKLKEAQTIIAQHVAENPRSEE-DRNYESTIAQLKDEIQILNKRLEDEALAQQQQKPKDEIVAES--EKKLKELKERNKQLVMEKSEIQRELDNINDHLDQVLVEKATVVQQRDDMQAELADVGDSLLTEKDSVKRLQDEAEKAKKQVADFEEKLKEIETEKIALIKKQEEVTIEARKSVETDDHLSEEVVAAKNTIASLQATNE---ERETEIKKLKQRMDEERASHTAQSEQEMKQLEAHY-ERAQKMLQDNVEQMNVENRGLRDEIEKLSQQMAALPRGGLNE-----QQLH-EIFNWVSEEKATREEMENLTRKITGEVESLKNNSPLTTSNYIQNTPSGWGSRRMNNVARKDGLDLQRQLQAEIDAKLKLKAELKNSQEQYLTSAARLDDTEKRMASLMREVAMLKQQKNIENSSDSAFSSTMGRGDLMISMNNDYEMSNSSLMRQEMISRQSTPSYENAILLHDHQVPKRVDDLRYKQKPMKTASGIFSPVSISAMERGHNFERMKIKTPTKCGHCTSILIGLDRQGLFCQSCQYACHVSCAERV-SQSCPVPEEERRPLGIDPTRGVGTAYEGLVKTPRAGGVRKGWQTAYVVVCDFKLYLYDCTVDRQ-NKMQDVKNEIRLVLDMRDPDFTVCGVSEADVIHAQKGDIPKIFRVTTTQILNSSSEYSSSSKFYTLFMAETEEEKRKWVVALSELKTLLRRSKLADRKAFLVKEVFDVTTLP-SIRVAQCCAIIDRSKIVIGFSDHGLYCIEISRQLLIPVGGEKENKQRCVETVEYDEAEQLLMMIVGPAKDRHVRIVPSAALDG-RDLKWIKVNDTKGCHLLAVGTN--NPGGRAGFFA-----------------------VAFKKSVTIFQIDRSEKRHKKWKDLAMPGTPQSIAI--FNGRLYVGFSHSFRSWSLVGVDSSPVGSGDASGAVLQHISLVNMEDTSLQFLNQQTSYEAKLIVNVPGSPDEYLLVFNMIGLYVNEMGRRSRLPEVMFPTQAKYFAYHEPYLCVFSENEVDIFNVTLAE----WVQTINLRSAKPLSGDG-ILSTC---LCNDSPIFVLLQNVLQDQDSIEVPVNLASGSTD---GRKVTRRKFTF----------------------RTIGKDDRSASERRSHIQISTPSDFMHIVHMGP 1556          
BLAST of Serine/threonine kinase vs. Ensembl Celegans
Match: mrck-1 (Serine/threonine-protein kinase mrck-1 [Source:UniProtKB/Swiss-Prot;Acc:O01583])

HSP 1 Score: 623.239 bits (1606), Expect = 0.000e+0
Identity = 487/1631 (29.86%), Postives = 806/1631 (49.42%), Query Frame = 2
Query:   74 IKEFLLNYKSSVPDSVTLEFLIDSLFCTYYECRLPFHKDEKNVAQFIKSIKGTVDKIESLRIRRSDFDTIRVIGRGAFGKVSVVRFKEKGEIYAMKSLHKYDILKKIDAACFQEERDVLFQAMKIKSPWITRLHYAFQDEFYLYFVMDFYNGGDMLTLLSKFNDRLPEEITKFYIAEVVMSIDVVHKLGYLHRDIKPDNLLLDSLGHIVLADFGSCVKLRPNGTTITERAVGTPDYISPEILRSAE-GHGPYGVECDWWSLGIVIHEMLYGELPFYNEDFSETYWQIMNFETCFQIPTEYDD--VSDEAEDLIKQLICKKECRLGNKGIDDFKNHPFFREIDWDNLRSYNAPFIPEVSSAEDTSNFEFD----DFNA---NHEGPPLSSNFKGCHLPCIGFTFTKDFIFNEMGSEESSVRLKSLMENIGAPALLNGNHNESNSDALLEEVNQLKITCSQLEKQLNECRTNSVQRIFSHPVYQQLVTDKEKLLTQCQNY---------DYSLREKEQKMDDLIETNRLLNKERDELTSDRLQILQKKQDIEEDLKVMTENFNQLKSTNKAINRXXXXXXXXXXXXXXXXXXXXXXXXHLSIQKNQSQP----------DIQVEK----QRFEEVMLQLRS--ENDQMLEKMRLKCSNLTNSLEQSDQTIFNIKEEIKSLKEIFTNKEKNLKLSHDNEIEQLKISVAEEQSRILASNTQ--------LKSQVKSLSEENVEL-RSSLQEISNKNMKFHFRLKTILDKEIVKTSENSELLTELDREVELLKT---LCVDN--DGDQKAQGERQDNN--GNESWRLRKCVKAD-------KIEISNLNLTLQSERRARADLEKKLTQQKSEICDISKQL-------EKYKQDVNEKDNLIANLKSASQNLEPHVPKEIPSNPVTLSEFNSIL-----------------------SGSLDKTVVNCNQ--HVFSHSTFNRPIKCDYCTSHMLGQYYQGVKCKECSFSCHHYCLSNVLNDKCYTRKSAGK--GANLKNGIGTMYENFIKVPKPGGIRRGWKRQFMALCDLKLFFFDVKEGSTGTQMPDISRNPCRVIDLKYTEFKVVKVSRDEVMHAPKKDVEFIIKISIEN-------SSTMLPIYVLF--ESVDNKEDCIKVIEEARSYIKKDPHY-RMIFTEKSCLNNLDISMNYRQILSAAIIDQSTLLFG-TEEGLLKVTDS-------GYNKIGEKKPVYIIESLDQQELQLVAVIQSKQRVLKLLLSGILDGAHDWEPIIVENGKSCTTFVVGKSYVSPGNQFAPYADTMLANSTFHIKSPSNDRIWIMCAAFKNSVEVYHLNLKLTRHEKLRQILCNTSVTSLQIAGHGEQLLIGMHDSVAIYSLW-----ETGSPXXXXXXXXXXXXXN-----FQYI-FQTNFESMLIVEI--SFNEYLILFECAGIFINRNHRQTR-PDLQWPDKPTRFTYRAPYLLCFTE-MAGLFAYEITEHSCNLVQALPLRSSKPLDRSGHILTTANEFIQAIDLIYVHLVSANEEKISIGKTIDKTSSSNTLSIFKFLNKRKPSYNKQEDSFDTNDAISPNPAGNSTKSTGLKYRDKPTLKSNRQISVPQNFRHLSHMGP 4591
            ++   ++  S  P++++ E LIDSL C Y EC     + EK +A+F++S+K  + K + LR+ R DF+ ++VIG+GAFG+V+VVR +  GEIYAMK L+K++++K+ + ACF+EERDVL    +    WIT LHYAFQDE  LYFVMD+Y GGDMLTLLSKF D +PE + KFYIAE+V++ID +H+LGY+HRD+KPDN+LLD  GHI LADFGSC+++  +G+  +  AVGTPDYISPEILR+ E G G YG ECDWWSLGI ++EMLYG  PFY+E   +TY +IM+ +     P +  D  VS+EA+DLI+QLIC  + R G  G+ DF+ HPFF  IDW+ +R  N P++PEVSS EDTSNF+ D    DF       + P + + F G HLP +GF++T   + ++  S    +R  ++ +     A L     E + D  + E+   K   ++L ++L E +T   Q +  +P  ++   + E  + Q ++          D +L +++QK  D I       K+  EL     Q++ +K +I+ +L  + ++ +Q+      + +++D ++ EL  +    + EK+ +K L  +  +++           +I+ EK    ++ EEV ++ R   E D  L +  +   N   SL+ +++     + EIK LK+    +  +     + E++QL+    E   ++L  N +        L+ +++ LS++   L R  L E      + H  +   + +E     E   L  ++  EVE LK    L   N         G R+ NN    +   L++ ++A+       K E+ N      +      D EK++     E+  + +Q          +   +   D +I+       +    + +E+ S   T S  N+IL                       SG      ++  +  H F       P KC +CTS ++G   QG+ C+ C ++CH  C   V +  C   +   +  G +   G+GT YE  +K P+ GG+R+GW+  ++ +CD KL+ +D        +M D+      V+D++  +F V  VS  +V+HA K D+  I +++           S+    Y LF  E+ + K   +  + E ++ +++     R  F  K   +   +  + R     AIID+S ++ G ++ GL  +  S       G  K  +++ V  +E  + ++L ++ V  +K R ++++ S  LDG  D + I V + K C    VG +  +PG +   +A                        AFK SV ++ ++    RH+K + +    +  S+ I     +L +G   S   +SL        GS             +N      Q++  QT++E+ LIV +  S +EYL++F   G+++N   R++R P++ +P +   F Y  PYL  F+E    +F   + E     VQ + LRS+KPL   G IL+T    +     I+V L +  +++ SI   ++  S S      + + +RK ++                      ++ G   R     +S+ QIS P +F H+ HMGP
Sbjct:   17 LENIYMDGPSKKPEALSFETLIDSLICLYDECCNSTLRKEKCIAEFVESVKTVISKAKKLRLSRDDFEVLKVIGKGAFGEVAVVRMRGVGEIYAMKILNKWEMVKRAETACFREERDVLVYGDR---RWITNLHYAFQDEKNLYFVMDYYIGGDMLTLLSKFVDHIPESMAKFYIAEMVLAIDSLHRLGYVHRDVKPDNVLLDMQGHIRLADFGSCLRILADGSVASNVAVGTPDYISPEILRAMEDGRGRYGKECDWWSLGICMYEMLYGTTPFYSERLVDTYGKIMSHQDMLDFPDDEIDWVVSEEAKDLIRQLICSSDVRFGRNGLSDFQLHPFFEGIDWNTIRDSNPPYVPEVSSPEDTSNFDVDVCEDDFTPCLQETQPPRVLAAFTGNHLPFVGFSYTHGSLLSDARSLTDEIR--AIAQRCQGDAELM----EKSVDGFMVELENEK---AELVQKLKEAQTIIAQHVAENPRSEE-DRNYESTIAQLKDEIQILNKRLEDEALAQQQQKPKDEIVAES--EKKLKELKERNKQLVMEKSEIQRELDNINDHLDQVLVEKATVVQQRDDMQAELADVGDSLLTEKDSVKRLQDEAEKAKKQVADFEEKLKEIETEKIALIKKQEEVTIEARKSVETDDHLSEEVVAAKNTIASLQATNE---ERETEIKKLKQRMDEERASHTAQSEQEMKQLEAHY-ERAQKMLQDNVEQMNVENRGLRDEIEKLSQQMAALPRGGLNE-----QQLH-EIFNWVSEEKATREEMENLTRKITGEVESLKNNSPLTTSNYIQNTPSGWGSRRMNNVARKDGLDLQRQLQAEIDAKLKLKAELKNSQEQYLTSAARLDDTEKRMASLMREVAMLKQQKNIENSSDSAFSSTMGRGDLMISMNNDYEMSNSSLMRQEMISRQSTPSYENAILLHDHQVPKRVDDLRYKQKPMKTASGIFSPVSISAMERGHNFERMKIKTPTKCGHCTSILIGLDRQGLFCQSCQYACHVSCAERV-SQSCPVPEEERRPLGIDPTRGVGTAYEGLVKTPRAGGVRKGWQTAYVVVCDFKLYLYDCTVDRQ-NKMQDVKNEIRLVLDMRDPDFTVCGVSEADVIHAQKGDIPKIFRVTTTQILNSSSEYSSSSKFYTLFMAETEEEKRKWVVALSELKTLLRRSKLADRKAFLVKEVFDVTTLP-SIRVAQCCAIIDRSKIVIGFSDHGLYCIEISRQLLIPVGGEKENKQRCVETVEYDEAEQLLMMIVGPAKDRHVRIVPSAALDG-RDLKWIKVNDTKGCHLLAVGTN--NPGGRAGFFA-----------------------VAFKKSVTIFQIDRSEKRHKKWKDLAMPGTPQSIAI--FNGRLYVGFSHSFRSWSLVGVDSSPVGSGDASGAVLQHISLVNMEDTSLQFLNQQTSYEAKLIVNVPGSPDEYLLVFNMIGLYVNEMGRRSRLPEVMFPTQAKYFAYHEPYLCVFSENEVDIFNVTLAE----WVQTINLRSAKPLSGDG-ILSTC---LCNDSPIFVLLQNVLQDQDSIEVPVNLASGSTD---GRKVTRRKFTF----------------------RTIGKDDRSASERRSHIQISTPSDFMHIVHMGP 1558          
BLAST of Serine/threonine kinase vs. Ensembl Celegans
Match: mrck-1 (Serine/threonine-protein kinase mrck-1 [Source:UniProtKB/Swiss-Prot;Acc:O01583])

HSP 1 Score: 623.239 bits (1606), Expect = 0.000e+0
Identity = 487/1631 (29.86%), Postives = 806/1631 (49.42%), Query Frame = 2
Query:   74 IKEFLLNYKSSVPDSVTLEFLIDSLFCTYYECRLPFHKDEKNVAQFIKSIKGTVDKIESLRIRRSDFDTIRVIGRGAFGKVSVVRFKEKGEIYAMKSLHKYDILKKIDAACFQEERDVLFQAMKIKSPWITRLHYAFQDEFYLYFVMDFYNGGDMLTLLSKFNDRLPEEITKFYIAEVVMSIDVVHKLGYLHRDIKPDNLLLDSLGHIVLADFGSCVKLRPNGTTITERAVGTPDYISPEILRSAE-GHGPYGVECDWWSLGIVIHEMLYGELPFYNEDFSETYWQIMNFETCFQIPTEYDD--VSDEAEDLIKQLICKKECRLGNKGIDDFKNHPFFREIDWDNLRSYNAPFIPEVSSAEDTSNFEFD----DFNA---NHEGPPLSSNFKGCHLPCIGFTFTKDFIFNEMGSEESSVRLKSLMENIGAPALLNGNHNESNSDALLEEVNQLKITCSQLEKQLNECRTNSVQRIFSHPVYQQLVTDKEKLLTQCQNY---------DYSLREKEQKMDDLIETNRLLNKERDELTSDRLQILQKKQDIEEDLKVMTENFNQLKSTNKAINRXXXXXXXXXXXXXXXXXXXXXXXXHLSIQKNQSQP----------DIQVEK----QRFEEVMLQLRS--ENDQMLEKMRLKCSNLTNSLEQSDQTIFNIKEEIKSLKEIFTNKEKNLKLSHDNEIEQLKISVAEEQSRILASNTQ--------LKSQVKSLSEENVEL-RSSLQEISNKNMKFHFRLKTILDKEIVKTSENSELLTELDREVELLKT---LCVDN--DGDQKAQGERQDNN--GNESWRLRKCVKAD-------KIEISNLNLTLQSERRARADLEKKLTQQKSEICDISKQL-------EKYKQDVNEKDNLIANLKSASQNLEPHVPKEIPSNPVTLSEFNSIL-----------------------SGSLDKTVVNCNQ--HVFSHSTFNRPIKCDYCTSHMLGQYYQGVKCKECSFSCHHYCLSNVLNDKCYTRKSAGK--GANLKNGIGTMYENFIKVPKPGGIRRGWKRQFMALCDLKLFFFDVKEGSTGTQMPDISRNPCRVIDLKYTEFKVVKVSRDEVMHAPKKDVEFIIKISIEN-------SSTMLPIYVLF--ESVDNKEDCIKVIEEARSYIKKDPHY-RMIFTEKSCLNNLDISMNYRQILSAAIIDQSTLLFG-TEEGLLKVTDS-------GYNKIGEKKPVYIIESLDQQELQLVAVIQSKQRVLKLLLSGILDGAHDWEPIIVENGKSCTTFVVGKSYVSPGNQFAPYADTMLANSTFHIKSPSNDRIWIMCAAFKNSVEVYHLNLKLTRHEKLRQILCNTSVTSLQIAGHGEQLLIGMHDSVAIYSLW-----ETGSPXXXXXXXXXXXXXN-----FQYI-FQTNFESMLIVEI--SFNEYLILFECAGIFINRNHRQTR-PDLQWPDKPTRFTYRAPYLLCFTE-MAGLFAYEITEHSCNLVQALPLRSSKPLDRSGHILTTANEFIQAIDLIYVHLVSANEEKISIGKTIDKTSSSNTLSIFKFLNKRKPSYNKQEDSFDTNDAISPNPAGNSTKSTGLKYRDKPTLKSNRQISVPQNFRHLSHMGP 4591
            ++   ++  S  P++++ E LIDSL C Y EC     + EK +A+F++S+K  + K + LR+ R DF+ ++VIG+GAFG+V+VVR +  GEIYAMK L+K++++K+ + ACF+EERDVL    +    WIT LHYAFQDE  LYFVMD+Y GGDMLTLLSKF D +PE + KFYIAE+V++ID +H+LGY+HRD+KPDN+LLD  GHI LADFGSC+++  +G+  +  AVGTPDYISPEILR+ E G G YG ECDWWSLGI ++EMLYG  PFY+E   +TY +IM+ +     P +  D  VS+EA+DLI+QLIC  + R G  G+ DF+ HPFF  IDW+ +R  N P++PEVSS EDTSNF+ D    DF       + P + + F G HLP +GF++T   + ++  S    +R  ++ +     A L     E + D  + E+   K   ++L ++L E +T   Q +  +P  ++   + E  + Q ++          D +L +++QK  D I       K+  EL     Q++ +K +I+ +L  + ++ +Q+      + +++D ++ EL  +    + EK+ +K L  +  +++           +I+ EK    ++ EEV ++ R   E D  L +  +   N   SL+ +++     + EIK LK+    +  +     + E++QL+    E   ++L  N +        L+ +++ LS++   L R  L E      + H  +   + +E     E   L  ++  EVE LK    L   N         G R+ NN    +   L++ ++A+       K E+ N      +      D EK++     E+  + +Q          +   +   D +I+       +    + +E+ S   T S  N+IL                       SG      ++  +  H F       P KC +CTS ++G   QG+ C+ C ++CH  C   V +  C   +   +  G +   G+GT YE  +K P+ GG+R+GW+  ++ +CD KL+ +D        +M D+      V+D++  +F V  VS  +V+HA K D+  I +++           S+    Y LF  E+ + K   +  + E ++ +++     R  F  K   +   +  + R     AIID+S ++ G ++ GL  +  S       G  K  +++ V  +E  + ++L ++ V  +K R ++++ S  LDG  D + I V + K C    VG +  +PG +   +A                        AFK SV ++ ++    RH+K + +    +  S+ I     +L +G   S   +SL        GS             +N      Q++  QT++E+ LIV +  S +EYL++F   G+++N   R++R P++ +P +   F Y  PYL  F+E    +F   + E     VQ + LRS+KPL   G IL+T    +     I+V L +  +++ SI   ++  S S      + + +RK ++                      ++ G   R     +S+ QIS P +F H+ HMGP
Sbjct:   17 LENIYMDGPSKKPEALSFETLIDSLICLYDECCNSTLRKEKCIAEFVESVKTVISKAKKLRLSRDDFEVLKVIGKGAFGEVAVVRMRGVGEIYAMKILNKWEMVKRAETACFREERDVLVYGDR---RWITNLHYAFQDEKNLYFVMDYYIGGDMLTLLSKFVDHIPESMAKFYIAEMVLAIDSLHRLGYVHRDVKPDNVLLDMQGHIRLADFGSCLRILADGSVASNVAVGTPDYISPEILRAMEDGRGRYGKECDWWSLGICMYEMLYGTTPFYSERLVDTYGKIMSHQDMLDFPDDEIDWVVSEEAKDLIRQLICSSDVRFGRNGLSDFQLHPFFEGIDWNTIRDSNPPYVPEVSSPEDTSNFDVDVCEDDFTPCLQETQPPRVLAAFTGNHLPFVGFSYTHGSLLSDARSLTDEIR--AIAQRCQGDAELM----EKSVDGFMVELENEK---AELVQKLKEAQTIIAQHVAENPRSEE-DRNYESTIAQLKDEIQILNKRLEDEALAQQQQKPKDEIVAES--EKKLKELKERNKQLVMEKSEIQRELDNINDHLDQVLVEKATVVQQRDDMQAELADVGDSLLTEKDSVKRLQDEAEKAKKQVADFEEKLKEIETEKIALIKKQEEVTIEARKSVETDDHLSEEVVAAKNTIASLQATNE---ERETEIKKLKQRMDEERASHTAQSEQEMKQLEAHY-ERAQKMLQDNVEQMNVENRGLRDEIEKLSQQMAALPRGGLNE-----QQLH-EIFNWVSEEKATREEMENLTRKITGEVESLKNNSPLTTSNYIQNTPSGWGSRRMNNVARKDGLDLQRQLQAEIDAKLKLKAELKNSQEQYLTSAARLDDTEKRMASLMREVAMLKQQKNIENSSDSAFSSTMGRGDLMISMNNDYEMSNSSLMRQEMISRQSTPSYENAILLHDHQVPKRVDDLRYKQKPMKTASGIFSPVSISAMERGHNFERMKIKTPTKCGHCTSILIGLDRQGLFCQSCQYACHVSCAERV-SQSCPVPEEERRPLGIDPTRGVGTAYEGLVKTPRAGGVRKGWQTAYVVVCDFKLYLYDCTVDRQ-NKMQDVKNEIRLVLDMRDPDFTVCGVSEADVIHAQKGDIPKIFRVTTTQILNSSSEYSSSSKFYTLFMAETEEEKRKWVVALSELKTLLRRSKLADRKAFLVKEVFDVTTLP-SIRVAQCCAIIDRSKIVIGFSDHGLYCIEISRQLLIPVGGEKENKQRCVETVEYDEAEQLLMMIVGPAKDRHVRIVPSAALDG-RDLKWIKVNDTKGCHLLAVGTN--NPGGRAGFFA-----------------------VAFKKSVTIFQIDRSEKRHKKWKDLAMPGTPQSIAI--FNGRLYVGFSHSFRSWSLVGVDSSPVGSGDASGAVLQHISLVNMEDTSLQFLNQQTSYEAKLIVNVPGSPDEYLLVFNMIGLYVNEMGRRSRLPEVMFPTQAKYFAYHEPYLCVFSENEVDIFNVTLAE----WVQTINLRSAKPLSGDG-ILSTC---LCNDSPIFVLLQNVLQDQDSIEVPVNLASGSTD---GRKVTRRKFTF----------------------RTIGKDDRSASERRSHIQISTPSDFMHIVHMGP 1558          
BLAST of Serine/threonine kinase vs. Ensembl Celegans
Match: let-502 (Rho-associated protein kinase let-502 [Source:UniProtKB/Swiss-Prot;Acc:P92199])

HSP 1 Score: 344.739 bits (883), Expect = 7.598e-98
Identity = 169/415 (40.72%), Postives = 254/415 (61.20%), Query Frame = 2
Query:  119 VTLEFLIDSLFCTYYECRLPFHKDEKNVAQFIKSIKGTVDKIESLRIRRSDFDTIRVIGRGAFGKVSVVRFKEKGEIYAMKSLHKYDILKKIDAACFQEERDVLFQAMKIKSPWITRLHYAFQDEFYLYFVMDFYNGGDMLTLLSKFNDRLPEEITKFYIAEVVMSIDVVHKLGYLHRDIKPDNLLLDSLGHIVLADFGSCVKLRPNGTTITERAVGTPDYISPEILRSAEGHGPYGVECDWWSLGIVIHEMLYGELPFYNEDFSETYWQIMNFETCFQIPTEYDDVSDEAEDLIKQLICKKECRLGNKGIDDFKNHPFFREIDWD--NLRSYNAPFIPEVSSAEDTSNF-EFDDFNANHEGP-PLSSNFKGCHLPCIGFTFTKDFIFNEMGSEESSVRLKSLMENIGAPALLNG 1351
            + +E L+D++     +C++P     K+V  FI   +  V+ + +LR++ +DF  ++VIGRGAFG+V +VR      +YAMK L+K D++K+ D+A F EERD++  A    S WI RL YAFQD  +LY VM++  GGD++ L++ +   + E+ T+FY AE+V ++  +H +GY+HRD+KPDN+L+   GHI LADFG+CVK+  NG      AVGTPDYISPE+LR+      +G E DWWS+G+ I+EML GE PFY E    TY  IMN +T  + P E   +S +A+D+IK+ +     RLG   +DD +NH FF   +W    LR  + P IP + S +DT++F E +  + ++ G   L   F G  LP IGFT++ ++             +K+L++  GA +  NG
Sbjct:   17 INIESLLDTITALVNDCKIPVLMRMKSVDNFISRYERVVESLAALRMKAADFRQLKVIGRGAFGEVHLVRHTRTNTVYAMKMLNKDDMIKRADSAFFWEERDIMAHA---NSEWIVRLQYAFQDPRHLYMVMEYMPGGDLVNLMTSYE--VSEKWTRFYTAEIVEALAALHSMGYIHRDVKPDNMLISISGHIKLADFGTCVKMNANGVVRCSTAVGTPDYISPEVLRNQGQDAEFGKEVDWWSVGVFIYEMLVGETPFYAEALVSTYTNIMNHKTSLKFPDE-PLISTQAKDIIKKFLSAAPDRLGRNSVDDIRNHKFFVNDEWTFATLREASPPVIPSLKSDDDTTHFEEIETRDRDNAGDFQLPKTFNGNQLPFIGFTYSNEY-----------SPVKNLLKGHGAGSKQNG 414          
BLAST of Serine/threonine kinase vs. Ensembl Fly
Match: gek (gene:FBgn0023081 transcript:FBtr0072287)

HSP 1 Score: 616.305 bits (1588), Expect = 0.000e+0
Identity = 495/1619 (30.57%), Postives = 799/1619 (49.35%), Query Frame = 2
Query:  122 TLEFLIDSLFCTYYECRLPFHKDEKNVAQFIKSIKGTVDKIESLRIRRSDFDTIRVIGRGAFGKVSVVRFKEKGEIYAMKSLHKYDILKKIDAACFQEERDVLFQAMKIKSPWITRLHYAFQDEFYLYFVMDFYNGGDMLTLLSKFNDRLPEEITKFYIAEVVMSIDVVHKLGYLHRDIKPDNLLLDSLGHIVLADFGSCVKLRPNGTTITERAVGTPDYISPEILRSAE-GHGPYGVECDWWSLGIVIHEMLYGELPFYNEDFSETYWQIMNFETCFQIPTEYD---DVSDEAEDLIKQLICKKECRLGNKGIDDFKNHPFFREIDWDNLRSYNAPFIPEVSSAEDTSNFEFDDFNAN-HEGPPLSSN--FKGCHLPCIGFTFTKDFIFNEMGSE-ESSVRLKSLMENIGAP--ALLNGNHNESNSD-----ALLEEVNQLKITCSQLEKQLNEC-----------RTNSVQRIFSHPVYQQLVTDKEKLLTQCQNYDYSLREKEQKMDDLIETNRLLNKERDELTSDRLQILQKKQDIEEDLKVMTENFNQLKSTNKAINRXXXXXXXXXXXXXXXXXXXXXXXXHLSIQKNQSQPDIQVEKQRFEEVMLQLRSENDQMLEKMRLKCSNLTNSLEQSDQTIFNIKEEIK--SLKEIFTNKEKNLKLSHDNEIEQLKISVAEEQSRILASNTQLKSQ-VKSLSEEN----VELRSSLQEISNKNMKFHFRLKTILDKEIVKTSENSELLTELDREVELLKTLC------VDNDGDQKAQGERQDNNG--NESWRLRKCVKADKI---EISNLNLTLQSERRARADLEKK-------LTQQKSEICDISKQLEKYKQDVNEK--------------------------------DNLIANL--------------KSASQNLEPHVP-KEIPSNPVTLSEFNSILSGSLDKTVVNCNQHVFSHSTFNRPIKCDYCTSHMLGQYYQGVKCKECSFSCHHYCLSNVLNDKCYTRKSAGK---GANLKNGIGTMYENFIKVPKPGGIRRGWKRQFMALCDLKLFFFDVKEGSTGTQMPDISRNPCRVIDLKYTEFKVVKVSRDEVMHAPKKDVE--FIIKISIENSSTMLPIYVLFESVDNKEDCIKVIEEARSYIKKD--PHYRMIFTEKSCLNNLDISMNYRQILSAAIIDQSTLLFGTEEGLLKVTDSGYN--KIGEKKPVYIIESLDQQELQLVAVIQSKQRVLKLLLSGILDGAHDWEPIIVENGKSCTTFVVGKSYVSPGNQFAPYADTMLANSTFHIKSPSNDRIWIMCAAFKNSVEVYHLNLKLTRHEKLRQILCNTSVTSLQIAGHGEQLLIGMHDSVAIYSLWETGSPXXXXXXXXXXXXXNFQYIFQTNFESMLIVEI------SFNEYLILFECAGIFINRNHRQTRP-DLQWPDKPTRFTYRAPYLLCFTEM-AGLFAYEITEHSCNLVQALPLRSSKPLDRSGH-ILTTANEFIQAIDLIYVHLVSANEEKISIGKTIDKTSSSNTLSIFKFLNKRK-PSYNKQEDSFDTNDAISPNPAGNSTKSTGLKYRDKPTLKSNRQISVPQNFRHLSHMGPDVPCQ---LIDL 4618
            +L++L+D+    Y EC     + EK V+ F+K  K  V  +  LR+ R DFD +++IGRGAFG+V VV+     ++YAMK L+K+++LK+ + ACF+EERDVL    +    WIT LHYAFQD   LY VMD+Y GGD+LTLLSKF D+LPE++ KFYI E++++I+ +H++ Y+HRDIKPDN+LLD  GH+ LADFGSC++L  +GT  +  AVGTPDYISPEILR+ E G G YG ECDWWSLG+ ++EMLYGE PFY E   ETY +IMN + CF +P++      VS+ ++DL+ +LIC  E RLG  GI DF +HP+F  IDW N+R   AP++PEVSS  DTSNF+ DD +    +  P S+N  F G HLP IGFTF+          + +SS      ++ I +P  A+L  N++E+  D     AL +++  LK   ++L KQ NE            +    QR  +   Y ++     +L  Q Q     +R+KE+++D  ++ N  L  E           L+K      +L++  E+     +  K +    +    +L    ++     E    LSI    S  +I+  + +F E +   ++ ++  LE +R + S L N+     + +   +E +K   ++ I  + E  L+L   +++E  K S  EE+ R L+S   LKS+ +K L  E+     ELR   + I+    +    ++ + D++  +    + L T++  E+E LK +       VDN   +  + ++ D     N    L++ ++A  +   E+S     L S ++   D +K+         ++++E+ D+ K   +Y +    K                                DN   N               K A +N + H   KE   + ++  E + ++  S  K   N   H F   TF+ P KC++CTS M+G   QGV C+ C F+CH  C   V    C       K   G +   GIGT YE ++KVPK G I+RGW RQF+ +CD KLF +D+        +P +S +  +V+D++  EF V  V   +V+HA KKDV   F IK ++ +    L   +L ++   K   +  + E    +K++  P+   IF     L+N  +S+  R  L + II  + +L GTE+GL  +    Y   +IGE K +  +  ++++  Q++ ++  KQR L+LL    L+ A D E I V   K+C +   G     P          ++ +    +K P+N             + VY +N   TRH+K  +         LQI     +L++        Y L    + + L+H + +       ++  +  +++ ++EI      +F EYL++F+   I+++   R++R  ++ +P  PT  T+   +LL F++    +F  +  E     VQ++ L+ S PL+  G+ +L++ N+    + L  +H                    +  L  ++  N++  PS  ++    + N  I  +                   + ++ IS P NF H+SHMGP    Q   L+DL
Sbjct:   50 SLDYLLDTFIVLYDECSNSSLRREKGVSDFLKLSKPFVHIVRKLRLSRDDFDILKIIGRGAFGEVCVVQMISTEKVYAMKILNKWEMLKRAETACFREERDVLVFGDR---QWITNLHYAFQDNINLYLVMDYYCGGDLLTLLSKFEDKLPEDMAKFYITEMILAINSIHQIRYVHRDIKPDNVLLDKRGHVRLADFGSCLRLDKDGTVQSNVAVGTPDYISPEILRAMEDGKGRYGTECDWWSLGVCMYEMLYGETPFYAESLVETYGKIMNHQNCFNLPSQETLNYKVSETSQDLLCKLICIPENRLGQNGIQDFMDHPWFVGIDWKNIRQGPAPYVPEVSSPTDTSNFDVDDNDVRLTDSIPPSANPAFSGFHLPFIGFTFSLTSSSTLDSKKNQSSGFGDDTLDTISSPQLAILPSNNSETPVDSVQLKALNDQLAALKQEKAELSKQHNEVFERLKTQDSELQDAISQRNIAMMEYSEVTEKLSELRNQKQKLSRQVRDKEEELDGAMQKNDSLRNE-----------LRKSDKTRRELELHIEDAVIEAAKEKKLREHAEDCCRQLQMELRKGSSSVETTMPLSISSEMSSYEIERLELQFSEKLSHQQTRHNMELEALREQFSELENANLALTKELQQTQERLKYTQMESITDSAETLLELKKQHDLE--KSSWFEEKQR-LSSEVNLKSKSLKELQAEDDEIFKELRMKREAITLWERQMAEIIQWVSDEKDARGYLQA-LATKMTEELEYLKHVGTFNNNGVDNKNWRNRRSQKLDKMELLNLQSALQREIQAKNMISDELSQTRSDLISTQKEVRDYKKRYDSILHDFQKKETELRDLQKGGLEYSESFLNKSTHHGLSSAFFRDMSKNSEIIDSAESFGNESGDNFTPNFFQSGNSGMLFNYEPKYAGKNNKDHSSMKEASVSDLSREESDQLVKESQKKVPGNTAIHQFLVRTFSSPTKCNHCTSLMVGLTRQGVVCEICGFACHTICCQKVPT-TCPVPMDQTKRPLGIDPTRGIGTAYEGYVKVPKSGVIKRGWIRQFVVVCDFKLFLYDISPDRCA--LPSVSVS--QVLDMRDPEFSVGSVRESDVIHAAKKDVPCIFKIKTALIDGGLSLNTLMLADNESEKSKWVIALGELHRILKRNSLPN-TAIFKVNEILDNT-LSL-IRNALCSVIIYPNQILLGTEDGLFYINLDQYEIARIGESKKILQLWYIEEE--QILVILCGKQRNLRLLPIRALE-ASDVEWIKVVESKNCISACTGIIRRFP---------NIVYSFIIALKRPNN----------HTQIVVYEINRTRTRHQKTCEFTIGYMAQHLQILSD-MRLVVAHQSGFTAYFLRGEATAMSLVHPENQLCA----FLNYSGVDAVRVIEILCPSGGNFGEYLLVFQTLAIYVDLQGRKSRDREIMYPAFPTYITFCDGHLLVFSDTHLDIFNTQTAE----WVQSIGLKQSLPLNNLGNVVLSSVNDTPLIVYLSNIH--------------------TKGLLQYRDGNRKGLPSIKRRFSIREINKTIKSD-------------------RRSKMISAPTNFNHISHMGPGDGIQNQRLLDL 1572          
BLAST of Serine/threonine kinase vs. Ensembl Fly
Match: Rok (gene:FBgn0026181 transcript:FBtr0074286)

HSP 1 Score: 368.237 bits (944), Expect = 2.172e-104
Identity = 212/567 (37.39%), Postives = 331/567 (58.38%), Query Frame = 2
Query:  110 PDSV-TLEFLIDSLFCTYYECRLPFHKDEKNVAQFIKSIKGTVDKIESLRIRRSDFDTIRVIGRGAFGKVSVVRFKEKGEIYAMKSLHKYDILKKIDAACFQEERDVLFQAMKIKSPWITRLHYAFQDEFYLYFVMDFYNGGDMLTLLSKFNDRLPEEITKFYIAEVVMSIDVVHKLGYLHRDIKPDNLLLDSLGHIVLADFGSCVKLRPNGTTITERAVGTPDYISPEILRSAEGHGPYGVECDWWSLGIVIHEMLYGELPFYNEDFSETYWQIMNFETCFQIPTEYDDVSDEAEDLIKQLICKKECRLGNKGIDDFKNHPFFREIDW--DNLRSYNAPFIPEVSSAEDTSNFE-FDDFNANHEGPPLSSNFKGCHLPCIGFTFTKDFIFNEMGSEESSVRLKSL-MENIGAPALLNGNHNE-----SNSDAL--LEEVNQLKITCSQLEKQLNECRTNSVQRIFSHPV-YQQLVTDKEK-LLTQCQNYDYSLREKEQKMD-------DLIETNRLLNKE-----RDELTSDRLQILQKK-QDIEEDLKVMTENFNQLKSTNKAIN 1729
            P S+  ++ L+D++     +C     +  KN+ Q+    K    +I  LR+   DF  I++IG GAFG+V +VR K   ++YAMK L K++++K+ D+A F EER ++  A    S WI +LH+AFQD  YLY VMDF  GGD+++L+  ++  +PE+   FY  EVV+++D +H +G++HRD+KPDN+LLDS GH+ LADFG+C+++  NG  ++  AVGTPDYISPE+L+S      YG ECDWWS+GI ++EML+GE PFY +    TY +IM+ +     P E  ++S++A+ LI+  +  +  RLG  GI+D K HPFFR   W  DN+R    P +PE+SS +DT NFE  +      E  P+   F G HLP IGFT+T D+    + S+      K   + N GA +  +G+ +      SNS+ L  LE + + +   S+  +Q +      ++ I       Q++ ++ EK L  +  NY  ++++ EQ+++        L+ET R L  E     RD   +D++  L+K+  ++E+  K  TEN  +LK  N  ++
Sbjct:   32 PTSICNVDCLLDTVSALVSDCDHESLRRLKNIEQYAAKYKPLAMQINQLRMNVEDFHFIKLIGAGAFGEVQLVRHKSSSQVYAMKRLSKFEMMKRPDSAFFWEERHIMAHA---NSEWIVQLHFAFQDAKYLYMVMDFMPGGDIVSLMGDYD--IPEKWAIFYTMEVVLALDTIHNMGFVHRDVKPDNMLLDSYGHLKLADFGTCMRMGANGQVVSSNAVGTPDYISPEVLQSQGVDNEYGRECDWWSVGIFLYEMLFGETPFYADSLVGTYGKIMDHKNSLSFPPEV-EISEQAKALIRAFLTDRTQRLGRYGIEDIKAHPFFRNDTWSFDNIRESVPPVVPELSSDDDTRNFEDIERDEKPEEVFPVPKGFDGNHLPFIGFTYTGDYQL--LSSDTVDAESKEANVANSGAASNNHGHGHNHRHRPSNSNELKRLEALLERERGRSEALEQQDAGLRQQIELITKREAELQRIASEYEKDLALRQHNYKVAMQKVEQEIELRKKTEALLVETQRNLENEQKTRARDLNINDKVVSLEKQLLEMEQSYKTETENTQKLKKHNAELD 590          
BLAST of Serine/threonine kinase vs. Ensembl Fly
Match: Rok (gene:FBgn0026181 transcript:FBtr0340152)

HSP 1 Score: 367.851 bits (943), Expect = 2.297e-104
Identity = 212/567 (37.39%), Postives = 331/567 (58.38%), Query Frame = 2
Query:  110 PDSV-TLEFLIDSLFCTYYECRLPFHKDEKNVAQFIKSIKGTVDKIESLRIRRSDFDTIRVIGRGAFGKVSVVRFKEKGEIYAMKSLHKYDILKKIDAACFQEERDVLFQAMKIKSPWITRLHYAFQDEFYLYFVMDFYNGGDMLTLLSKFNDRLPEEITKFYIAEVVMSIDVVHKLGYLHRDIKPDNLLLDSLGHIVLADFGSCVKLRPNGTTITERAVGTPDYISPEILRSAEGHGPYGVECDWWSLGIVIHEMLYGELPFYNEDFSETYWQIMNFETCFQIPTEYDDVSDEAEDLIKQLICKKECRLGNKGIDDFKNHPFFREIDW--DNLRSYNAPFIPEVSSAEDTSNFE-FDDFNANHEGPPLSSNFKGCHLPCIGFTFTKDFIFNEMGSEESSVRLKSL-MENIGAPALLNGNHNE-----SNSDAL--LEEVNQLKITCSQLEKQLNECRTNSVQRIFSHPV-YQQLVTDKEK-LLTQCQNYDYSLREKEQKMD-------DLIETNRLLNKE-----RDELTSDRLQILQKK-QDIEEDLKVMTENFNQLKSTNKAIN 1729
            P S+  ++ L+D++     +C     +  KN+ Q+    K    +I  LR+   DF  I++IG GAFG+V +VR K   ++YAMK L K++++K+ D+A F EER ++  A    S WI +LH+AFQD  YLY VMDF  GGD+++L+  ++  +PE+   FY  EVV+++D +H +G++HRD+KPDN+LLDS GH+ LADFG+C+++  NG  ++  AVGTPDYISPE+L+S      YG ECDWWS+GI ++EML+GE PFY +    TY +IM+ +     P E  ++S++A+ LI+  +  +  RLG  GI+D K HPFFR   W  DN+R    P +PE+SS +DT NFE  +      E  P+   F G HLP IGFT+T D+    + S+      K   + N GA +  +G+ +      SNS+ L  LE + + +   S+  +Q +      ++ I       Q++ ++ EK L  +  NY  ++++ EQ+++        L+ET R L  E     RD   +D++  L+K+  ++E+  K  TEN  +LK  N  ++
Sbjct:   32 PTSICNVDCLLDTVSALVSDCDHESLRRLKNIEQYAAKYKPLAMQINQLRMNVEDFHFIKLIGAGAFGEVQLVRHKSSSQVYAMKRLSKFEMMKRPDSAFFWEERHIMAHA---NSEWIVQLHFAFQDAKYLYMVMDFMPGGDIVSLMGDYD--IPEKWAIFYTMEVVLALDTIHNMGFVHRDVKPDNMLLDSYGHLKLADFGTCMRMGANGQVVSSNAVGTPDYISPEVLQSQGVDNEYGRECDWWSVGIFLYEMLFGETPFYADSLVGTYGKIMDHKNSLSFPPEV-EISEQAKALIRAFLTDRTQRLGRYGIEDIKAHPFFRNDTWSFDNIRESVPPVVPELSSDDDTRNFEDIERDEKPEEVFPVPKGFDGNHLPFIGFTYTGDYQL--LSSDTVDAESKEANVANSGAASNNHGHGHNHRHRPSNSNELKRLEALLERERGRSEALEQQDAGLRQQIELITKREAELQRIASEYEKDLALRQHNYKVAMQKVEQEIELRKKTEALLVETQRNLENEQKTRARDLNINDKVVSLEKQLLEMEQSYKTETENTQKLKKHNAELD 590          
BLAST of Serine/threonine kinase vs. Ensembl Fly
Match: Rok (gene:FBgn0026181 transcript:FBtr0340153)

HSP 1 Score: 367.851 bits (943), Expect = 2.630e-104
Identity = 212/567 (37.39%), Postives = 331/567 (58.38%), Query Frame = 2
Query:  110 PDSV-TLEFLIDSLFCTYYECRLPFHKDEKNVAQFIKSIKGTVDKIESLRIRRSDFDTIRVIGRGAFGKVSVVRFKEKGEIYAMKSLHKYDILKKIDAACFQEERDVLFQAMKIKSPWITRLHYAFQDEFYLYFVMDFYNGGDMLTLLSKFNDRLPEEITKFYIAEVVMSIDVVHKLGYLHRDIKPDNLLLDSLGHIVLADFGSCVKLRPNGTTITERAVGTPDYISPEILRSAEGHGPYGVECDWWSLGIVIHEMLYGELPFYNEDFSETYWQIMNFETCFQIPTEYDDVSDEAEDLIKQLICKKECRLGNKGIDDFKNHPFFREIDW--DNLRSYNAPFIPEVSSAEDTSNFE-FDDFNANHEGPPLSSNFKGCHLPCIGFTFTKDFIFNEMGSEESSVRLKSL-MENIGAPALLNGNHNE-----SNSDAL--LEEVNQLKITCSQLEKQLNECRTNSVQRIFSHPV-YQQLVTDKEK-LLTQCQNYDYSLREKEQKMD-------DLIETNRLLNKE-----RDELTSDRLQILQKK-QDIEEDLKVMTENFNQLKSTNKAIN 1729
            P S+  ++ L+D++     +C     +  KN+ Q+    K    +I  LR+   DF  I++IG GAFG+V +VR K   ++YAMK L K++++K+ D+A F EER ++  A    S WI +LH+AFQD  YLY VMDF  GGD+++L+  ++  +PE+   FY  EVV+++D +H +G++HRD+KPDN+LLDS GH+ LADFG+C+++  NG  ++  AVGTPDYISPE+L+S      YG ECDWWS+GI ++EML+GE PFY +    TY +IM+ +     P E  ++S++A+ LI+  +  +  RLG  GI+D K HPFFR   W  DN+R    P +PE+SS +DT NFE  +      E  P+   F G HLP IGFT+T D+    + S+      K   + N GA +  +G+ +      SNS+ L  LE + + +   S+  +Q +      ++ I       Q++ ++ EK L  +  NY  ++++ EQ+++        L+ET R L  E     RD   +D++  L+K+  ++E+  K  TEN  +LK  N  ++
Sbjct:   23 PTSICNVDCLLDTVSALVSDCDHESLRRLKNIEQYAAKYKPLAMQINQLRMNVEDFHFIKLIGAGAFGEVQLVRHKSSSQVYAMKRLSKFEMMKRPDSAFFWEERHIMAHA---NSEWIVQLHFAFQDAKYLYMVMDFMPGGDIVSLMGDYD--IPEKWAIFYTMEVVLALDTIHNMGFVHRDVKPDNMLLDSYGHLKLADFGTCMRMGANGQVVSSNAVGTPDYISPEVLQSQGVDNEYGRECDWWSVGIFLYEMLFGETPFYADSLVGTYGKIMDHKNSLSFPPEV-EISEQAKALIRAFLTDRTQRLGRYGIEDIKAHPFFRNDTWSFDNIRESVPPVVPELSSDDDTRNFEDIERDEKPEEVFPVPKGFDGNHLPFIGFTYTGDYQL--LSSDTVDAESKEANVANSGAASNNHGHGHNHRHRPSNSNELKRLEALLERERGRSEALEQQDAGLRQQIELITKREAELQRIASEYEKDLALRQHNYKVAMQKVEQEIELRKKTEALLVETQRNLENEQKTRARDLNINDKVVSLEKQLLEMEQSYKTETENTQKLKKHNAELD 581          
BLAST of Serine/threonine kinase vs. Ensembl Fly
Match: Rok (gene:FBgn0026181 transcript:FBtr0340151)

HSP 1 Score: 367.081 bits (941), Expect = 5.729e-104
Identity = 212/567 (37.39%), Postives = 331/567 (58.38%), Query Frame = 2
Query:  110 PDSV-TLEFLIDSLFCTYYECRLPFHKDEKNVAQFIKSIKGTVDKIESLRIRRSDFDTIRVIGRGAFGKVSVVRFKEKGEIYAMKSLHKYDILKKIDAACFQEERDVLFQAMKIKSPWITRLHYAFQDEFYLYFVMDFYNGGDMLTLLSKFNDRLPEEITKFYIAEVVMSIDVVHKLGYLHRDIKPDNLLLDSLGHIVLADFGSCVKLRPNGTTITERAVGTPDYISPEILRSAEGHGPYGVECDWWSLGIVIHEMLYGELPFYNEDFSETYWQIMNFETCFQIPTEYDDVSDEAEDLIKQLICKKECRLGNKGIDDFKNHPFFREIDW--DNLRSYNAPFIPEVSSAEDTSNFE-FDDFNANHEGPPLSSNFKGCHLPCIGFTFTKDFIFNEMGSEESSVRLKSL-MENIGAPALLNGNHNE-----SNSDAL--LEEVNQLKITCSQLEKQLNECRTNSVQRIFSHPV-YQQLVTDKEK-LLTQCQNYDYSLREKEQKMD-------DLIETNRLLNKE-----RDELTSDRLQILQKK-QDIEEDLKVMTENFNQLKSTNKAIN 1729
            P S+  ++ L+D++     +C     +  KN+ Q+    K    +I  LR+   DF  I++IG GAFG+V +VR K   ++YAMK L K++++K+ D+A F EER ++  A    S WI +LH+AFQD  YLY VMDF  GGD+++L+  ++  +PE+   FY  EVV+++D +H +G++HRD+KPDN+LLDS GH+ LADFG+C+++  NG  ++  AVGTPDYISPE+L+S      YG ECDWWS+GI ++EML+GE PFY +    TY +IM+ +     P E  ++S++A+ LI+  +  +  RLG  GI+D K HPFFR   W  DN+R    P +PE+SS +DT NFE  +      E  P+   F G HLP IGFT+T D+    + S+      K   + N GA +  +G+ +      SNS+ L  LE + + +   S+  +Q +      ++ I       Q++ ++ EK L  +  NY  ++++ EQ+++        L+ET R L  E     RD   +D++  L+K+  ++E+  K  TEN  +LK  N  ++
Sbjct:   32 PTSICNVDCLLDTVSALVSDCDHESLRRLKNIEQYAAKYKPLAMQINQLRMNVEDFHFIKLIGAGAFGEVQLVRHKSSSQVYAMKRLSKFEMMKRPDSAFFWEERHIMAHA---NSEWIVQLHFAFQDAKYLYMVMDFMPGGDIVSLMGDYD--IPEKWAIFYTMEVVLALDTIHNMGFVHRDVKPDNMLLDSYGHLKLADFGTCMRMGANGQVVSSNAVGTPDYISPEVLQSQGVDNEYGRECDWWSVGIFLYEMLFGETPFYADSLVGTYGKIMDHKNSLSFPPEV-EISEQAKALIRAFLTDRTQRLGRYGIEDIKAHPFFRNDTWSFDNIRESVPPVVPELSSDDDTRNFEDIERDEKPEEVFPVPKGFDGNHLPFIGFTYTGDYQL--LSSDTVDAESKEANVANSGAASNNHGHGHNHRHRPSNSNELKRLEALLERERGRSEALEQQDAGLRQQIELITKREAELQRIASEYEKDLALRQHNYKVAMQKVEQEIELRKKTEALLVETQRNLENEQKTRARDLNINDKVVSLEKQLLEMEQSYKTETENTQKLKKHNAELD 590          
BLAST of Serine/threonine kinase vs. Ensembl Zebrafish
Match: cdc42bpaa (CDC42 binding protein kinase alpha (DMPK-like) a [Source:ZFIN;Acc:ZDB-GENE-120727-12])

HSP 1 Score: 478.404 bits (1230), Expect = 6.122e-140
Identity = 321/915 (35.08%), Postives = 490/915 (53.55%), Query Frame = 2
Query:  122 TLEFLIDSLFCTYYECRLPFHKDEKNVAQFIKSIKGTVDKIESLRIRRSDFDTIRVIGRGAFGKVSVVRFKEKGEIYAMKSLHKYDILKKIDAACFQEERDVLFQAMKIKSPWITRLHYAFQDEFYLYFVMDFYNGGDMLTLLSKFNDRLPEEITKFYIAEVVMSIDVVHKLGYLHRDIKPDNLLLDSLGHIVLADFGSCVKLRPNGTTITERAVGTPDYISPEILRSAE-GHGPYGVECDWWSLGIVIHEMLYGELPFYNEDFSETYWQIMNFETCFQIPTEYDDVSDEAEDLIKQLICKKECRLGNKGIDDFKNHPFFREIDWDNLRSYNAPFIPEVSSAEDTSNFEFDD---FNANHEGPPLSSNFKGCHLPCIGFTFTKDFIFNEMGSEESSV---------------------------RL--------KSLMENIGAPALLNGNHNESNSDALLE-EVNQLKITCSQLEKQLNECRTNSVQRIFSHPVYQQLVTDKEKLLTQCQNYDYSLREKEQKMDDL-------IETNRLLNKERDELTSDRLQILQKKQDIEEDLKVMTENFNQLKSTNKAINRXXXXXXXXXXXXXXXXXXXXXXXXHLSIQKNQSQPDIQVEK---QRFEEVMLQLRSENDQMLEKMRLKCSNLTNSLEQS----------DQTIFNIKEEIKSLKEIFTNKEKNLK----------LSHDNEIEQLKISVAEEQSRILASNTQLKSQVKSLSEENVELRSSLQEISNKNMKFHFRLKTILDK------------EIVKTSENSE--------LLTELDREVELLKTLCVDNDGDQKAQGERQDNNGNESWRLRKCVKADKIEISNLNLTLQSERRARADLEKKLTQQKSEICDISKQLEKYKQDVNEKDNLIANLKSASQNL 2596
            ++E L+D L C Y EC     + EKNVA+F++  K    K++ +R+ + DF+ ++VIGRGAFG+V+VV+ K   +++AMK L+K+++LK+ + ACF+EERDVL       S WIT LHYAFQD+ +LY VMD+Y GGD+LTLLSKF DRLPE++ +FY+AE+V++ID VH+L Y+HRDIKPDN+L+D  GHI LADFGSC+KL  +GT  +  AVGTPDYISPEIL++ E G G YG ECDWWSLG+ ++EMLYGE PFY E   ETY +IMN +  FQ P +  DVS+ A+DLI++LIC +E RLG  GI+DFK HPFF  IDW N+R+ +AP+IPEVSS  DTSNF+ DD    N     PP  + F G HLP +GFT+T +   ++ G    S                            RL        + L E+  A   L  + ++    +  E E+  LK     L+KQ+ +  T  V++     +  +  +D E    Q ++ +  L+  +Q+ DDL        +  ++  KE  E  S R   +Q+  ++ E +  +     +L    +    E D L  +++ L+    K +   K + +Q  +   + Q EK   +R E+   QL  E D + +K  +  S  T S EQ+          ++   + KEE+  +++   N+ K+LK          LS   EI  LK  + + +    +   +L+ +   LSEEN +L S L ++S  N +   +++ + D+            EI++   + +        L T++  E+E LK   +         G R  +     W++R+  K D      L   L +E +A+  ++ +L + K+       +LE+ ++   +    I  LK  + NL
Sbjct:   27 SVESLLDVLICIYDECTNSPLRREKNVAEFLEWAKPFTSKVKQMRLHKEDFEILKVIGRGAFGEVAVVKVKSSDKVFAMKILNKWEMLKRAETACFREERDVLVNG---DSQWITTLHYAFQDDNFLYLVMDYYVGGDLLTLLSKFEDRLPEDMARFYLAEMVLAIDSVHQLHYVHRDIKPDNILIDVNGHIRLADFGSCLKLTEDGTVQSSVAVGTPDYISPEILQAMEDGKGKYGPECDWWSLGVCMYEMLYGETPFYAESLVETYGKIMNHKERFQFPAQMTDVSENAKDLIRRLICCREHRLGQNGIEDFKQHPFFSGIDWQNIRNCDAPYIPEVSSPSDTSNFDVDDDCLKNTETMPPPSHTAFSGHHLPFVGFTYTSNCTLSDRGCLRESAAPAQMDVCVQRGLEDSLATEAYERRIRRLEQEKLELGRKLQESTKAVQALQYSSSDGPVSSNREFEIRGLKEEIEMLKKQIAD--TGQVEQQLEQAISAR--SDMEDSSKQIRSLEKQLKSTKQERDDLQKRLQESSDKQKVQGKELKEADSQRKMAMQEFAEVSEKVTELRSLKQRLTRQLRDKEEELDSLNQKVEALRLDVRKAERAKKEMEVQAEEWSAEAQKEKKLRERSEQFSRQLEEELDSIKQK-HVGRSPSTGSSEQNQELSKLRADLEKKTVHFKEELSRIEQQHANELKSLKKELKESEGQQLSLKKEIMMLKDKLDKSRRESHSERDELEFERVLLSEENKKLSSELDKLSCSNKQLEEKIRVLADEKESVAHWEAQITEIIQWVSDEKDARGYLQALATKMTEELEGLKNASL---------GARATDM---PWKVRRLAKLDMSARLELQSALDAEIKAKQTIQDELNKVKASHMATECKLEESEKQNQDLQAEIQRLKQETDNL 921          

HSP 2 Score: 234.572 bits (597), Expect = 2.171e-61
Identity = 192/650 (29.54%), Postives = 301/650 (46.31%), Query Frame = 2
Query: 2702 HVFSHSTFNRPIKCDYCTSHMLGQYYQGVKCKECSFSCHHYCLSNVLNDKCYTRKSAGKGA---NLKNGIGTMYENFIKVPKPGGIRRGWKRQFMALCDLKLFFFDVKEGSTGTQMPDISRNPCRVIDLKYTEFKVVKVSRDEVMHAPKKDVEFIIKISIE----NSSTMLPIYVLFESVDNKEDCIKVIEEARSYIKKDP-HYRMIFTEKSCLNNLDISMNYRQILSAAIIDQSTLLFGTEEGL--LKVTDSGYNKIGEKKPVYIIESLDQQELQLVAVIQSKQRVLKLLLSGILDGAHDWEPIIVENGKSCTTFVVGKSYVSPGNQFAPYADTMLANSTFHIKSPSNDRIWIMCAAFKNSVEVYHLNLKLTRHEKLRQILCNTSVTSLQIAGHGEQLLIGMHDSVAIYSLWETGSPXXXXXXXXXXXXXNFQYIFQTNFESMLIVEISFNEYLILFECAGIFINRNHRQTRP-DLQWPDKPTRFTYRAPYLLCFTEMAGLFAYEITEHSCNLVQALPLRSSKPLDRSGHILTTANEFIQAIDLIYVHLVSANEEKISIGKTIDKTSSSNTLSIFKFLNKRKPSYN--KQEDSFDTNDAISPNPAGNSTKSTGLKYRDKPTLKSNRQISVPQNFRHLSHMGPDVPCQLI 4612
            H F   TFN P KC+ CTS M+G   QG  C+ C+FSCH  C ++     C       KG    + + GIGT YE  +KVPKP G+++GW+R    +CD KLF +D+ EG      P +  N  +VID++  EF V  V   +V+HA +KD+  I +++      +S+    I +L +S   +   + +++E    +KK     R ++  K   +     +   Q  SAAIID   +  G EEGL  + VT     K+G+ K V+ IE +  +  QL+AVI  +   ++L     LD   D E   +   K C T + G   +  G+         L      +K P             + V VY LN    RH KLR+IL   SV  + +   GE+L +G       YSL   G         L   D    +I Q   +S+  VEIS  E L+ F   GI+++   R++R  +L WP  PT   Y APYL  ++E A +  +++  ++   +Q +PL+   PL+  G +       ++ + LIY    +A  +++ + +T D +      S     +KR+ S+   ++E      + +                RD P ++ N+ IS P NF H+ HMGP    Q++
Sbjct: 1034 HQFVVKTFNTPTKCNQCTSLMVGIIRQGCTCEVCNFSCHVTC-ADKAPAVCPIPPDQTKGPLGIDPQKGIGTAYEGHVKVPKPLGVKKGWQRAIAVVCDFKLFLYDLPEGKAA--QPGVVVN--QVIDMRDEEFSVSPVLASDVIHANRKDIPCIFRVTASQLCASSNKKCSILILADSDQERTKWVGLLKELHRLLKKSKLKERFVYVPKEAYDCALPLIKTTQ--SAAIIDHERIALGNEEGLYVIHVTKDEIIKVGDNKKVHQIELIPSE--QLIAVISGRNGHVRLYPMTALDD-RDVESYKIAETKGCQTLLSGT--IRHGS---------LTCLFVAMKKP-------------DKVIVYELNKSKARHRKLREILVPGSVQWMGL--QGEKLCVGFQSGFLRYSLQGDGG----TSSLLHPDDHTLGFIEQLGLDSLCAVEISSKELLLCFSSIGIYVDYQGRRSRQQELMWPATPTACRYNAPYLSVYSENA-VDVFDV--NTMEWIQTIPLKKVHPLNSDGSLNLLG---LETVRLIYFKNKTAEGDELVVPETSDNSRKQMVRST---ASKRRFSFRIPEEERVLQRREML----------------RD-PEIR-NKLISNPTNFNHVVHMGPGDGIQIL 1616          
BLAST of Serine/threonine kinase vs. Ensembl Zebrafish
Match: cdc42bpb (CDC42 binding protein kinase beta (DMPK-like) [Source:ZFIN;Acc:ZDB-GENE-030131-3647])

HSP 1 Score: 471.47 bits (1212), Expect = 2.218e-137
Identity = 319/879 (36.29%), Postives = 494/879 (56.20%), Query Frame = 2
Query:   32 MSIKLTLKQRHENLIKEFLLNYKSSVPDSVTLEFLIDSLFCTYYECRLPFHKDEKNVAQFIKSIKGTVDKIESLRIRRSDFDTIRVIGRGAFGKVSVVRFKEKGEIYAMKSLHKYDILKKIDAACFQEERDVLFQAMKIKSPWITRLHYAFQDEFYLYFVMDFYNGGDMLTLLSKFNDRLPEEITKFYIAEVVMSIDVVHKLGYLHRDIKPDNLLLDSLGHIVLADFGSCVKLRPNGTTITERAVGTPDYISPEILRSAE-GHGPYGVECDWWSLGIVIHEMLYGELPFYNEDFSETYWQIMNFETCFQIPTEYDDVSDEAEDLIKQLICKKECRLGNKGIDDFKNHPFFREIDWDNLRSYNAPFIPEVSSAEDTSNFEFDD--FNANHEGPPLS-SNFKGCHLPCIGFTFTKDFIFNEMGSEESSVRLKSLMENIGAPALLNGNHNESNSDALLE-EVNQLKITCSQLEK-QLNECRTNSVQRIFSHPVYQQLVTDKEKLLTQCQNYDYSLREKE-QKMDDLIETNRLLNKERDELTSDRLQILQKKQDIEEDLKVMTENFNQLKSTNKAINRXXXXXXXXXXXXXXXXXXXXXXXXHLSIQKNQSQPDIQVEKQRFEEV---MLQLRSENDQMLEKMRLKCSNLTNSLEQSDQTIFNIKEEIKSLKEIFT---------NKEKNLKLSH--------DNEIEQLKISVAEEQSRILASNTQLKSQVKSLSEENVELRSSLQEISNKNMKFHFRLKTILDKEIVKTSENSELLTELD----REVELLKTLCVDNDGDQKAQGERQDNNGNESWRLRKCVKADKIEISNLNLTLQSERRARADLEKKLTQQKSEICDISKQLEKYKQDVNEKDNLIANL 2575
            MS K+ LK+     +++ LL+       S+++E L+D L C Y EC     K EK+V  F++ +K     ++ +R+ R DF+ ++VIGRGAFG+V+VV+ K    +YAMK L+K+++LK+ + ACF+EER+VL         WIT LHYAFQD+ YLY VMD+Y GGD+LTLLSKF DRLPE++ KFY+AE+V++I  +H+  Y+HRDIKPDN+LLD  GHI LADFGSC+K+  +GT  +  AVGTPDYISPEIL++ E G G YG ECDWWSLG+ ++EMLYGE PFY E   ETY +IMN E  FQ P+   DVS++A+DLI++LIC +E RLG  GI++F+ H FF  IDW+N+R+  AP+IP+VSS  DTSNF+ DD         PP+S + F G HLP +GFT+T +  F++ GS          M  +   AL +G   E   D  ++ E  + +I C + EK +LN     S Q + S             L    +      R+KE +K+++  E +RL  K  D   SDRL+       +EE +  + ++F    +  KA++++   L+ E + + KQ ++  + +K  + +   +    ++  Q F EV   M +LRS+  ++  ++R K   +   +++ D    +I++  K+ KE+ +         +KE+ L+  H        ++E+E LK+     ++  L + TQ         +E  +L+S   E+  K + +    + ++ +E   T+E   L  EL     +++ L K L    +  +KA+ ERQ         L++  + ++  +S  N  L +E         KLT Q  ++ D  ++L   K+ V   +  IA +
Sbjct:    1 MSAKVRLKK-----LEQLLLDGHQKNDKSLSVETLLDILICLYNECSNSPLKREKHVTDFLEWVKPFTTTVKEMRLHRDDFEMLKVIGRGAFGEVAVVKMKHTERVYAMKILNKWEMLKRAETACFREERNVLVNG---DCQWITTLHYAFQDDNYLYLVMDYYVGGDLLTLLSKFEDRLPEDMAKFYVAEMVLAIHSIHQQRYVHRDIKPDNVLLDMNGHIRLADFGSCLKMMQDGTVQSSVAVGTPDYISPEILQAMEDGMGKYGPECDWWSLGVCMYEMLYGETPFYAESLVETYGKIMNHEERFQFPSHITDVSEDAKDLIQRLICSRERRLGQHGIEEFRKHAFFSGIDWENIRNMEAPYIPDVSSPSDTSNFDVDDDVLKNPDIAPPVSHTGFTGQHLPFVGFTYTTESCFSDGGS----------MRGV---ALSDGGTGEDLQDGGMQVEAFEKRIRCLEQEKLELNRKLQESTQAVQS-------------LHGSGRGAGTLGRDKEIKKLNE--EIDRLKKKLAD---SDRLE-----HQLEEAV-TLRQDFESSSTKLKALDKQVKALKLEKEDIHKQLVESLDRLKSQTKELKDAHQQRKLAMQEFSEVNERMAELRSQKQRLSRQLRDKEEEMEVVMQKIDAMRQDIRKTEKARKELESQLEDARAEASKERKLR-EHSEVYSKQLESELETLKVKQGAGRASGLGAETQ---------QELTKLKS---ELDKKGLYYE---EELVRREASHTTEMKNLRKELQDSEGQQLSLHKELLALKEKLEKAKRERQIEMEEAINALKEQYERERNLMSEDNRKLTAETDRLCSFVDKLTAQNRQLEDELQELASKKESVAHWEAQIAEI 818          

HSP 2 Score: 201.83 bits (512), Expect = 1.942e-51
Identity = 172/659 (26.10%), Postives = 303/659 (45.98%), Query Frame = 2
Query: 2681 TVVNCNQHVFSHSTFNRPIKCDYCTSHMLGQYYQGVKCKECSFSCHHYCLSNVLNDKCYTRKSAGK---GANLKNGIGTMYENFIKVPKPGGIRRGWKRQFMALCDLKLFFFDVKEGSTGTQMPDISRNPCRVIDLKYTEFKVVKVSRDEVMHAPKKDVEFIIKI---SIENSSTMLPIYVLFESVDNKEDCIKVIEEARSYIKKDP-HYRMIFTEKSCLNNLDISMNYRQILSAAIIDQSTLLFGTEEGL--LKVTDSGYNKIGEKKPVYIIESLDQQELQLVAVIQSKQRVLKLLLSGILDGAHDWEPIIVENGKSCTTFVVGKSYVSPGNQFAPYADTMLANSTFHIKSPSNDRIWIMCAAFKNSVEVYHLNLKLTRHEKLRQILCNTSVTSLQIAGHGEQLLIGMHDSVAIYSLWETGSPXXXXXXXXXXXXXNFQYIFQTNFESMLIVEISFNEYLILFECAGIFINRNHRQTRP-DLQWPDKPTRFTYRAPYLLCFTEMAGLFAYEITEHSCNLVQALPLRSSKPLDRSGHILTTANEFIQAIDLIYVHLVSANEEKISIGKTIDKTSS--SNTLSIFKFLNKRKPSYNKQEDSFDTNDAISPNPAGNSTKSTGLKYRDKPTLKSNRQISVPQNFRHLSHMGPDVPCQ-LIDL 4618
            T      H  S  TF+ P +C +CTS M+GQ  QG  C+ CSF CH  C  N     C       K   G +++ GIGT Y+ F+++PKP G+++GW+R +  +CD KLF ++V EG +   +   S    +V+DL+  EF V  V   +V+HA  KDV  I ++   ++++S   +P+ +L ES   K   + ++E  +S + K+    R++       ++   ++  +  LSAAI+D+  ++ GTE+GL  +++T     +  + K V  IE + ++  ++VA++  + R + L     L+GA       + + + C    +G   + PG                    P+      + A  K  V  Y +      H KL ++     V  L I    E++ +G     A+ ++    SP       +   D +  ++ Q   +++  +E+  NE L+ F   G++++   R++R  +L WP  P   +  +  L  +++  G+  +++  H+   VQ + LR  +PL+  G +   +   I+   LIY    S++   ++I +T D +      T S  KFL K                     P     +      RD P ++S + IS P NF H++HMGP    Q L+DL
Sbjct: 1015 TAPKPKAHQLSIKTFSSPTQCTHCTSLMVGQMRQGYACEVCSFICHVSCKDNA-PQLCPIPPEQTKRPLGIDVQRGIGTAYKGFVRIPKPTGVKKGWQRAYAVVCDCKLFLYEVPEGKSTQPVVMAS----QVLDLRDEEFSVSSVLASDVIHANHKDVPCIFRVTSSALKSSIRPVPLLILAESEAEKRKWVGILEGLQSILAKNRLKNRVVHVLHEAYDSSLPAI--KTTLSAAIVDRERIVLGTEDGLFVVEITRDVIVRAADCKKVCQIELIPKE--KMVALLSGRNRHVHLYPWAALEGAEGGFDAKLTDTRGCQAMTIGN--LRPGG-------------------PA-----CLFAGVKRQVFCYEITRAKPHHRKLWEVQAPGVVQWLGII--RERICVGYPSGFALLAMQGESSP----VSLVSPGDPSLAFLAQQPLDALHAMEVGSNELLLCFSQLGVYVDATGRRSRTQELMWPSTPLACSSNSNCLTVYSDY-GVDVFDV--HTMEWVQTISLRKIRPLNVEGSLNLLS---IEQPHLIYFSNNSSDGCDLAIPETSDNSKKLMVRTRSKRKFLFK--------------------VPEEERLQQRREMLRD-PEMRS-KLISHPTNFNHVAHMGPGDGMQVLMDL 1604          
BLAST of Serine/threonine kinase vs. Ensembl Zebrafish
Match: cdc42bpab (CDC42 binding protein kinase alpha (DMPK-like) b [Source:ZFIN;Acc:ZDB-GENE-080219-17])

HSP 1 Score: 469.159 bits (1206), Expect = 1.222e-136
Identity = 233/470 (49.57%), Postives = 315/470 (67.02%), Query Frame = 2
Query:   32 MSIKLTLKQRHENLIKEFLLNYKSSVPDSVTLEFLIDSLFCTYYECRLPFHKDEKNVAQFIKSIKGTVDKIESLRIRRSDFDTIRVIGRGAFGKVSVVRFKEKGEIYAMKSLHKYDILKKIDAACFQEERDVLFQAMKIKSPWITRLHYAFQDEFYLYFVMDFYNGGDMLTLLSKFNDRLPEEITKFYIAEVVMSIDVVHKLGYLHRDIKPDNLLLDSLGHIVLADFGSCVKLRPNGTTITERAVGTPDYISPEILRSAE-GHGPYGVECDWWSLGIVIHEMLYGELPFYNEDFSETYWQIMNFETCFQIPTEYDDVSDEAEDLIKQLICKKECRLGNKGIDDFKNHPFFREIDWDNLRSYNAPFIPEVSSAEDTSNFEFDD---FNANHEGPPLSSNFKGCHLPCIGFTFTKDFIFNEMGSEESSVRLKSLMENIGAPALLNGNHNESNSDALLEEVNQLKITCSQLEK 1429
            MS+++ LK+    L K  +     S     ++E L+D L C Y EC     + EKNV +F+   K    K++ +R+ + DF+ ++VIGRGAFG+V+VV+ K   +++AMK L+K+++LK+ + ACF+EERDVL         WIT LHYAFQDE  LY VMD+Y GGD+LTLLSKF DRLPE++ KFY+AE+V++ID VH+L Y+HRDIKPDN+L+D  GHI LADFGSC+KL  +GT  +  AVGTPDYISPEIL++ E G G YG ECDWWSLG+ ++EMLYGE PFY E   ETY +IMN +  FQ P +  DVS++A+DL+++LIC +E RLG  GI+DFK HPFF  IDWDN+R+  AP+IPEVSS  DTSNF+ DD    N     PP  + F G HLP +GFT+T     ++ G          L E++G PA ++ +   S  ++L  E  + +I   + EK
Sbjct:    1 MSVEVRLKK----LEKLIMDGPSQSSGQCFSMETLLDILVCLYDECSSSPIRREKNVLEFLDWAKPFTSKVKQMRLHKEDFEILKVIGRGAFGEVAVVKVKNTDKVFAMKILNKWEMLKRAETACFREERDVLVNG---DCQWITTLHYAFQDENNLYLVMDYYVGGDLLTLLSKFEDRLPEDMAKFYLAEMVLAIDSVHQLHYVHRDIKPDNILMDMNGHIRLADFGSCLKLMEDGTVQSSVAVGTPDYISPEILQAMEDGKGKYGPECDWWSLGVCMYEMLYGETPFYAESLVETYGKIMNHKERFQFPLQVTDVSEDAKDLVRRLICSREHRLGQNGIEDFKQHPFFTGIDWDNIRTCEAPYIPEVSSPTDTSNFDVDDDCLKNCETLPPPSHTAFSGHHLPFVGFTYTSKCTLSDRG---------CLRESVG-PAQVDAHVQRSLEESLASEAYERRIRRLEQEK 453          

HSP 2 Score: 226.483 bits (576), Expect = 5.666e-59
Identity = 224/932 (24.03%), Postives = 407/932 (43.67%), Query Frame = 2
Query: 2003 KEIFTNKEKNLKLSHDNEIEQLKISVAEEQSRILASNTQLKSQVKSLSEENVELRSSLQEISNKNMKFHFRLKTILDK------------EIVKTSENSE--------LLTELDREVELLKTLCVDNDGDQKAQGERQDNNGNESWRLRKCVKADKIEISNLNLTLQSERRARADL--------------EKKLTQQKSEICDISKQLEKYKQDVNE------------KDNLIANLKSASQNLEP-----HVPKEIPSNPVTLSEFNSILSGSLDKTVVNCNQHVFSHSTFNRPIKCDYCTSHMLGQYYQGVKCKECSFSCHHYCLSNVLND-KCYTRKSAGK-GANLKNGIGTMYENFIKVPKPGGIRRGWKRQFMALCDLKLFFFDVKEGSTGTQMPDISRNPCRVIDLKYTEFKVVKVSRDEVMHAPKKDVEFIIKISIENSSTMLP----IYVLFESVDNKEDCIKVIEEARSYIKKDP-HYRMIFTEKSCLNNLDISMNYRQILSAAIIDQSTLLFGTEEGL--LKVTDSGYNKIGEKKPVYIIESLDQQELQLVAVIQSKQRVLKLLLSGILDGAHDWEPIIVENGKSCTTFVVGKSYVSPGNQFAPYADTMLANSTFHIKSPSNDRIWIMCAAFKNSVEVYHLNLKLTRHEKLRQILCNTSVTSLQIAGHGEQLLIGMHDSVAIYSLWETGSPXXXXXXXXXXXXXNFQYIFQTNFESMLIVEISFNEYLILFECAGIFINRNHRQTR-PDLQWPDKPTRFTYRAPYLLCFTEMAGLFAYEITEHSCNLVQALPLRSSKPLDRSGHILTTANEFIQAIDLIYVHLVSANEEKISIGKTIDKTSSSNTLSIFKFLNKRKPSYN-KQEDSFDTNDAISPNPAGNSTKSTGLKYRDKPTLKSNRQISVPQNFRHLSHMGPDVPCQLI 4612
            KEI   K+K  K   ++++E+ +  V E + +       L  + K LS E  +L    +++S+ + +    ++ + DK            EI++   + +        L T++  E+E L+   +   G             +  W++R+  K D      L   L +E RA+  +              E KL + +S   ++  ++E+ +++  E            +++ +A L + +  L+      H  + + + P   S +     GSL  +      H FS  +FN P KC+ CTS M+G   QG  C+ CSFSCH  C     +       ++ GK G + + GIGT YE  ++VPKP G+++GW+R +  +CD KLF +++ EG  G Q P +  N  +VID++  EF    V   +V+HA +KD+  I +++    S        I +L ++   +   +  + E    ++K+    R ++  K   ++    +   Q  +AAIID   +  G EEGL  + VT     ++G+ K V+ +E +  +   ++AVI  + R + L+    LDG  + +   V + K+C   V G                ++ N T              C A K  +  + +N   +RH  L  I    +V  + +    +QL +G       YSL+    P       L   D    +I   N +++  VEIS  E L+ F    ++++ + R++R  +L WP  PT   Y APYL  ++E A +  +++  +S   +Q +PL+  +PL+  G +       ++ + LIY    +A  +++ + +  D +      S+    NKR+ S+   +E+       +  +P                  + N+ IS P NF H++HMGP    Q++
Sbjct:  733 KEILVLKDKLEKTRRESQVEREEF-VCEYKQKYEREKAHLTDENKKLSAEVEKLNGQFEQLSSSHRQLEEEMRELADKKESVAHWEAQITEIIQWVSDEKDARGYLQALATKMTEELEGLRNTSLGARGT------------DMPWKMRRFAKLDMSARLELQSALDTEIRAKQSIQDELNKVKATNIATECKLQESESRNQELLGEIERLRKETEELRLRRGVKHQDSQNSFLAFLNAPTSALDQFDLIDHTSRSLQT-PTGRSGY-----GSLGHSSPKPKAHQFSVKSFNVPTKCNQCTSLMVGLIRQGCTCEACSFSCHVTCADKAPSVCPVAPDQTRGKLGIDTQRGIGTAYEGHLRVPKPTGVKKGWQRVWAVVCDFKLFLYELGEGK-GAQ-PGVVVN--QVIDMRDEEFSASSVLESDVIHANRKDIPCIFRVTASQLSASSSQKTCILILADNEQERTKWVCALNELHRILRKNKLKERFVYVPKEAYDSTLPLIKTTQ--TAAIIDHERVALGNEEGLFVIHVTKDEIIRVGDVKKVHHVELMPTE--HILAVISGRNRQVCLVSMAGLDG-REVDKNKVADTKNCQLLVSG----------------VVRNVT------------CFCLAIKRQISCFEINKSKSRHSHLVDIQAPGTVQWMAL--FNQQLCVGYPSGFMRYSLYGETPP----ASLLHPDDPTLAFIKTDNLDALCAVEISNKELLLCFSKIAVYVDTHGRRSRQQELMWPAAPTACCYNAPYLSVYSENA-VDVFDV--NSTEWIQTIPLKKVRPLNMDGSLNLLG---LETVRLIYFRNKTAEGDELVVPEVCDNSRKQMVRSMS---NKRRFSFRIPEEERLQQRREMLKDPE-----------------RRNKLISNPTNFNHVAHMGPGDGMQIL 1576          
BLAST of Serine/threonine kinase vs. Ensembl Zebrafish
Match: CU929346.1 (pep chromosome:GRCz11:10:360237:373575:-1 gene:ENSDARG00000074914.4 transcript:ENSDART00000114487.4 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CU929346.1)

HSP 1 Score: 368.237 bits (944), Expect = 1.568e-113
Identity = 183/388 (47.16%), Postives = 260/388 (67.01%), Query Frame = 2
Query:  119 VTLEFLIDSLFCTYYE-CRLPFHKDEKNVAQFIKSIKGTVDKIESLRIRRSDFDTIRVIGRGAFGKVSVVRFKEKGEIYAMKSLHKYDILKKIDAACFQEERDVLFQAMKIKSPWITRLHYAFQDEFYLYFVMDFYNGGDMLTLLSKFNDRLPEEITKFYIAEVVMSIDVVHKLGYLHRDIKPDNLLLDSLGHIVLADFGSCVKLRPNGTTITERAVGTPDYISPEILRSAEGHGPYGVECDWWSLGIVIHEMLYGELPFYNEDFSETYWQIMNFETCFQIPTEYDDVSDEAEDLIKQLICKKECRLGNKGIDDFKNHPFFREIDWDNLRSYNAPFIPEVSSAEDTSNFEFDDFNANHEGP---PLSSNFK----GCHLPCIGFTFTK 1258
            V L+ L+D L   Y E C  P  + EK+V +F++  +  V +++  RI R DF  ++VIGRG F +V++ R +   ++YA+K ++K+D+LK+ + AC+QEER+VL   +K    WIT LHYAFQD+ YLY VM +Y GGD+LTLLSKFND LPEE+ +FY+AE+VM+ID VH LGY+HRDIKPDN+LL + GH  L DFGSC++L  +G   +  AVGTPDY+SPE+LR+ E  G YG +CDWW+LG+  +EML G  PFY E  SETY +I++F+   ++P     VS+ A    + L+CK+  RLG+ G  DF++HPFF  +DW +L  +  P+ P+VS+A DTSNF+  D   +   P    LS   +    G HL  +G+++T 
Sbjct:   28 VGLQTLLDLLVGVYQEFCSSPLRR-EKHVQRFLQWAEPLVRQVKKTRISREDFHILKVIGRGTFSEVALARMRNTQQVYAVKIMNKWDMLKRGEMACYQEEREVL---LKGDRRWITELHYAFQDDDYLYLVMHYYVGGDLLTLLSKFNDGLPEEMAQFYLAEMVMAIDSVHLLGYVHRDIKPDNILLTADGHARLGDFGSCLRLEDDGLVHSAVAVGTPDYLSPELLRAVEAGGGYGSDCDWWALGVCAYEMLLGTTPFYAESISETYAKIIHFKLILELPLVGVQVSEPA----RALVCKRSERLGSGGSADFRSHPFFSGLDWSSLHLHPPPYRPDVSNATDTSNFDVLDDCLSETVPQPETLSDVMERAPVGVHLAFVGYSYTA 407          
BLAST of Serine/threonine kinase vs. Ensembl Zebrafish
Match: rock1 (Rho-associated, coiled-coil containing protein kinase 1 [Source:ZFIN;Acc:ZDB-GENE-100712-2])

HSP 1 Score: 378.252 bits (970), Expect = 9.345e-108
Identity = 187/445 (42.02%), Postives = 280/445 (62.92%), Query Frame = 2
Query:   32 MSIKLTLKQRHENLIKEFLLNYKSSVPDSVTLEFLIDSLFCTYYECRLPFHKDEKNVAQFIKSIKGTVDKIESLRIRRSDFDTIRVIGRGAFGKVSVVRFKEKGEIYAMKSLHKYDILKKIDAACFQEERDVLFQAMKIKSPWITRLHYAFQDEFYLYFVMDFYNGGDMLTLLSKFNDRLPEEITKFYIAEVVMSIDVVHKLGYLHRDIKPDNLLLDSLGHIVLADFGSCVKLRPNGTTITERAVGTPDYISPEILRSAEGHGPYGVECDWWSLGIVIHEMLYGELPFYNEDFSETYWQIMNFETCFQIPTEYDDVSDEAEDLIKQLICKKECRLGNKGIDDFKNHPFFR--EIDWDNLRSYNAPFIPEVSSAEDTSNF-EFDDFNANHEGPPLSSNFKGCHLPCIGFTFTKDFIFNEMGSEESSVRL----------KSLMENI 1327
            MSI  +L  R E  I   L + KS V      + L+DSL    Y+   P  +  K++  F+K  K T+ KI  LR++  D++ ++VIGRGAFG+V +VR K   ++YAMK L K++++K+ D+A F EERD++  A    S W+ +L YAFQD+ YLY VM++  GGD++ L+S ++  +PE+  +FY AEVV+++D +H +G++HRD+KPDN+LLD  GH+ LADFG+C+K+  +G    + AVGTPDYISPE+L+S  G G YG ECDWWS+G+ ++EML G+ PFY +    TY +IMN +     P E  D+S +A+ LI   +  +E RLG  G+D+ K H FF+  +  W+N+R   AP +PE+S   DTSNF + ++     E  P+   F G  LP +GFT+  + +F    S+ES+++           KSL+EN+
Sbjct:    3 MSIGESLTARFEK-IDAMLKDPKSEV----NTDCLLDSLDALVYDLDFPALRKNKSIDDFLKRYKDTISKIRELRMKAEDYEVVKVIGRGAFGEVQLVRHKATRKVYAMKLLSKFEMIKRSDSAFFWEERDIMAFA---NSNWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYD--VPEKWARFYTAEVVLALDGIHSMGFIHRDVKPDNMLLDKSGHLKLADFGTCMKMNKDGMVRCDTAVGTPDYISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNALTFP-EDSDISKDAKSLICAFLTDREVRLGRNGVDEIKRHGFFKNDQWTWENIRETAAPVVPELSCDTDTSNFDDIEEDRGEEETFPIPKAFVGNQLPFVGFTYYSNNLF----SQESTIKTSDKRSSTKEDKSLLENL 432          
BLAST of Serine/threonine kinase vs. Ensembl Xenopus
Match: CDC42BPA (CDC42 binding protein kinase alpha [Source:NCBI gene;Acc:100497067])

HSP 1 Score: 677.167 bits (1746), Expect = 0.000e+0
Identity = 527/1648 (31.98%), Postives = 805/1648 (48.85%), Query Frame = 2
Query:  116 SVTLEFLIDSLFCTYYECRLPFHKDEKNVAQFIKSIKGTVDKIESLRIRRSDFDTIRVIGRGAFGKVSVVRFKEKGEIYAMKSLHKYDILKKIDAACFQEERDVLFQAMKIKSPWITRLHYAFQDEFYLYFVMDFYNGGDMLTLLSKFNDRLPEEITKFYIAEVVMSIDVVHKLGYLHRDIKPDNLLLDSLGHIVLADFGSCVKLRPNGTTITERAVGTPDYISPEILRSAE-GHGPYGVECDWWSLGIVIHEMLYGELPFYNEDFSETYWQIMNFETCFQIPTEYDDVSDEAEDLIKQLICKKECRLGNKGIDDFKNHPFFREIDWDNLRSYNAPFIPEVSSAEDTSNFEFDD---FNANHEGPPLSSNFKGCHLPCIGFTFTKDFIFNEMGSEESSVRLKSLMENIGAPAL-LNGNHNESNSDALLEE-----VNQLKITCSQLEKQLNECRTNSVQRIFSHPVYQQLVT--------------DKEKLLTQCQ----------------NYDYSLR-----------EKEQKMDDLIETNRLL---NKERDELTSDRLQILQKKQDIEE---DLKVMTENF-NQLKSTNKAINRXXXXXXXXXXXXXXXXXXXXXXXXHLSIQKNQSQPDIQVEKQRFEEVMLQLRSENDQMLEKMRLKCSNLTNSLEQSDQTIFNIKEEIKSLKEIFTNKE-KNLKLSHDNEIEQLKISVAEEQSRILASNTQLKSQVKSLSEENVELRSSLQEISNKNMKFHFRLKTILDKE-IVKTSENSELLTELDREVELLKTLCVDND---------GDQK----------------------AQG----------ERQDNNGNES---------WRLRKCVKADKIEISNLNLTLQSERRARADLEKKLTQQKSEIC--------------DISKQLEKYKQDVNE------------KDNLIANLKSASQNLEPHVPKEIPSNPVTLSEFNSILSGSLDKTVVNCNQHVFSHSTFNRPIKCDYCTSHMLGQYYQGVKCKECSFSCHHYCLSNVLNDKC--YTRKSAGK-GANLKNGIGTMYENFIKVPKPGGIRRGWKRQFMALCDLKLFFFDVKEGSTGTQMPDISRNPCRVIDLKYTEFKVVKVSRDEVMHAPKKDVEFIIKIS---IENSSTMLPIYVLFESVDNKEDCIKVIEEARSYIKKDP-HYRMIFTEKSCLNN-LDISMNYRQILSAAIIDQSTLLFGTEEGL--LKVTDSGYNKIGEKKPVYIIESLDQQELQLVAVIQSKQRVLKLLLSGILDGAHDWEPIIVENGKSCTTFVVGKSYVSPGNQFAPYADTMLANSTFHIKSPSNDRIWIMCAAFKNSVEVYHLNLKLTRHEKLRQILCNTSVTSLQIAGHGEQLLIGMHDSVAIYSLWETGSPXXXXXXXXXXXXXNFQYIFQTNFESMLIVEISFNEYLILFECAGIFINRNHRQTR-PDLQWPDKPTRF--TYRAPYLLCFTEMAGLFAYEITEHSCNLVQALPLRSSKPLDRSGHILTTANEFIQAIDLIYVHLVSANEEKISIGKTIDKTSSSNTLSIFKFLNKRKPSYNKQEDSFDTNDAISPNPAGNSTKSTGLKYRDKPTLKSNRQISVPQNFRHLSHMGPDVPCQLI 4612
            S+++E L+DSL C Y EC     + +K++  +I+  K    K++ +R+ + DF+ ++VIGRGAFG+V+VV+ K   +++AMK L+K+++LK+ + ACF+EERDVL       S WIT LHYAFQD+  LY VMD+Y GGD+LTLLSKF DRLPE++++FY+AE+V++ID VH+L Y+HRDIKPDN+LLD  GHI LADFGSC+KL  +GT  +  AVGTPDYISPEIL++ E G G YG ECDWWSLG+ ++EMLYGE PFY E   ETY +IMN +  FQ PT+  DVS+ A+DLI++LIC +E RLG  GI+DFKNHPFF  IDWDN+R+  AP+IPEVSS  DTSNF+ DD    N     PP  + F G HLP +GFT+T + +     S+ SS+R  S     G P+  L+ N   S  D+L  E     + +L+    +L ++L E  T +VQ    H      VT              DK K L   Q                 +   +R           EKE    DL+E+N  +    KE  E  S R Q LQ+  ++ E   +L+   + F  QL+   + +      LE     L++    +KE    +    +++  D ++ +++ E+   QL SE + +  K   +   ++NS  Q  Q I  +K +++  K +F  +E    +  H  EI+ LK  + + +S+ L  N ++      L +   E +S  +E       F   +K   D+E ++   EN +L +ELD+   + + L V+N           D+K                      A+G          E  D   N S         W++R+  K D      L   L +E RA+  ++++L + K+ I               D++ ++EK K + +E            +++ +A L + +  L+ H  +   SNP +                +    H F   TFN P KC+ CTS M+G   QG  C+ C FSCH  C ++     C   T ++ G  G + + GIGT YE  +KVPKP G+++GW+R    +CD KLF +++ EG +      +S    +VID++  EF V  V   +V+HA +KD+  I +++   +  SS    I +L +S   K   + V+ E    +KK+    R ++  K   ++ L +  N +   SAAI+D   +  G EEGL  + VT     ++G+ K V+ +E +  +  QL+AVI  + R ++L     LDG       +VE  K C   V G+  V  G                         +  +C + K  V  Y LN   TRH+K+++I    +V  + I    E+L +G       Y L   GSP    +  L   D    +I Q   +++  VEIS  EYL+ F   G++++   R++R  +L WP  P      Y  PY   +  +                        +PL+  G +       ++ I LIY     A  +++ + +T D   +S    +    NKR+ S+                P     +      RD P ++ N+ IS P NF H++HMGP    Q++
Sbjct:   23 SLSVESLLDSLLCLYDECSASPLRRDKHINDYIQWAKPFALKVKQMRLHKEDFEILKVIGRGAFGEVAVVKLKNADKVFAMKILNKWEMLKRAETACFREERDVLVNG---DSQWITTLHYAFQDDNNLYLVMDYYVGGDLLTLLSKFEDRLPEDMSRFYLAEMVLAIDSVHQLHYVHRDIKPDNILLDMNGHIRLADFGSCLKLMEDGTVQSSVAVGTPDYISPEILQAMEDGKGKYGPECDWWSLGVCMYEMLYGETPFYAESLVETYGKIMNHKERFQFPTQLADVSENAKDLIRRLICSREHRLGQNGIEDFKNHPFFVGIDWDNIRNCEAPYIPEVSSPTDTSNFDVDDDCLKNCETMPPPTHTGFSGHHLPFVGFTYTSNCVL----SDRSSLRDAS-----GTPSTDLDANVQRSLEDSLATEAYERRIRRLEQEKVELTRKLQES-TQAVQ-ALQHSAVDGPVTASKDLEIKSLKEELDKLKTLGANQLTQQLDKSGLARPDFEEFSRQIRVFEKQVKVLKQEKEDLNKDLVESNEKMKTQTKELKEAQSQRKQALQEMAELNERLTELRSQKQKFVRQLRDKEEEMEAVAQKLEGLRQDLRRVERAKKELEAQMDSAASEASKDRKL-REKSEQYTKQLESELEGLKLKQVGRPLGVSNSEHQ--QEIAKLKTDLEK-KSVFYEEEFAKREALHAGEIKNLKKELRDAESQQLNLNKEILVLKDKLDKTRRESQSEREE-------FEAEMKQKFDRERLLLMEENKKLSSELDKLSAMFEKLSVNNRHLEEEMRDLADKKESVAHWEAQITEIIQWVSDEKDARGYLQALASKMTEELDTLRNSSLGAKPTDMPWKMRRFAKLDMSARLELQSALDAEIRAKQAIQEELNKAKAAIIATECKLQESDKKNQDLTTEIEKLKWETDELRSEKGVKHQESQNSFLAFLNAPTSVLD-HFERSPSSNPASKGRRVRGCLALCAPPFLPPKAHQFVVKTFNAPTKCNQCTSLMVGLIRQGCTCEVCGFSCHVTC-ADKAPAVCPIPTDQTKGPLGIDPQKGIGTAYEGHVKVPKPAGVKKGWQRAMAVVCDFKLFLYEIAEGKSSQTSCVVS----QVIDMRDEEFAVSSVLASDVIHANRKDIPCIFRVTASQLSASSNKCSILLLADSESEKGKWVGVLNELHRILKKNKLKDRSVYVPKEAYDSTLPLIKNTQ---SAAILDHERIALGNEEGLFVVHVTKDEIIRVGDNKKVHQVELIPSE--QLIAVISGRNRHVRLYPMISLDGRETEFYKLVET-KGCQGIVSGQ--VRHGA------------------------LTCLCVSMKRQVLCYELNQSKTRHKKIKEIQVPGNVQWMAI--FNERLCVGYQSGFMRYPLHADGSP----YSLLHSDDHTLSFITQQATDAICAVEISNKEYLLCFSSVGVYVDCQGRRSRQQELMWPAGPLSCCKGYIIPYPHIYHHV------------------------RPLNSEGSLNILG---LETIRLIYFKNKMAEGDELVVPETSD---NSRKQMVRNMNNKRRYSFRV--------------PEEERMQQRREMLRD-PEMR-NKLISNPTNFNHIAHMGPGDGIQIL 1555          
BLAST of Serine/threonine kinase vs. Ensembl Xenopus
Match: CDC42BPA (CDC42 binding protein kinase alpha [Source:NCBI gene;Acc:100497067])

HSP 1 Score: 677.167 bits (1746), Expect = 0.000e+0
Identity = 529/1646 (32.14%), Postives = 803/1646 (48.78%), Query Frame = 2
Query:  116 SVTLEFLIDSLFCTYYECRLPFHKDEKNVAQFIKSIKGTVDKIESLRIRRSDFDTIRVIGRGAFGKVSVVRFKEKGEIYAMKSLHKYDILKKIDAACFQEERDVLFQAMKIKSPWITRLHYAFQDEFYLYFVMDFYNGGDMLTLLSKFNDRLPEEITKFYIAEVVMSIDVVHKLGYLHRDIKPDNLLLDSLGHIVLADFGSCVKLRPNGTTITERAVGTPDYISPEILRSAE-GHGPYGVECDWWSLGIVIHEMLYGELPFYNEDFSETYWQIMNFETCFQIPTEYDDVSDEAEDLIKQLICKKECRLGNKGIDDFKNHPFFREIDWDNLRSYNAPFIPEVSSAEDTSNFEFDD---FNANHEGPPLSSNFKGCHLPCIGFTFTKDFIFNEMGSEESSVRLKSLMENIGAPAL-LNGNHNESNSDALLEE-----VNQLKITCSQLEKQLNECRTNSVQRIFSHPVYQQLVT--------------DKEKLLTQCQ----------------NYDYSLR-----------EKEQKMDDLIETNRLL---NKERDELTSDRLQILQKKQDIEE---DLKVMTENF-NQLKSTNKAINRXXXXXXXXXXXXXXXXXXXXXXXXHLSIQKNQSQPDIQVEKQRFEEVMLQLRSENDQMLEKMRLKCSNLTNSLEQSDQTIFNIKEEIKSLKEIFTNKE-KNLKLSHDNEIEQLKISVAEEQSRILASNTQLKSQVKSLSEENVELRSSLQEISNKNMKFHFRLKTILDKE-IVKTSENSELLTELDREVELLKTLCVDND---------GDQK----------------------AQG----------ERQDNNGNES---------WRLRKCVKADKIEISNLNLTLQSERRARADLEKKLTQQKSEIC--------------DISKQLEKYKQDVNE------------KDNLIANLKSASQNLEPHVPKEIPSNPVTLSEFNSILSGSLDKTVVNCNQHVFSHSTFNRPIKCDYCTSHMLGQYYQGVKCKECSFSCHHYCLSNVLNDKC--YTRKSAGK-GANLKNGIGTMYENFIKVPKPGGIRRGWKRQFMALCDLKLFFFDVKEGSTGTQMPDISRNPCRVIDLKYTEFKVVKVSRDEVMHAPKKDVEFIIKIS---IENSSTMLPIYVLFESVDNKEDCIKVIEEARSYIKKDP-HYRMIFTEKSCLNN-LDISMNYRQILSAAIIDQSTLLFGTEEGL--LKVTDSGYNKIGEKKPVYIIESLDQQELQLVAVIQSKQRVLKLLLSGILDGAHDWEPIIVENGKSCTTFVVGKSYVSPGNQFAPYADTMLANSTFHIKSPSNDRIWIMCAAFKNSVEVYHLNLKLTRHEKLRQILCNTSVTSLQIAGHGEQLLIGMHDSVAIYSLWETGSPXXXXXXXXXXXXXNFQYIFQTNFESMLIVEISFNEYLILFECAGIFINRNHRQTR-PDLQWPDKPTRFTYRAPYLLCFTEMAGLFAYEITEHSCNLVQALPLRSSKPLDRSGHILTTANEFIQAIDLIYVHLVSANEEKISIGKTIDKTSSSNTLSIFKFLNKRKPSYNKQEDSFDTNDAISPNPAGNSTKSTGLKYRDKPTLKSNRQISVPQNFRHLSHMGPDVPCQLI 4612
            S+++E L+DSL C Y EC     + +K++  +I+  K    K++ +R+ + DF+ ++VIGRGAFG+V+VV+ K   +++AMK L+K+++LK+ + ACF+EERDVL       S WIT LHYAFQD+  LY VMD+Y GGD+LTLLSKF DRLPE++++FY+AE+V++ID VH+L Y+HRDIKPDN+LLD  GHI LADFGSC+KL  +GT  +  AVGTPDYISPEIL++ E G G YG ECDWWSLG+ ++EMLYGE PFY E   ETY +IMN +  FQ PT+  DVS+ A+DLI++LIC +E RLG  GI+DFKNHPFF  IDWDN+R+  AP+IPEVSS  DTSNF+ DD    N     PP  + F G HLP +GFT+T + +     S+ SS+R  S     G P+  L+ N   S  D+L  E     + +L+    +L ++L E  T +VQ    H      VT              DK K L   Q                 +   +R           EKE    DL+E+N  +    KE  E  S R Q LQ+  ++ E   +L+   + F  QL+   + +      LE     L++    +KE    +    +++  D ++ +++ E+   QL SE + +  K   +   ++NS  Q  Q I  +K +++  K +F  +E    +  H  EI+ LK  + + +S+ L  N ++      L +   E +S  +E       F   +K   D+E ++   EN +L +ELD+   + + L V+N           D+K                      A+G          E  D   N S         W++R+  K D      L   L +E RA+  ++++L + K+ I               D++ ++EK K + +E            +++ +A L + +  L+ H  +   SNP +                +    H F   TFN P KC+ CTS M+G   QG  C+ C FSCH  C ++     C   T ++ G  G + + GIGT YE  +KVPKP G+++GW+R    +CD KLF +++ EG +      +S    +VID++  EF V  V   +V+HA +KD+  I +++   +  SS    I +L +S   K   + V+ E    +KK+    R ++  K   ++ L +  N +   SAAI+D   +  G EEGL  + VT     ++G+ K V+ +E +  +  QL+AVI  + R ++L     LDG       +VE  K C   V G+  V  G                         +  +C + K  V  Y LN   TRH+K+++I    +V  + I    E+L +G       Y L   GSP    +  L   D    +I Q   +++  VEIS  EYL+ F   G++++   R++R  +L WP  P         L C                C      PL S   L+  G         ++ I LIY     A  +++ + +T D   +S    +    NKR+ S+                P     +      RD P ++ N+ IS P NF H++HMGP    Q++
Sbjct:   23 SLSVESLLDSLLCLYDECSASPLRRDKHINDYIQWAKPFALKVKQMRLHKEDFEILKVIGRGAFGEVAVVKLKNADKVFAMKILNKWEMLKRAETACFREERDVLVNG---DSQWITTLHYAFQDDNNLYLVMDYYVGGDLLTLLSKFEDRLPEDMSRFYLAEMVLAIDSVHQLHYVHRDIKPDNILLDMNGHIRLADFGSCLKLMEDGTVQSSVAVGTPDYISPEILQAMEDGKGKYGPECDWWSLGVCMYEMLYGETPFYAESLVETYGKIMNHKERFQFPTQLADVSENAKDLIRRLICSREHRLGQNGIEDFKNHPFFVGIDWDNIRNCEAPYIPEVSSPTDTSNFDVDDDCLKNCETMPPPTHTGFSGHHLPFVGFTYTSNCVL----SDRSSLRDAS-----GTPSTDLDANVQRSLEDSLATEAYERRIRRLEQEKVELTRKLQES-TQAVQ-ALQHSAVDGPVTASKDLEIKSLKEELDKLKTLGANQLTQQLDKSGLARPDFEEFSRQIRVFEKQVKVLKQEKEDLNKDLVESNEKMKTQTKELKEAQSQRKQALQEMAELNERLTELRSQKQKFVRQLRDKEEEMEAVAQKLEGLRQDLRRVERAKKELEAQMDSAASEASKDRKL-REKSEQYTKQLESELEGLKLKQVGRPLGVSNSEHQ--QEIAKLKTDLEK-KSVFYEEEFAKREALHAGEIKNLKKELRDAESQQLNLNKEILVLKDKLDKTRRESQSEREE-------FEAEMKQKFDRERLLLMEENKKLSSELDKLSAMFEKLSVNNRHLEEEMRDLADKKESVAHWEAQITEIIQWVSDEKDARGYLQALASKMTEELDTLRNSSLGAKPTDMPWKMRRFAKLDMSARLELQSALDAEIRAKQAIQEELNKAKAAIIATECKLQESDKKNQDLTTEIEKLKWETDELRSEKGVKHQESQNSFLAFLNAPTSVLD-HFERSPSSNPASKGRRVRGCLALCAPPFLPPKAHQFVVKTFNAPTKCNQCTSLMVGLIRQGCTCEVCGFSCHVTC-ADKAPAVCPIPTDQTKGPLGIDPQKGIGTAYEGHVKVPKPAGVKKGWQRAMAVVCDFKLFLYEIAEGKSSQTSCVVS----QVIDMRDEEFAVSSVLASDVIHANRKDIPCIFRVTASQLSASSNKCSILLLADSESEKGKWVGVLNELHRILKKNKLKDRSVYVPKEAYDSTLPLIKNTQ---SAAILDHERIALGNEEGLFVVHVTKDEIIRVGDNKKVHQVELIPSE--QLIAVISGRNRHVRLYPMISLDGRETEFYKLVET-KGCQGIVSGQ--VRHGA------------------------LTCLCVSMKRQVLCYELNQSKTRHKKIKEIQVPGNVQWMAI--FNERLCVGYQSGFMRYPLHADGSP----YSLLHSDDHTLSFITQQATDAICAVEISNKEYLLCFSSVGVYVDCQGRRSRQQELMWPAGP---------LSC----------------CKCPAVRPLNSEGSLNILG---------LETIRLIYFKNKMAEGDELVVPETSD---NSRKQMVRNMNNKRRYSFRV--------------PEEERMQQRREMLRD-PEMR-NKLISNPTNFNHIAHMGPGDGIQIL 1546          
BLAST of Serine/threonine kinase vs. Ensembl Xenopus
Match: CDC42BPA (CDC42 binding protein kinase alpha [Source:NCBI gene;Acc:100497067])

HSP 1 Score: 673.315 bits (1736), Expect = 0.000e+0
Identity = 528/1645 (32.10%), Postives = 807/1645 (49.06%), Query Frame = 2
Query:  116 SVTLEFLIDSLFCTYYECRLPFHKDEKNVAQFIKSIKGTVDKIESLRIRRSDFDTIRVIGRGAFGKVSVVRFKEKGEIYAMKSLHKYDILKKIDAACFQEERDVLFQAMKIKSPWITRLHYAFQDEFYLYFVMDFYNGGDMLTLLSKFNDRLPEEITKFYIAEVVMSIDVVHKLGYLHRDIKPDNLLLDSLGHIVLADFGSCVKLRPNGTTITERAVGTPDYISPEILRSAE-GHGPYGVECDWWSLGIVIHEMLYGELPFYNEDFSETYWQIMNFETCFQIPTEYDDVSDEAEDLIKQLICKKECRLGNKGIDDFKNHPFFREIDWDNLRSYNAPFIPEVSSAEDTSNFEFDD---FNANHEGPPLSSNFKGCHLPCIGFTFTKDFIFNEMGSEESSVRLKSLMENIGAPAL-LNGNHNESNSDALLEE-----VNQLKITCSQLEKQLNECRTNSVQRI----FSHPV--------------------------YQQL------VTDKEKLLTQCQNYDYSLR----EKEQKMDDLIETNRLL---NKERDELTSDRLQILQKKQDIEE---DLKVMTENF-NQLKSTNKAINRXXXXXXXXXXXXXXXXXXXXXXXXHLSIQKNQSQPDIQVEKQRFEEVMLQLRSENDQMLEKMRLKCSNLTNSLEQSDQTIFNIKEEIKSLKEIFTNKE-KNLKLSHDNEIEQLKISVAEEQSRILASNTQLKSQVKSLSEENVELRSSLQEISNKNMKFHFRLKTILDKE-IVKTSENSELLTELDREVELLKTLCVDND---------GDQK----------------------AQG----------ERQDNNGNES---------WRLRKCVKADKIEISNLNLTLQSERRARADLEKKLTQQKSEIC--------------DISKQLEKYKQDVNE------------KDNLIANLKSASQNLEPHVPKEIPSNPVTLSEFNSILSGSLDKTVVNCNQHVFSHSTFNRPIKCDYCTSHMLGQYYQGVKCKECSFSCHHYCLSNVLNDKC--YTRKSAGK-GANLKNGIGTMYENFIKVPKPGGIRRGWKRQFMALCDLKLFFFDVKEGSTGTQMPDISRNPCRVIDLKYTEFKVVKVSRDEVMHAPKKDVEFIIKIS---IENSSTMLPIYVLFESVDNKEDCIKVIEEARSYIKKDP-HYRMIFTEKSCLNN-LDISMNYRQILSAAIIDQSTLLFGTEEGL--LKVTDSGYNKIGEKKPVYIIESLDQQELQLVAVIQSKQRVLKLLLSGILDGAHDWEPIIVENGKSCTTFVVGKSYVSPGNQFAPYADTMLANSTFHIKSPSNDRIWIMCAAFKNSVEVYHLNLKLTRHEKLRQILCNTSVTSLQIAGHGEQLLIGMHDSVAIYSLWETGSPXXXXXXXXXXXXXNFQYIFQTNFESMLIVEISFNEYLILFECAGIFINRNHRQTR-PDLQWPDKPTRFTYRAPYLLCFTEMAGLFAYEITEHSCNLVQALPLRSSKPLDRSGHILTTANEFIQAIDLIYVHLVSANEEKISIGKTIDKTSSSNTLSIFKFLNKRKPSYNKQEDSFDTNDAISPNPAGNSTKSTGLKYRDKPTLKSNRQISVPQNFRHLSHMGPDVPCQLI 4612
            S+++E L+DSL C Y EC     + +K++  +I+  K    K++ +R+ + DF+ ++VIGRGAFG+V+VV+ K   +++AMK L+K+++LK+ + ACF+EERDVL       S WIT LHYAFQD+  LY VMD+Y GGD+LTLLSKF DRLPE++++FY+AE+V++ID VH+L Y+HRDIKPDN+LLD  GHI LADFGSC+KL  +GT  +  AVGTPDYISPEIL++ E G G YG ECDWWSLG+ ++EMLYGE PFY E   ETY +IMN +  FQ PT+  DVS+ A+DLI++LIC +E RLG  GI+DFKNHPFF  IDWDN+R+  AP+IPEVSS  DTSNF+ DD    N     PP  + F G HLP +GFT+T + +     S+ SS+R  S     G P+  L+ N   S  D+L  E     + +L+    +L ++L E  T +VQ +       PV                           QQL        D E+   Q + ++  ++    EKE    DL+E+N  +    KE  E  S R Q LQ+  ++ E   +L+   + F  QL+   + +      LE     L++    +KE    +    +++  D ++ +++ E+   QL SE + +  K   +   ++NS  Q  Q I  +K +++  K +F  +E    +  H  EI+ LK  + + +S+ L  N ++      L +   E +S  +E       F   +K   D+E ++   EN +L +ELD+   + + L V+N           D+K                      A+G          E  D   N S         W++R+  K D      L   L +E RA+  ++++L + K+ I               D++ ++EK K + +E            +++ +A L + +  L+ H   +    P   +  +S     L         H F   TFN P KC+ CTS M+G   QG  C+ C FSCH  C ++     C   T ++ G  G + + GIGT YE  +KVPKP G+++GW+R    +CD KLF +++ EG +      +S    +VID++  EF V  V   +V+HA +KD+  I +++   +  SS    I +L +S   K   + V+ E    +KK+    R ++  K   ++ L +  N +   SAAI+D   +  G EEGL  + VT     ++G+ K V+ +E +  +  QL+AVI  + R ++L     LDG       +VE  K C   V G+  V  G                         +  +C + K  V  Y LN   TRH+K+++I    +V  + I    E+L +G       Y L   GSP    +  L   D    +I Q   +++  VEIS  EYL+ F   G++++   R++R  +L WP  P         L C                C      PL S   L+  G         ++ I LIY     A  +++ + +T D   +S    +    NKR+ S+                P     +      RD P ++ N+ IS P NF H++HMGP    Q++
Sbjct:   23 SLSVESLLDSLLCLYDECSASPLRRDKHINDYIQWAKPFALKVKQMRLHKEDFEILKVIGRGAFGEVAVVKLKNADKVFAMKILNKWEMLKRAETACFREERDVLVNG---DSQWITTLHYAFQDDNNLYLVMDYYVGGDLLTLLSKFEDRLPEDMSRFYLAEMVLAIDSVHQLHYVHRDIKPDNILLDMNGHIRLADFGSCLKLMEDGTVQSSVAVGTPDYISPEILQAMEDGKGKYGPECDWWSLGVCMYEMLYGETPFYAESLVETYGKIMNHKERFQFPTQLADVSENAKDLIRRLICSREHRLGQNGIEDFKNHPFFVGIDWDNIRNCEAPYIPEVSSPTDTSNFDVDDDCLKNCETMPPPTHTGFSGHHLPFVGFTYTSNCVL----SDRSSLRDAS-----GTPSTDLDANVQRSLEDSLATEAYERRIRRLEQEKVELTRKLQES-TQAVQALQHSAVDGPVTASKDLEIKSLKEELDKLKTLGANQLTQQLDKSGLARPDFEEFSRQIRVFEKQVKVLKQEKEDLNKDLVESNEKMKTQTKELKEAQSQRKQALQEMAELNERLTELRSQKQKFVRQLRDKEEEMEAVAQKLEGLRQDLRRVERAKKELEAQMDSAASEASKDRKL-REKSEQYTKQLESELEGLKLKQVGRPLGVSNSEHQ--QEIAKLKTDLEK-KSVFYEEEFAKREALHAGEIKNLKKELRDAESQQLNLNKEILVLKDKLDKTRRESQSEREE-------FEAEMKQKFDRERLLLMEENKKLSSELDKLSAMFEKLSVNNRHLEEEMRDLADKKESVAHWEAQITEIIQWVSDEKDARGYLQALASKMTEELDTLRNSSLGAKPTDMPWKMRRFAKLDMSARLELQSALDAEIRAKQAIQEELNKAKAAIIATECKLQESDKKNQDLTTEIEKLKWETDELRSEKGVKHQESQNSFLAFLNAPTSVLD-HFEVKTWFLPACSNTADSETCPLLVAVGAVPKAHQFVVKTFNAPTKCNQCTSLMVGLIRQGCTCEVCGFSCHVTC-ADKAPAVCPIPTDQTKGPLGIDPQKGIGTAYEGHVKVPKPAGVKKGWQRAMAVVCDFKLFLYEIAEGKSSQTSCVVS----QVIDMRDEEFAVSSVLASDVIHANRKDIPCIFRVTASQLSASSNKCSILLLADSESEKGKWVGVLNELHRILKKNKLKDRSVYVPKEAYDSTLPLIKNTQ---SAAILDHERIALGNEEGLFVVHVTKDEIIRVGDNKKVHQVELIPSE--QLIAVISGRNRHVRLYPMISLDGRETEFYKLVET-KGCQGIVSGQ--VRHGA------------------------LTCLCVSMKRQVLCYELNQSKTRHKKIKEIQVPGNVQWMAI--FNERLCVGYQSGFMRYPLHADGSP----YSLLHSDDHTLSFITQQATDAICAVEISNKEYLLCFSSVGVYVDCQGRRSRQQELMWPAGP---------LSC----------------CKCPAVRPLNSEGSLNILG---------LETIRLIYFKNKMAEGDELVVPETSD---NSRKQMVRNMNNKRRYSFRV--------------PEEERMQQRREMLRD-PEMR-NKLISNPTNFNHIAHMGPGDGIQIL 1546          
BLAST of Serine/threonine kinase vs. Ensembl Xenopus
Match: CDC42BPA (CDC42 binding protein kinase alpha [Source:NCBI gene;Acc:100497067])

HSP 1 Score: 671.774 bits (1732), Expect = 0.000e+0
Identity = 530/1670 (31.74%), Postives = 812/1670 (48.62%), Query Frame = 2
Query:  116 SVTLEFLIDSLFCTYYECRLPFHKDEKNVAQFIKSIKGTVDKIESLRIRRSDFDTIRVIGRGAFGKVSVVRFKEKGEIYAMKSLHKYDILKKIDAACFQEERDVLFQAMKIKSPWITRLHYAFQDEFYLYFVMDFYNGGDMLTLLSKFNDRLPEEITKFYIAEVVMSIDVVHKLGYLHRDIKPDNLLLDSLGHIVLADFGSCVKLRPNGTTITERAVGTPDYISPEILRSAE-GHGPYGVECDWWSLGIVIHEMLYGELPFYNEDFSETYWQIMNFETCFQIPTEYDDVSDEAEDLIKQLICKKECRLGNKGIDDFKNHPFFREIDWDNLRSYNAPFIPEVSSAEDTSNFEFDD---FNANHEGPPLSSNFKGCHLPCIGFTFTKDFIFNEMGSEESSVRLKSLMENIGAPAL-LNGNHNESNSDALLEE-----VNQLKITCSQLEKQLNECRTNSVQRIFSHPVYQQLVT--------------DKEKLLTQCQ----------------NYDYSLR-----------EKEQKMDDLIETNRLL---NKERDELTSDRLQILQKKQDIEE---DLKVMTENF-NQLKSTNKAINRXXXXXXXXXXXXXXXXXXXXXXXXHLSIQKNQSQPDIQVEKQRFEEVMLQLRSENDQMLEKMRLKCSNLTNSLEQSDQTIFNIKEEIKSLKEIFTNKE-KNLKLSHDNEIEQLKISVAEEQSRILASNTQLKSQVKSLSEENVELRSSLQEISNKNMKFHFRLKTILDKE-IVKTSENSELLTELDREVELLKTLCVDND---------GDQK----------------------AQG----------ERQDNNGNES---------WRLRKCVKADKIEISNLNLTLQSERRARADLEKKLTQQKSEIC--------------DISKQLEKYKQDVNE------------KDNLIANLKSASQNLE---------------PHVPKEIPS-------NPVTLSEFN--SILSGSLDKTVVNCNQHVFSHSTFNRPIKCDYCTSHMLGQYYQGVKCKECSFSCHHYCLSNVLNDKC--YTRKSAGK-GANLKNGIGTMYENFIKVPKPGGIRRGWKRQFMALCDLKLFFFDVKEGSTGTQMPDISRNPCRVIDLKYTEFKVVKVSRDEVMHAPKKDVEFIIKIS---IENSSTMLPIYVLFESVDNKEDCIKVIEEARSYIKKDP-HYRMIFTEKSCLNN-LDISMNYRQILSAAIIDQSTLLFGTEEGL--LKVTDSGYNKIGEKKPVYIIESLDQQELQLVAVIQSKQRVLKLLLSGILDGAHDWEPIIVENGKSCTTFVVGKSYVSPGNQFAPYADTMLANSTFHIKSPSNDRIWIMCAAFKNSVEVYHLNLKLTRHEKLRQILCNTSVTSLQIAGHGEQLLIGMHDSVAIYSLWETGSPXXXXXXXXXXXXXNFQYIFQTNFESMLIVEISFNEYLILFECAGIFINRNHRQTR-PDLQWPDKPTRFTYRAPYLLCFTEMAGLFAYEITEHSCNLVQALPLRSSKPLDRSGHILTTANEFIQAIDLIYVHLVSANEEKISIGKTIDKTSSSNTLSIFKFLNKRKPSYNKQEDSFDTNDAISPNPAGNSTKSTGLKYRDKPTLKSNRQISVPQNFRHLSHMGPDVPCQLI 4612
            S+++E L+DSL C Y EC     + +K++  +I+  K    K++ +R+ + DF+ ++VIGRGAFG+V+VV+ K   +++AMK L+K+++LK+ + ACF+EERDVL       S WIT LHYAFQD+  LY VMD+Y GGD+LTLLSKF DRLPE++++FY+AE+V++ID VH+L Y+HRDIKPDN+LLD  GHI LADFGSC+KL  +GT  +  AVGTPDYISPEIL++ E G G YG ECDWWSLG+ ++EMLYGE PFY E   ETY +IMN +  FQ PT+  DVS+ A+DLI++LIC +E RLG  GI+DFKNHPFF  IDWDN+R+  AP+IPEVSS  DTSNF+ DD    N     PP  + F G HLP +GFT+T + +     S+ SS+R  S     G P+  L+ N   S  D+L  E     + +L+    +L ++L E  T +VQ    H      VT              DK K L   Q                 +   +R           EKE    DL+E+N  +    KE  E  S R Q LQ+  ++ E   +L+   + F  QL+   + +      LE     L++    +KE    +    +++  D ++ +++ E+   QL SE + +  K   +   ++NS  Q  Q I  +K +++  K +F  +E    +  H  EI+ LK  + + +S+ L  N ++      L +   E +S  +E       F   +K   D+E ++   EN +L +ELD+   + + L V+N           D+K                      A+G          E  D   N S         W++R+  K D      L   L +E RA+  ++++L + K+ I               D++ ++EK K + +E            +++ +A L + +  L+               P   +++ S       +P T+S+     + + ++   +     H F   TFN P KC+ CTS M+G   QG  C+ C FSCH  C ++     C   T ++ G  G + + GIGT YE  +KVPKP G+++GW+R    +CD KLF +++ EG +      +S    +VID++  EF V  V   +V+HA +KD+  I +++   +  SS    I +L +S   K   + V+ E    +KK+    R ++  K   ++ L +  N +   SAAI+D   +  G EEGL  + VT     ++G+ K V+ +E +  +  QL+AVI  + R ++L     LDG       +VE  K C   V G+  V  G                         +  +C + K  V  Y LN   TRH+K+++I    +V  + I    E+L +G       Y L   GSP    +  L   D    +I Q   +++  VEIS  EYL+ F   G++++   R++R  +L WP  P         L C                C      PL S   L+  G         ++ I LIY     A  +++ + +T D   +S    +    NKR+ S+                P     +      RD P ++ N+ IS P NF H++HMGP    Q++
Sbjct:   23 SLSVESLLDSLLCLYDECSASPLRRDKHINDYIQWAKPFALKVKQMRLHKEDFEILKVIGRGAFGEVAVVKLKNADKVFAMKILNKWEMLKRAETACFREERDVLVNG---DSQWITTLHYAFQDDNNLYLVMDYYVGGDLLTLLSKFEDRLPEDMSRFYLAEMVLAIDSVHQLHYVHRDIKPDNILLDMNGHIRLADFGSCLKLMEDGTVQSSVAVGTPDYISPEILQAMEDGKGKYGPECDWWSLGVCMYEMLYGETPFYAESLVETYGKIMNHKERFQFPTQLADVSENAKDLIRRLICSREHRLGQNGIEDFKNHPFFVGIDWDNIRNCEAPYIPEVSSPTDTSNFDVDDDCLKNCETMPPPTHTGFSGHHLPFVGFTYTSNCVL----SDRSSLRDAS-----GTPSTDLDANVQRSLEDSLATEAYERRIRRLEQEKVELTRKLQES-TQAVQ-ALQHSAVDGPVTASKDLEIKSLKEELDKLKTLGANQLTQQLDKSGLARPDFEEFSRQIRVFEKQVKVLKQEKEDLNKDLVESNEKMKTQTKELKEAQSQRKQALQEMAELNERLTELRSQKQKFVRQLRDKEEEMEAVAQKLEGLRQDLRRVERAKKELEAQMDSAASEASKDRKL-REKSEQYTKQLESELEGLKLKQVGRPLGVSNSEHQ--QEIAKLKTDLEK-KSVFYEEEFAKREALHAGEIKNLKKELRDAESQQLNLNKEILVLKDKLDKTRRESQSEREE-------FEAEMKQKFDRERLLLMEENKKLSSELDKLSAMFEKLSVNNRHLEEEMRDLADKKESVAHWEAQITEIIQWVSDEKDARGYLQALASKMTEELDTLRNSSLGAKPTDMPWKMRRFAKLDMSARLELQSALDAEIRAKQAIQEELNKAKAAIIATECKLQESDKKNQDLTTEIEKLKWETDELRSEKGVKHQESQNSFLAFLNAPTSVLDHFEMDSVDNFTLSNTPSRDEDVKSQGPSRSRSPSTMSDIEPPEVPAPTIGIELCTPKAHQFVVKTFNAPTKCNQCTSLMVGLIRQGCTCEVCGFSCHVTC-ADKAPAVCPIPTDQTKGPLGIDPQKGIGTAYEGHVKVPKPAGVKKGWQRAMAVVCDFKLFLYEIAEGKSSQTSCVVS----QVIDMRDEEFAVSSVLASDVIHANRKDIPCIFRVTASQLSASSNKCSILLLADSESEKGKWVGVLNELHRILKKNKLKDRSVYVPKEAYDSTLPLIKNTQ---SAAILDHERIALGNEEGLFVVHVTKDEIIRVGDNKKVHQVELIPSE--QLIAVISGRNRHVRLYPMISLDGRETEFYKLVET-KGCQGIVSGQ--VRHGA------------------------LTCLCVSMKRQVLCYELNQSKTRHKKIKEIQVPGNVQWMAI--FNERLCVGYQSGFMRYPLHADGSP----YSLLHSDDHTLSFITQQATDAICAVEISNKEYLLCFSSVGVYVDCQGRRSRQQELMWPAGP---------LSC----------------CKCPAVRPLNSEGSLNILG---------LETIRLIYFKNKMAEGDELVVPETSD---NSRKQMVRNMNNKRRYSFRV--------------PEEERMQQRREMLRD-PEMR-NKLISNPTNFNHIAHMGPGDGIQIL 1571          
BLAST of Serine/threonine kinase vs. Ensembl Xenopus
Match: CDC42BPA (CDC42 binding protein kinase alpha [Source:NCBI gene;Acc:100497067])

HSP 1 Score: 669.848 bits (1727), Expect = 0.000e+0
Identity = 525/1627 (32.27%), Postives = 806/1627 (49.54%), Query Frame = 2
Query:  116 SVTLEFLIDSLFCTYYECRLPFHKDEKNVAQFIKSIKGTVDKIESLRIRRSDFDTIRVIGRGAFGKVSVVRFKEKGEIYAMKSLHKYDILKKIDAACFQEERDVLFQAMKIKSPWITRLHYAFQDEFYLYFVMDFYNGGDMLTLLSKFNDRLPEEITKFYIAEVVMSIDVVHKLGYLHRDIKPDNLLLDSLGHIVLADFGSCVKLRPNGTTITERAVGTPDYISPEILRSAE-GHGPYGVECDWWSLGIVIHEMLYGELPFYNEDFSETYWQIMNFETCFQIPTEYDDVSDEAEDLIKQLICKKECRLGNKGIDDFKNHPFFREIDWDNLRSYNAPFIPEVSSAEDTSNFEFDD---FNANHEGPPLSSNFKGCHLPCIGFTFTKDFIFNEMGSEESSVRLKSLMENIGAPAL-LNGNHNESNSDALLEEVNQLKITCSQLEK-QLNECRTNSVQRIF-----SHPVYQQL------VTDKEKLLTQCQNYDYSLR----EKEQKMDDLIETNRLL---NKERDELTSDRLQILQKKQDIEE---DLKVMTENF-NQLKSTNKAINRXXXXXXXXXXXXXXXXXXXXXXXXHLSIQKNQSQPDIQVEKQRFEEVMLQLRSENDQMLEKMRLKCSNLTNSLEQSDQTIFNIKEEIKSLKEIFTNKE-KNLKLSHDNEIEQLKISVAEEQSRILASNTQLKSQVKSLSEENVELRSSLQEISNKNMKFHFRLKTILDKE-IVKTSENSELLTELDREVELLKTLCVDND---------GDQK----------------------AQG----------ERQDNNGNES---------WRLRKCVKADKIEISNLNLTLQSERRARADLEKKLTQQKSEIC--------------DISKQLEKYKQDVNEKDN------LIANLKSASQNLE-----------------PHVPKEIPSNPVTLSEFNSILSGSLDKTVVNCNQHVFSHSTFNRPIKCDYCTSHMLGQYYQGVKCKECSFSCHHYCLSNVLNDKC--YTRKSAGK-GANLKNGIGTMYENFIKVPKPGGIRRGWKRQFMALCDLKLFFFDVKEGSTGTQMPDISRNPCRVIDLKYTEFKVVKVSRDEVMHAPKKDVEFIIKIS---IENSSTMLPIYVLFESVDNKEDCIKVIEEARSYIKKDP-HYRMIFTEKSCLNN-LDISMNYRQILSAAIIDQSTLLFGTEEGL--LKVTDSGYNKIGEKKPVYIIESLDQQELQLVAVIQSKQRVLKLLLSGILDGAHDWEPIIVENGKSCTTFVVGKSYVSPGNQFAPYADTMLANSTFHIKSPSNDRIWIMCAAFKNSVEVYHLNLKLTRHEKLRQILCNTSVTSLQIAGHGEQLLIGMHDSVAIYSLWETGSPXXXXXXXXXXXXXNFQYIFQTNFESMLIVEISFNEYLILFECAGIFINRNHRQTR-PDLQWPDKPTRFTYRAPYLLCFTEMAGLFAYEITEHSCNLVQALPLRSSKPLDRSGHILTTANEFIQAIDLIYVHLVSANEEKISIGKTIDKTSSSNTLSIFKFLNKRKPSYNKQEDSFDTNDAISPNPAGNSTKSTGLKYRDKPTLKSNRQISVPQNFRHLSHMGPDVPCQLI 4612
            S+++E L+DSL C Y EC     + +K++  +I+  K    K++ +R+ + DF+ ++VIGRGAFG+V+VV+ K   +++AMK L+K+++LK+ + ACF+EERDVL       S WIT LHYAFQD+  LY VMD+Y GGD+LTLLSKF DRLPE++++FY+AE+V++ID VH+L Y+HRDIKPDN+LLD  GHI LADFGSC+KL  +GT  +  AVGTPDYISPEIL++ E G G YG ECDWWSLG+ ++EMLYGE PFY E   ETY +IMN +  FQ PT+  DVS+ A+DLI++LIC +E RLG  GI+DFKNHPFF  IDWDN+R+  AP+IPEVSS  DTSNF+ DD    N     PP  + F G HLP +GFT+T + +     S+ SS+R  S     G P+  L+ N   S  D+L  E  + +I   + EK +L       V   F     ++ + QQL        D E+   Q + ++  ++    EKE    DL+E+N  +    KE  E  S R Q LQ+  ++ E   +L+   + F  QL+   + +      LE     L++    +KE    +    +++  D ++ +++ E+   QL SE + +  K   +   ++NS  Q  Q I  +K +++  K +F  +E    +  H  EI+ LK  + + +S+ L  N ++      L +   E +S  +E       F   +K   D+E ++   EN +L +ELD+   + + L V+N           D+K                      A+G          E  D   N S         W++R+  K D      L   L +E RA+  ++++L + K+ I               D++ ++EK K + +E  +      ++    S    +                       +IP +P    + N   +G   K       H F   TFN P KC+ CTS M+G   QG  C+ C FSCH  C ++     C   T ++ G  G + + GIGT YE  +KVPKP G+++GW+R    +CD KLF +++ EG +      +S    +VID++  EF V  V   +V+HA +KD+  I +++   +  SS    I +L +S   K   + V+ E    +KK+    R ++  K   ++ L +  N +   SAAI+D   +  G EEGL  + VT     ++G+ K V+ +E +  +  QL+AVI  + R ++L     LDG       +VE  K C   V G+  V  G                         +  +C + K  V  Y LN   TRH+K+++I    +V  + I    E+L +G       Y L   GSP    +  L   D    +I Q   +++  VEIS  EYL+ F   G++++   R++R  +L WP  P         L C          +I E S  +         +PL+  G +       ++ I LIY       + K+     + +TS ++   + + +N      NK+  SF         P     +      RD P ++ N+ IS P NF H++HMGP    Q++
Sbjct:   23 SLSVESLLDSLLCLYDECSASPLRRDKHINDYIQWAKPFALKVKQMRLHKEDFEILKVIGRGAFGEVAVVKLKNADKVFAMKILNKWEMLKRAETACFREERDVLVNG---DSQWITTLHYAFQDDNNLYLVMDYYVGGDLLTLLSKFEDRLPEDMSRFYLAEMVLAIDSVHQLHYVHRDIKPDNILLDMNGHIRLADFGSCLKLMEDGTVQSSVAVGTPDYISPEILQAMEDGKGKYGPECDWWSLGVCMYEMLYGETPFYAESLVETYGKIMNHKERFQFPTQLADVSENAKDLIRRLICSREHRLGQNGIEDFKNHPFFVGIDWDNIRNCEAPYIPEVSSPTDTSNFDVDDDCLKNCETMPPPTHTGFSGHHLPFVGFTYTSNCVL----SDRSSLRDAS-----GTPSTDLDANVQRSLEDSLATEAYERRIRRLEQEKVELTRKLQGLVTDFFFCSVGANQLTQQLDKSGLARPDFEEFSRQIRVFEKQVKVLKQEKEDLNKDLVESNEKMKTQTKELKEAQSQRKQALQEMAELNERLTELRSQKQKFVRQLRDKEEEMEAVAQKLEGLRQDLRRVERAKKELEAQMDSAASEASKDRKL-REKSEQYTKQLESELEGLKLKQVGRPLGVSNSEHQ--QEIAKLKTDLEK-KSVFYEEEFAKREALHAGEIKNLKKELRDAESQQLNLNKEILVLKDKLDKTRRESQSEREE-------FEAEMKQKFDRERLLLMEENKKLSSELDKLSAMFEKLSVNNRHLEEEMRDLADKKESVAHWEAQITEIIQWVSDEKDARGYLQALASKMTEELDTLRNSSLGAKPTDMPWKMRRFAKLDMSARLELQSALDAEIRAKQAIQEELNKAKAAIIATECKLQESDKKNQDLTTEIEKLKWETDELRSEKGIWPIMWGFSSQHSKIWGGNVYILCGVTVTLYCCAASWSDIPPSPPAADQQN---NGKGPKA------HQFVVKTFNAPTKCNQCTSLMVGLIRQGCTCEVCGFSCHVTC-ADKAPAVCPIPTDQTKGPLGIDPQKGIGTAYEGHVKVPKPAGVKKGWQRAMAVVCDFKLFLYEIAEGKSSQTSCVVS----QVIDMRDEEFAVSSVLASDVIHANRKDIPCIFRVTASQLSASSNKCSILLLADSESEKGKWVGVLNELHRILKKNKLKDRSVYVPKEAYDSTLPLIKNTQ---SAAILDHERIALGNEEGLFVVHVTKDEIIRVGDNKKVHQVELIPSE--QLIAVISGRNRHVRLYPMISLDGRETEFYKLVET-KGCQGIVSGQ--VRHGA------------------------LTCLCVSMKRQVLCYELNQSKTRHKKIKEIQVPGNVQWMAI--FNERLCVGYQSGFMRYPLHADGSP----YSLLHSDDHTLSFITQQATDAICAVEISNKEYLLCFSSVGVYVDCQGRRSRQQELMWPAGP---------LSC----CKCPGQDIRETSWTV---------RPLNSEGSLNILG---LETIRLIYF------KNKMGDELVVPETSDNSRKQMVRNMN------NKRRYSFRV-------PEEERMQQRREMLRD-PEMR-NKLISNPTNFNHIAHMGPGDGIQIL 1528          
BLAST of Serine/threonine kinase vs. Ensembl Mouse
Match: Cdc42bpa (CDC42 binding protein kinase alpha [Source:MGI Symbol;Acc:MGI:2441841])

HSP 1 Score: 687.182 bits (1772), Expect = 0.000e+0
Identity = 517/1644 (31.45%), Postives = 809/1644 (49.21%), Query Frame = 2
Query:   32 MSIKLTLKQRHENLIKEFLLNYKSSV-PDSVTLEFLIDSLFCTYYECRLPFHKDEKNVAQFIKSIKGTVDKIESLRIRRSDFDTIRVIGRGAFGKVSVVRFKEKGEIYAMKSLHKYDILKKIDAACFQEERDVLFQAMKIKSPWITRLHYAFQDEFYLYFVMDFYNGGDMLTLLSKFNDRLPEEITKFYIAEVVMSIDVVHKLGYLHRDIKPDNLLLDSLGHIVLADFGSCVKLRPNGTTITERAVGTPDYISPEILRSAE-GHGPYGVECDWWSLGIVIHEMLYGELPFYNEDFSETYWQIMNFETCFQIPTEYDDVSDEAEDLIKQLICKKECRLGNKGIDDFKNHPFFREIDWDNLRSYNAPFIPEVSSAEDTSNFEFDD---FNANHEGPPLSSNFKGCHLPCIGFTFTKDFIFNEMGSEESSVRLKSLMENIGAPALLNGNHNESNSDALLEEVNQLKITCSQLEKQLNECRTNSVQRIFSHPVYQQLVTDKEKLLTQCQNYDYSLREK-------EQKMDDLIETNRLLNKERDELTSDRLQILQKKQDIEEDLKVMTENFNQLKSTNKAI-----NRXXXXXXXXXXXXXXXXXXXXXXXXHLSIQKNQSQPDIQVEK--------QRFE----------EVMLQLRSENDQMLEKMRLKCSNLTNSLE----------------QSDQTIFNIKEEIKSLKEIFTNKEKNLKLS-HDNEIEQLKISVAEEQSRILASNTQLKSQVKSLSEENVELRSSLQEISNKNMKFHFRLKTILDKEIVKTSENSELLTELDREVELLKTLCVDND---------GDQK---AQGERQ------------DNNG-----------------NES---------WRLRKCVKADKIEISNLNLTLQSERRARADLEKKLTQQKSEICDISKQLEKYKQDVNEKDNL-----IANLKSASQNLEPHVPKEIPSNPVTLSEFNSILSGSLDKTVVNCNQHVFSHSTFNRPIKCDYCTSHMLGQYYQGVKCKECSFSCHHYCLSNVLNDKCYTRKSAGKGA---NLKNGIGTMYENFIKVPKPGGIRRGWKRQFMALCDLKLFFFDVKEGSTGTQMPDISRNPCRVIDLKYTEFKVVKVSRDEVMHAPKKDVEFIIKIS---IENSSTMLPIYVLFESVDNKEDCIKVIEEARSYIKKDPHY-RMIFTEKSCLNNLDISMNYRQILSAAIIDQSTLLFGTEEGL--LKVTDSGYNKIGEKKPVYIIESLDQQELQLVAVIQSKQRVLKLLLSGILDGAHDWEPIIVENGKSCTTFVVGKSYVSPGNQFAPYADTMLANSTFHIKSPSNDRIWIMCAAFKNSVEVYHLNLKLTRHEKLRQILCNTSVTSLQIAGHGEQLLIGMHDSVAIYSLWETGSPXXXXXXXXXXXXXNFQYIFQTNFESMLIVEISFNEYLILFECAGIFINRNHRQTR-PDLQWPDKPTRFTYRAPYLLCFTEMAGLFAYEITEHSCNLVQALPLRSSKPLDRSGHILTTANEFIQAIDLIYVHLVSANEEKISIGKTIDKTSSSNTLSIFKFLNKRKPSYNKQEDSFDTNDAISPNPAGNSTKSTGLKYRDKPTLKSNRQISVPQNFRHLSHMGPDVPCQLI 4612
            MS ++ L+Q     +++F+L+  +       ++E L+D L C Y EC     + EKN+ ++++  K    K++ +R+ R DF+ ++VIGRGAFG+V+VV+ K   +++AMK L+K+++LK+ + ACF+EERDVL       S WIT LHYAFQD+  LY VMD+Y GGD+LTLLSKF DRLPEE+ +FY+AE+V++ID VH+L Y+HRDIKPDN+L+D  GHI LADFGSC+KL  +GT  +  AVGTPDYISPEIL++ E G G YG ECDWWSLG+ ++EMLYGE PFY E   ETY +IMN +  FQ P +  DVS+ A+DLI++LIC +E RLG  GI+DFK HPFF  IDWDN+R+  AP+IPEVSS  DTSNF+ DD    N+    PP  + F G HLP +GFT+T   + ++      +    SL  ++     L+ N      +  ++ + Q K+   +L ++L E  T +VQ +    V   L   K+  +   +     LR++       EQ++++     R L+    ++ +   QI   +Q+ EE  K + +   +LK+ +K +      R+  + EF     +   +  +++     ++  + + D+ ++K        +R E          E ++   S++ ++ E+       L N LE                +  Q I  +K +++  K IF  +E + +   H +EI+ LK  + + + + LA N ++      L +   E +S  +E  N+  + + R K +L      T EN +L +ELD+   L ++L + N           D+K   A  E Q            D  G                 N S         W++R+  K D      L   L +E RA+  ++++L + K+     S  L + K   +EK NL     I  L   ++ L      E   +  +   F +  + +LD+       H F   +F  P KC  CTS M+G   QG  C+ C FSCH  C+ N     C       KG    + + G+GT YE  +++PKP G+++GW+R    +CD KLF +D+ EG        IS    +VID++  EF V  V   +V+HA +KD+  I +++   +   S    I +L +S + +   + V+ E    +KK+    R ++  K   ++    +   Q  +AAIID   +  G EEGL  + VT     ++G+ K ++ IE +     QLVAVI  + R ++L     LDG  + +   +   K C T   GK  V  G                         +  +C A K  V  Y L    TRH K ++I    +V  + I    E L +G       Y L   G P       L   D    +I     +++  VEIS  EYL+ F   GI+ +   R++R  +L WP  P+   Y APYL  ++E A +  +++  +S   +Q LPL+  +PL+  G +       ++ I LIY     A  +++ + +T D +      +I    NKR+ S+                P     +      RD P ++ N+ IS P NF H++HMGP    Q++
Sbjct:    1 MSGEVRLRQ-----LEQFILDGPAQTNGQCFSVETLLDILICLYDECNNSPLRREKNILEYLEWAKPFTSKVKQMRLHREDFEILKVIGRGAFGEVAVVKLKNADKVFAMKILNKWEMLKRAETACFREERDVLVNG---DSKWITTLHYAFQDDNNLYLVMDYYVGGDLLTLLSKFEDRLPEEMARFYLAEMVIAIDSVHQLHYVHRDIKPDNILMDMNGHIRLADFGSCLKLMEDGTVQSSVAVGTPDYISPEILQAMEDGKGRYGPECDWWSLGVCMYEMLYGETPFYAESLVETYGKIMNHKERFQFPAQVTDVSENAKDLIRRLICSREHRLGQNGIEDFKKHPFFSGIDWDNIRNCEAPYIPEVSSPTDTSNFDVDDDCLKNSETMPPPTHTAFSGHHLPFVGFTYTSSCVLSDRSCLRVTAGPTSLDLDVSVQRTLDNNLATEAYERRIKRLEQEKL---ELTRKLQES-TQTVQALQYSTVDGPLTASKDLEIKSLKEEIEKLRKQVAEVNHLEQQLEEANSVRRELDDAFRQIKASEKQIKTLQQEREELNKELVQASERLKNQSKELKDAHCQRKLAMQEFMEINERLTELHTQKQKLARHVRDKEEEVDLVMQKAESLRQELRRAERAKKELEVHTEALIAEASKDKKLREQSEHYSKQLENELEGLKQKQISYSPGICSIEHQQEITKLKTDLEK-KSIFYEEEISKREGIHASEIKNLKKELHDSEGQQLALNKEILVLKDKLEKTRRESQSEREEFENEFKQQYEREKVLL------TEENKKLTSELDKLTSLYESLSLRNQHLEEEVKDLADKKESVAHWEAQITEIIQWVSDEKDARGYLQALASKMTEELEALRNSSLGTRATDMPWKMRRFAKLDMSARLELQSALDAEIRAKQAIQEELNKVKA-----SNILTECKLKDSEKKNLELLSEIEQLIKDTEELRSEKGIEHQDSQHSFLAFLNTPTDALDQ--FERKTHQFFVKSFTAPTKCHQCTSLMVGLIRQGCSCEVCGFSCHITCV-NKAPTVCPVPPEQTKGPLGIDPQKGVGTAYEGHVRIPKPAGVKKGWQRALAVVCDFKLFLYDIAEGKASQPTSVIS----QVIDMRDEEFSVSSVLASDVIHASRKDIPCIFRVTASQLSAPSNKCSILMLADSENERSKWVGVLSELHKILKKNKFRDRSVYVPKEAYDSTLPLIKTTQ--AAAIIDHERIALGNEEGLFVVHVTKDEIVRVGDNKKIHQIELIPSD--QLVAVISGRNRHVRLFPMSALDG-RETDFYKLAETKGCQTIAAGK--VRHGA------------------------LSCLCVAMKRQVLCYELFQSKTRHRKFKEIQVPCNVQWMAI--FSEHLCVGFQSGFLRYPLNGEGGP----CNMLHSNDHTLSFISHQPMDALCAVEISNKEYLLCFNSIGIYTDCQGRRSRQQELMWPANPSSCCYNAPYLSVYSENA-VDIFDV--NSMEWIQTLPLKKVRPLNTEGSLNLLG---LETIRLIYFKNKMAEGDELVVPETSDNSRKQMVRNIN---NKRRYSFRV--------------PEEERMQQRREMLRD-PEMR-NKLISNPTNFNHIAHMGPGDGIQIL 1551          
BLAST of Serine/threonine kinase vs. Ensembl Mouse
Match: Cdc42bpa (CDC42 binding protein kinase alpha [Source:MGI Symbol;Acc:MGI:2441841])

HSP 1 Score: 681.404 bits (1757), Expect = 0.000e+0
Identity = 504/1595 (31.60%), Postives = 794/1595 (49.78%), Query Frame = 2
Query:   32 MSIKLTLKQRHENLIKEFLLNYKSSV-PDSVTLEFLIDSLFCTYYECRLPFHKDEKNVAQFIKSIKGTVDKIESLRIRRSDFDTIRVIGRGAFGKVSVVRFKEKGEIYAMKSLHKYDILKKIDAACFQEERDVLFQAMKIKSPWITRLHYAFQDEFYLYFVMDFYNGGDMLTLLSKFNDRLPEEITKFYIAEVVMSIDVVHKLGYLHRDIKPDNLLLDSLGHIVLADFGSCVKLRPNGTTITERAVGTPDYISPEILRSAE-GHGPYGVECDWWSLGIVIHEMLYGELPFYNEDFSETYWQIMNFETCFQIPTEYDDVSDEAEDLIKQLICKKECRLGNKGIDDFKNHPFFREIDWDNLRSYNAPFIPEVSSAEDTSNFEFDD---FNANHEGPPLSSNFKGCHLPCIGFTFTKDFIFNEMGSEESSVRLKSLMENIGAPALLNGNHNESNSDALLEEVNQLKITCSQLEKQLNECRTNSVQRIFSHPVYQQLVTDKEKLLTQCQNYDYSLREK-------EQKMDDLIETNRLLNKERDELTSDRLQILQKKQDIEE--DLKVMTENFNQLKSTNKAINRXXXXXXXXXXXXXXXXXXXXXXXXHLSIQKNQSQPDIQVEKQRFEEVMLQLRSENDQMLEKMRLKCSNLTNSLEQSDQTIFNIKEEIKSLKEIF--TNKE-KNLKLSHDNEIEQL----KISVAEEQSRILASNTQLKSQVKSLSEENVELRSSLQEISNKNMKF-HFRLKTILDKEIVKTSENSE-----LLTELDREVELLKTLCVDNDGDQKAQGERQDNNGNESWRLRKCVKADKIEISNLNLTLQSERRARADLEKKLTQQKSEICDISKQLEKYKQDVNEKDNL-----IANLKSASQNLEPHVPKEIPSNPVTLSEFNSILSGSLDK-TVVNC-------------------------NQHVFSHSTFNRPIKCDYCTSHMLGQYYQGVKCKECSFSCHHYCLSNVLNDKCYTRKSAGKGA---NLKNGIGTMYENFIKVPKPGGIRRGWKRQFMALCDLKLFFFDVKEGSTGTQMPDISRNPCRVIDLKYTEFKVVKVSRDEVMHAPKKDVEFIIKIS---IENSSTMLPIYVLFESVDNKEDCIKVIEEARSYIKKDPHY-RMIFTEKSCLNNLDISMNYRQILSAAIIDQSTLLFGTEEGL--LKVTDSGYNKIGEKKPVYIIESLDQQELQLVAVIQSKQRVLKLLLSGILDGAHDWEPIIVENGKSCTTFVVGKSYVSPGNQFAPYADTMLANSTFHIKSPSNDRIWIMCAAFKNSVEVYHLNLKLTRHEKLRQILCNTSVTSLQIAGHGEQLLIGMHDSVAIYSLWETGSPXXXXXXXXXXXXXNFQYIFQTNFESMLIVEISFNEYLILFECAGIFINRNHRQTR-PDLQWPDKPTRFTYRAPYLLCFTEMAGLFAYEITEHSCNLVQALPLRSSKPLDRSGHILTTANEFIQAIDLIYVHLVSANEEKISIGKTIDKTSSSNTLSIFKFLNKRKPSYNKQEDSFDTNDAISPNPAGNSTKSTGLKYRDKPTLKSNRQISVPQNFRHLSHMGPDVPCQLI 4612
            MS ++ L+Q     +++F+L+  +       ++E L+D L C Y EC     + EKN+ ++++  K    K++ +R+ R DF+ ++VIGRGAFG+V+VV+ K   +++AMK L+K+++LK+ + ACF+EERDVL       S WIT LHYAFQD+  LY VMD+Y GGD+LTLLSKF DRLPEE+ +FY+AE+V++ID VH+L Y+HRDIKPDN+L+D  GHI LADFGSC+KL  +GT  +  AVGTPDYISPEIL++ E G G YG ECDWWSLG+ ++EMLYGE PFY E   ETY +IMN +  FQ P +  DVS+ A+DLI++LIC +E RLG  GI+DFK HPFF  IDWDN+R+  AP+IPEVSS  DTSNF+ DD    N+    PP  + F G HLP +GFT+T   + ++      +    SL  ++     L+ N      +  ++ + Q K+   +L ++L E  T +VQ +    V   L   K+  +   +     LR++       EQ++++     R L+    ++ +   QI   +Q+ EE   L+V TE      S +K + RE+     +  + + + +K+K+      I   + Q +I   K   E+  +    E  +       +  NL   L  S+     + +EI  LK+    T +E ++ +   +NE +Q     K+ + EE  ++ +   +L S  +SLS  N  L   ++++++K     H+  +     + V   +++      L +++  E+E L+           + G R  +     W++R+  K D      L   L +E RA+  ++++L + K+     S  L + K   +EK NL     I  L   ++ L      E   +  +   F +  + +LD+  + +C                           H F   +F  P KC  CTS M+G   QG  C+ C FSCH  C+ N     C       KG    + + G+GT YE  +++PKP G+++GW+R    +CD KLF +D+ EG        IS    +VID++  EF V  V   +V+HA +KD+  I +++   +   S    I +L +S + +   + V+ E    +KK+    R ++  K   ++    +   Q  +AAIID   +  G EEGL  + VT     ++G+ K ++ IE +     QLVAVI  + R ++L     LDG  + +   +   K C T   GK                            +  +  +C A K  V  Y L    TRH K ++I    +V  + I    E L +G       Y L   G P       L   D    +I     +++  VEIS  EYL+ F   GI+ +   R++R  +L WP  P+   Y APYL  ++E A +  +++  +S   +Q LPL+  +PL+  G +       ++ I LIY     A  +++ + +T D +      +I    NKR+ S+                P     +      RD P ++ N+ IS P NF H++HMGP    Q++
Sbjct:    1 MSGEVRLRQ-----LEQFILDGPAQTNGQCFSVETLLDILICLYDECNNSPLRREKNILEYLEWAKPFTSKVKQMRLHREDFEILKVIGRGAFGEVAVVKLKNADKVFAMKILNKWEMLKRAETACFREERDVLVNG---DSKWITTLHYAFQDDNNLYLVMDYYVGGDLLTLLSKFEDRLPEEMARFYLAEMVIAIDSVHQLHYVHRDIKPDNILMDMNGHIRLADFGSCLKLMEDGTVQSSVAVGTPDYISPEILQAMEDGKGRYGPECDWWSLGVCMYEMLYGETPFYAESLVETYGKIMNHKERFQFPAQVTDVSENAKDLIRRLICSREHRLGQNGIEDFKKHPFFSGIDWDNIRNCEAPYIPEVSSPTDTSNFDVDDDCLKNSETMPPPTHTAFSGHHLPFVGFTYTSSCVLSDRSCLRVTAGPTSLDLDVSVQRTLDNNLATEAYERRIKRLEQEKL---ELTRKLQES-TQTVQALQYSTVDGPLTASKDLEIKSLKEEIEKLRKQVAEVNHLEQQLEEANSVRRELDDAFRQIKASEKQIKTLQQEREELNKLEVHTEALIAEASKDKKL-REQSEHYSKQLENELEGLKQKQISYSPGICSIEHQQEITKLKTDLEKKSIFYEEEISKREGIHASEIKNLKKELHDSEGQQLALNKEILVLKDKLEKTRRESQSEREEFENEFKQQYEREKVLLTEENKKLTSELDKLTSLYESLSLRNQHLEEEVKDLADKKESVAHWEAQITEIIQWVSDEKDARGYLQALASKMTEELEALRN---------SSLGTRATDM---PWKMRRFAKLDMSARLELQSALDAEIRAKQAIQEELNKVKA-----SNILTECKLKDSEKKNLELLSEIEQLIKDTEELRSEKGIEHQDSQHSFLAFLNTPTDALDQFEIADCAPLPAHTPTLRKKGCPASTGFPPKRKTHQFFVKSFTAPTKCHQCTSLMVGLIRQGCSCEVCGFSCHITCV-NKAPTVCPVPPEQTKGPLGIDPQKGVGTAYEGHVRIPKPAGVKKGWQRALAVVCDFKLFLYDIAEGKASQPTSVIS----QVIDMRDEEFSVSSVLASDVIHASRKDIPCIFRVTASQLSAPSNKCSILMLADSENERSKWVGVLSELHKILKKNKFRDRSVYVPKEAYDSTLPLIKTTQ--AAAIIDHERIALGNEEGLFVVHVTKDEIVRVGDNKKIHQIELIPSD--QLVAVISGRNRHVRLFPMSALDG-RETDFYKLAETKGCQTIAAGKV--------------------------RHGALSCLCVAMKRQVLCYELFQSKTRHRKFKEIQVPCNVQWMAI--FSEHLCVGFQSGFLRYPLNGEGGP----CNMLHSNDHTLSFISHQPMDALCAVEISNKEYLLCFNSIGIYTDCQGRRSRQQELMWPANPSSCCYNAPYLSVYSENA-VDIFDV--NSMEWIQTLPLKKVRPLNTEGSLNLLG---LETIRLIYFKNKMAEGDELVVPETSDNSRKQMVRNIN---NKRRYSFRV--------------PEEERMQQRREMLRD-PEMR-NKLISNPTNFNHIAHMGPGDGIQIL 1498          
BLAST of Serine/threonine kinase vs. Ensembl Mouse
Match: Cdc42bpa (CDC42 binding protein kinase alpha [Source:MGI Symbol;Acc:MGI:2441841])

HSP 1 Score: 680.248 bits (1754), Expect = 0.000e+0
Identity = 516/1670 (30.90%), Postives = 811/1670 (48.56%), Query Frame = 2
Query:   32 MSIKLTLKQRHENLIKEFLLNYKSSV-PDSVTLEFLIDSLFCTYYECRLPFHKDEKNVAQFIKSIKGTVDKIESLRIRRSDFDTIRVIGRGAFGKVSVVRFKEKGEIYAMKSLHKYDILKKIDAACFQEERDVLFQAMKIKSPWITRLHYAFQDEFYLYFVMDFYNGGDMLTLLSKFNDRLPEEITKFYIAEVVMSIDVVHKLGYLHRDIKPDNLLLDSLGHIVLADFGSCVKLRPNGTTITERAVGTPDYISPEILRSAE-GHGPYGVECDWWSLGIVIHEMLYGELPFYNEDFSETYWQIMNFETCFQIPTEYDDVSDEAEDLIKQLICKKECRLGNKGIDDFKNHPFFREIDWDNLRSYNAPFIPEVSSAEDTSNFEFDD---FNANHEGPPLSSNFKGCHLPCIGFTFTKDFIFNEMGSEESSVRLKSLMENIGAPALLNGNHNESNSDALLEEVNQLKITCSQLEKQLNECRTNSVQRIFSHPVYQQLVTDKEKLLTQCQNYDYSLREK-------EQKMDDLIETNRLLNKERDELTSDRLQILQKKQDIEEDLKVMTENFNQLKSTNKAI-----NRXXXXXXXXXXXXXXXXXXXXXXXXHLSIQKNQSQPDIQVEK--------QRFE----------EVMLQLRSENDQMLEKMRLKCSNLTNSLE----------------QSDQTIFNIKEEIKSLKEIFTNKEKNLKLS-HDNEIEQLKISVAEEQSRILASNTQLKSQVKSLSEENVELRSSLQEISNKNMKFHFRLKTILDKEIVKTSENSELLTELDREVELLKTLCVDND---------GDQK---AQGERQ------------DNNG--------------------------NESWRLRKCVKADKIEISNLNLTLQSERRARADLEKKLTQQKSEICDISKQLEKYKQDVNEKDNL-----IANLKSASQNLEPHVPKEIPSNPVTLSEFNSILSGSLDK-TVVNC-------------------------NQHVFSHSTFNRPIKCDYCTSHMLGQYYQGVKCKECSFSCHHYCLSNVLNDKCYTRKSAGKGA---NLKNGIGTMYENFIKVPKPGGIRRGWKRQFMALCDLKLFFFDVKEGSTGTQMPDISRNPCRVIDLKYTEFKVVKVSRDEVMHAPKKDVEFIIKIS---IENSSTMLPIYVLFESVDNKEDCIKVIEEARSYIKKDPHY-RMIFTEKSCLNNLDISMNYRQILSAAIIDQSTLLFGTEEGL--LKVTDSGYNKIGEKKPVYIIESLDQQELQLVAVIQSKQRVLKLLLSGILDGAHDWEPIIVENGKSCTTFVVGKSYVSPGNQFAPYADTMLANSTFHIKSPSNDRIWIMCAAFKNSVEVYHLNLKLTRHEKLRQILCNTSVTSLQIAGHGEQLLIGMHDSVAIYSLWETGSPXXXXXXXXXXXXXNFQYIFQTNFESMLIVEISFNEYLILFECAGIFINRNHRQTR-PDLQWPDKPTRFTYRAPYLLCFTEMAGLFAYEITEHSCNLVQALPLRSSKPLDRSGHILTTANEFIQAIDLIYVHLVSANEEKISIGKTIDKTSSSNTLSIFKFLNKRKPSYNKQEDSFDTNDAISPNPAGNSTKSTGLKYRDKPTLKSNRQISVPQNFRHLSHMGPDVPCQLI 4612
            MS ++ L+Q     +++F+L+  +       ++E L+D L C Y EC     + EKN+ ++++  K    K++ +R+ R DF+ ++VIGRGAFG+V+VV+ K   +++AMK L+K+++LK+ + ACF+EERDVL       S WIT LHYAFQD+  LY VMD+Y GGD+LTLLSKF DRLPEE+ +FY+AE+V++ID VH+L Y+HRDIKPDN+L+D  GHI LADFGSC+KL  +GT  +  AVGTPDYISPEIL++ E G G YG ECDWWSLG+ ++EMLYGE PFY E   ETY +IMN +  FQ P +  DVS+ A+DLI++LIC +E RLG  GI+DFK HPFF  IDWDN+R+  AP+IPEVSS  DTSNF+ DD    N+    PP  + F G HLP +GFT+T   + ++      +    SL  ++     L+ N      +  ++ + Q K+   +L ++L E  T +VQ +    V   L   K+  +   +     LR++       EQ++++     R L+    ++ +   QI   +Q+ EE  K + +   +LK+ +K +      R+  + EF     +   +  +++     ++  + + D+ ++K        +R E          E ++   S++ ++ E+       L N LE                +  Q I  +K +++  K IF  +E + +   H +EI+ LK  + + + + LA N ++      L +   E +S  +E  N+  + + R K +L      T EN +L +ELD+   L ++L + N           D+K   A  E Q            D  G                          +  W++R+  K D      L   L +E RA+  ++++L + K+     S  L + K   +EK NL     I  L   ++ L      E   +  +   F +  + +LD+  + +C                           H F   +F  P KC  CTS M+G   QG  C+ C FSCH  C+ N     C       KG    + + G+GT YE  +++PKP G+++GW+R    +CD KLF +D+ EG        IS    +VID++  EF V  V   +V+HA +KD+  I +++   +   S    I +L +S + +   + V+ E    +KK+    R ++  K   ++    +   Q  +AAIID   +  G EEGL  + VT     ++G+ K ++ IE +     QLVAVI  + R ++L     LDG  + +   +   K C T   GK  V  G                         +  +C A K  V  Y L    TRH K ++I    +V  + I    E L +G       Y L   G P       L   D    +I     +++  VEIS  EYL+ F   GI+ +   R++R  +L WP  P+   Y APYL  ++E A +  +++  +S   +Q LPL+  +PL+  G +       ++ I LIY     A  +++ + +T D +      +I    NKR+ S+                P     +      RD P ++ N+ IS P NF H++HMGP    Q++
Sbjct:    1 MSGEVRLRQ-----LEQFILDGPAQTNGQCFSVETLLDILICLYDECNNSPLRREKNILEYLEWAKPFTSKVKQMRLHREDFEILKVIGRGAFGEVAVVKLKNADKVFAMKILNKWEMLKRAETACFREERDVLVNG---DSKWITTLHYAFQDDNNLYLVMDYYVGGDLLTLLSKFEDRLPEEMARFYLAEMVIAIDSVHQLHYVHRDIKPDNILMDMNGHIRLADFGSCLKLMEDGTVQSSVAVGTPDYISPEILQAMEDGKGRYGPECDWWSLGVCMYEMLYGETPFYAESLVETYGKIMNHKERFQFPAQVTDVSENAKDLIRRLICSREHRLGQNGIEDFKKHPFFSGIDWDNIRNCEAPYIPEVSSPTDTSNFDVDDDCLKNSETMPPPTHTAFSGHHLPFVGFTYTSSCVLSDRSCLRVTAGPTSLDLDVSVQRTLDNNLATEAYERRIKRLEQEKL---ELTRKLQES-TQTVQALQYSTVDGPLTASKDLEIKSLKEEIEKLRKQVAEVNHLEQQLEEANSVRRELDDAFRQIKASEKQIKTLQQEREELNKELVQASERLKNQSKELKDAHCQRKLAMQEFMEINERLTELHTQKQKLARHVRDKEEEVDLVMQKAESLRQELRRAERAKKELEVHTEALIAEASKDKKLREQSEHYSKQLENELEGLKQKQISYSPGICSIEHQQEITKLKTDLEK-KSIFYEEEISKREGIHASEIKNLKKELHDSEGQQLALNKEILVLKDKLEKTRRESQSEREEFENEFKQQYEREKVLL------TEENKKLTSELDKLTSLYESLSLRNQHLEEEVKDLADKKESVAHWEAQITEIIQWVSDEKDARGYLQALASKMTEELEALRNSSLGTRATDMPWKMRRFAKLDMSARLELQSALDAEIRAKQAIQEELNKVKA-----SNILTECKLKDSEKKNLELLSEIEQLIKDTEELRSEKGIEHQDSQHSFLAFLNTPTDALDQFEIADCAPLPAHTPTLRKKGCPASTGFPPKRKTHQFFVKSFTAPTKCHQCTSLMVGLIRQGCSCEVCGFSCHITCV-NKAPTVCPVPPEQTKGPLGIDPQKGVGTAYEGHVRIPKPAGVKKGWQRALAVVCDFKLFLYDIAEGKASQPTSVIS----QVIDMRDEEFSVSSVLASDVIHASRKDIPCIFRVTASQLSAPSNKCSILMLADSENERSKWVGVLSELHKILKKNKFRDRSVYVPKEAYDSTLPLIKTTQ--AAAIIDHERIALGNEEGLFVVHVTKDEIVRVGDNKKIHQIELIPSD--QLVAVISGRNRHVRLFPMSALDG-RETDFYKLAETKGCQTIAAGK--VRHGA------------------------LSCLCVAMKRQVLCYELFQSKTRHRKFKEIQVPCNVQWMAI--FSEHLCVGFQSGFLRYPLNGEGGP----CNMLHSNDHTLSFISHQPMDALCAVEISNKEYLLCFNSIGIYTDCQGRRSRQQELMWPANPSSCCYNAPYLSVYSENA-VDIFDV--NSMEWIQTLPLKKVRPLNTEGSLNLLG---LETIRLIYFKNKMAEGDELVVPETSDNSRKQMVRNIN---NKRRYSFRV--------------PEEERMQQRREMLRD-PEMR-NKLISNPTNFNHIAHMGPGDGIQIL 1579          
BLAST of Serine/threonine kinase vs. Ensembl Mouse
Match: Cdc42bpa (CDC42 binding protein kinase alpha [Source:MGI Symbol;Acc:MGI:2441841])

HSP 1 Score: 649.432 bits (1674), Expect = 0.000e+0
Identity = 506/1679 (30.14%), Postives = 805/1679 (47.95%), Query Frame = 2
Query:   32 MSIKLTLKQRHENLIKEFLLNYKSSV-PDSVTLEFLIDSLFCTYYECRLPFHKDEKNVAQFIKSIKGTVDKIESLRIRRSDFDTIRVIGRGAFGKVSVVRFKEKGEIYAMKSLHKYDILKKIDAACFQEERDVLFQAMKIKSPWITRLHYAFQDEFYLYFVMDFYNGGDMLTLLSKFNDRLPEEITKFYIAEVVMSIDVVHKLGYLHRDIKPDNLLLDSLGHIVLADFGSCVKLRPNGTTITERAVGTPDYISPEILRSAE-GHGPYGVECDWWSLGIVIHEMLYGELPFYNEDFSETYWQIMNFETCFQIPTEYDDVSDEAEDLIKQLICKKECRLGNKGIDDFKNHPFFREIDWDNLRSYNAPFIPEVSSAEDTSNFEFDD---FNANHEGPPLSSNFKGCHLPCIGFTFTKDFIFNEMGSEESSVRLKSLMENIGAPALLNGNHNESNSDALLEEVNQLKITCSQLEKQLNECRTNSVQRIFSHPVYQQLVTDKEKLLTQCQNYDYSLREK-------EQKMDDLIETNRLLNKERDELTSDRLQILQKKQDIEEDLKVMTENFNQLKSTNKAI-----NRXXXXXXXXXXXXXXXXXXXXXXXXHLSIQKNQSQPDIQVEK--------QRFE----------EVMLQLRSENDQMLEKMRLKCSNLTNSLE----------------QSDQTIFNIKEEIKSLKEIFTNKEKNLKLS-HDNEIEQLKISVAEEQSRILASNTQLKSQVKSLSEENVELRSSLQEISNKNMKFHFRLKTILDKEIVKTSENSELLTELDREVELLKTLCVDND---------GDQK---AQGERQ------------DNNG--------------------------NESWRLRKCVKADKIEISNLNLTLQSERRARADLEKKLTQQKSE----ICDISKQLEKYKQDVNEKDNLIANL------KSASQNLEPHVPKEIPSNPV-TLSEFN---SILSGSLDKTVVNCNQHVFSHSTFNRPIKCDYCTS---------HMLGQYYQGVKCKECS-----------------FSCHHYCLSNVLNDKCYTRKSAGKGA---NLKNGIGTMYENFIKVPKPGGIRRGWKRQFMALCDLKLFFFDVKEGSTGTQMPDISRNPCRVIDLKYTEFKVVKVSRDEVMHAPKKDVEFIIKIS---IENSSTMLPIYVLFESVDNKEDCIKVIEEARSYIKKDPHY-RMIFTEKSCLNNLDISMNYRQILSAAIIDQSTLLFGTEEGL--LKVTDSGYNKIGEKKPVYIIESLDQQELQLVAVIQSKQRVLKLLLSGILDGAHDWEPIIVENGKSCTTFVVGKSYVSPGNQFAPYADTMLANSTFHIKSPSNDRIWIMCAAFKNSVEVYHLNLKLTRHEKLRQILCNTSVTSLQIAGHGEQLLIGMHDSVAIYSLWETGSPXXXXXXXXXXXXXNFQYIFQTNFESMLIVEISFNEYLILFECAGIFINRNHRQTR-PDLQWPDKPTRFTYRAPYLLCFTEMAGLFAYEITEHSCNLVQALPLRSSKPLDRSGHILTTANEFIQAIDLIYVHLVSANEEKISIGKTIDKTSSSNTLSIFKFLNKRKPSYNKQEDSFDTNDAISPNPAGNSTKSTGLKYRDKPTLKSNRQISVPQNFRHLSHMGPDVPCQLI 4612
            MS ++ L+Q     +++F+L+  +       ++E L+D L C Y EC     + EKN+ ++++  K    K++ +R+ R DF+ ++VIGRGAFG+V+VV+ K   +++AMK L+K+++LK+ + ACF+EERDVL       S WIT LHYAFQD+  LY VMD+Y GGD+LTLLSKF DRLPEE+ +FY+AE+V++ID VH+L Y+HRDIKPDN+L+D  GHI LADFGSC+KL  +GT  +  AVGTPDYISPEIL++ E G G YG ECDWWSLG+ ++EMLYGE PFY E   ETY +IMN +  FQ P +  DVS+ A+DLI++LIC +E RLG  GI+DFK HPFF  IDWDN+R+  AP+IPEVSS  DTSNF+ DD    N+    PP  + F G HLP +GFT+T   + ++      +    SL  ++     L+ N      +  ++ + Q K+   +L ++L E  T +VQ +    V   L   K+  +   +     LR++       EQ++++     R L+    ++ +   QI   +Q+ EE  K + +   +LK+ +K +      R+  + EF     +   +  +++     ++  + + D+ ++K        +R E          E ++   S++ ++ E+       L N LE                +  Q I  +K +++  K IF  +E + +   H +EI+ LK  + + + + LA N ++      L +   E +S  +E  N+  + + R K +L      T EN +L +ELD+   L ++L + N           D+K   A  E Q            D  G                          +  W++R+  K D      L   L +E RA+  ++++L + K+      C +    +K  + ++E + LI +       K        H      + P   L +F    S    S  + + +C   + +H+   R   C   T            +  +    KC +C+                 FSCH  C+ N     C       KG    + + G+GT YE  +++PKP G+++GW+R    +CD KLF +D+ EG        IS    +VID++  EF V  V   +V+HA +KD+  I +++   +   S    I +L +S + +   + V+ E    +KK+    R ++  K   ++    +   Q  +AAIID   +  G EEGL  + VT     ++G+ K ++ IE +     QLVAVI  + R ++L     LDG  + +   +   K C T   GK  V  G                         +  +C A K  V  Y L    TRH K ++I    +V  + I    E L +G       Y L   G P       L   D    +I     +++  VEIS  EYL+ F   GI+ +   R++R  +L WP  P+   Y APYL  ++E A +  +++  +S   +Q LPL+  +PL+  G +       ++ I LIY     A  +++ + +T D +      +I    NKR+ S+                P     +      RD P ++ N+ IS P NF H++HMGP    Q++
Sbjct:    1 MSGEVRLRQ-----LEQFILDGPAQTNGQCFSVETLLDILICLYDECNNSPLRREKNILEYLEWAKPFTSKVKQMRLHREDFEILKVIGRGAFGEVAVVKLKNADKVFAMKILNKWEMLKRAETACFREERDVLVNG---DSKWITTLHYAFQDDNNLYLVMDYYVGGDLLTLLSKFEDRLPEEMARFYLAEMVIAIDSVHQLHYVHRDIKPDNILMDMNGHIRLADFGSCLKLMEDGTVQSSVAVGTPDYISPEILQAMEDGKGRYGPECDWWSLGVCMYEMLYGETPFYAESLVETYGKIMNHKERFQFPAQVTDVSENAKDLIRRLICSREHRLGQNGIEDFKKHPFFSGIDWDNIRNCEAPYIPEVSSPTDTSNFDVDDDCLKNSETMPPPTHTAFSGHHLPFVGFTYTSSCVLSDRSCLRVTAGPTSLDLDVSVQRTLDNNLATEAYERRIKRLEQEKL---ELTRKLQES-TQTVQALQYSTVDGPLTASKDLEIKSLKEEIEKLRKQVAEVNHLEQQLEEANSVRRELDDAFRQIKASEKQIKTLQQEREELNKELVQASERLKNQSKELKDAHCQRKLAMQEFMEINERLTELHTQKQKLARHVRDKEEEVDLVMQKAESLRQELRRAERAKKELEVHTEALIAEASKDKKLREQSEHYSKQLENELEGLKQKQISYSPGICSIEHQQEITKLKTDLEK-KSIFYEEEISKREGIHASEIKNLKKELHDSEGQQLALNKEILVLKDKLEKTRRESQSEREEFENEFKQQYEREKVLL------TEENKKLTSELDKLTSLYESLSLRNQHLEEEVKDLADKKESVAHWEAQITEIIQWVSDEKDARGYLQALASKMTEELEALRNSSLGTRATDMPWKMRRFAKLDMSARLELQSALDAEIRAKQAIQEELNKVKASNILTECKLKDSEKKNLELLSEIEQLIKDTEELRSEKGIEHQDSQHSFLAFLNTPTDALDQFERSPSCTPASKGRRIADCAP-LPAHTPTLRKKGCPASTGFPPKRKTHQFFVKSFTAPTKCHQCTSLMVGLIRQGCSCEVCGFSCHITCV-NKAPTVCPVPPEQTKGPLGIDPQKGVGTAYEGHVRIPKPAGVKKGWQRALAVVCDFKLFLYDIAEGKASQPTSVIS----QVIDMRDEEFSVSSVLASDVIHASRKDIPCIFRVTASQLSAPSNKCSILMLADSENERSKWVGVLSELHKILKKNKFRDRSVYVPKEAYDSTLPLIKTTQ--AAAIIDHERIALGNEEGLFVVHVTKDEIVRVGDNKKIHQIELIPSD--QLVAVISGRNRHVRLFPMSALDG-RETDFYKLAETKGCQTIAAGK--VRHGA------------------------LSCLCVAMKRQVLCYELFQSKTRHRKFKEIQVPCNVQWMAI--FSEHLCVGFQSGFLRYPLNGEGGP----CNMLHSNDHTLSFISHQPMDALCAVEISNKEYLLCFNSIGIYTDCQGRRSRQQELMWPANPSSCCYNAPYLSVYSENA-VDIFDV--NSMEWIQTLPLKKVRPLNTEGSLNLLG---LETIRLIYFKNKMAEGDELVVPETSDNSRKQMVRNIN---NKRRYSFRV--------------PEEERMQQRREMLRD-PEMR-NKLISNPTNFNHIAHMGPGDGIQIL 1592          
BLAST of Serine/threonine kinase vs. Ensembl Mouse
Match: Cdc42bpb (CDC42 binding protein kinase beta [Source:MGI Symbol;Acc:MGI:2136459])

HSP 1 Score: 593.964 bits (1530), Expect = 0.000e+0
Identity = 452/1539 (29.37%), Postives = 770/1539 (50.03%), Query Frame = 2
Query:   32 MSIKLTLKQRHENLIKEFLLNYKSSVPDSVTLEFLIDSLFCTYYECRLPFHKDEKNVAQFIKSIKGTVDKIESLRIRRSDFDTIRVIGRGAFGKVSVVRFKEKGEIYAMKSLHKYDILKKIDAACFQEERDVLFQAMKIKSPWITRLHYAFQDEFYLYFVMDFYNGGDMLTLLSKFNDRLPEEITKFYIAEVVMSIDVVHKLGYLHRDIKPDNLLLDSLGHIVLADFGSCVKLRPNGTTITERAVGTPDYISPEILRSAE-GHGPYGVECDWWSLGIVIHEMLYGELPFYNEDFSETYWQIMNFETCFQIPTEYDDVSDEAEDLIKQLICKKECRLGNKGIDDFKNHPFFREIDWDNLRSYNAPFIPEVSSAEDTSNFEFDD---FNANHEGPPLSSNFKGCHLPCIGFTFTKDFIFNEMGSEESSVRLKSL---------MENI-----------------------------------GAPALLNGNHNESNSDALLEEVNQLK---ITCSQLEKQLNECRT------NSVQRIFS------------HPVYQQLVTDKEKLLTQCQNYDYSLREKEQKMDDLIETNRLLNKERDELTSDRLQILQKKQDIEEDLKVMTENFNQLKSTNKAINRXXXXXXXXXXXXXXXXXXXXXXXXH--------------LSIQKNQSQPDIQVEKQRFEEVMLQLRSENDQML-----EKMR------LKCSNLTNSLEQSDQTIFNIKEEIKSLKEIF--TNKEKNLKLSH-----DNEIEQLKISVAEEQSRILASNTQLKSQVKSLSEENVELRSSLQEISNKNMKF-HFRLKTILDKEIVKTSENSE-----LLTELDREVELLKTLCVDNDGDQKAQGERQDNNGNESWRLRKCVKADKIEISNLNLTLQSERRARADLEKKLTQQK---------------------SEICDISKQLE-KYKQDVNEK------------------DNLIANLKSAS--------QNLEPHV--------------PKEIPSNPVTLSEFNSI-LSGSLDKTVVNCNQHVFSHSTFNRPIKCDYCTSHMLGQYYQGVKCKECSFSCHHYCLSNVLNDKCYTRKSAGK---GANLKNGIGTMYENFIKVPKPGGIRRGWKRQFMALCDLKLFFFDVKEGSTGTQMPDISRNPCRVIDLKYTEFKVVKVSRDEVMHAPKKDVEFIIKIS---IENSSTMLPIYVLFESVDNKEDCIKVIEEARSYIKKDPHYRMI--FTEKSCLNNLDISMNYRQILSAAIIDQSTLLFGTEEGL--LKVTDSGYNKIGEKKPVYIIESLDQQELQLVAVIQSKQRVLKLLLSGILDGAHDWEPIIVENGKSCTTFVVGKSYVSPGNQFAPYADTMLANSTFHIKSPSNDRIWIMCAAFKNSVEVYHLNLKLTRHEKLRQILCNTSVTSLQIAGHGEQLLIGMHDSVAIYSLWETGSPXXXXXXXXXXXXXNFQYIFQTNFESMLIVEISFNEYLILFECAGIFINRNHRQTR-PDLQW 4105
            MS K+ LK+     +++ LL+       ++++E L+D L C Y EC     + +K VA+F++  K     ++ +++ R DF+ I+VIGRGAFG+V+VV+ K    IYAMK L+K+++LK+ + ACF+EERDVL         WIT LHYAFQDE YLY VMD+Y GGD+LTLLSKF D+LPE++ +FYI E+V++ID +H+L Y+HRDIKPDN+LLD  GHI LADFGSC+K+  +GT  +  AVGTPDYISPEIL++ E G G YG ECDWWSLG+ ++EMLYGE PFY E   ETY +IMN E  FQ P+   DVS+EA+DLI++LIC +E RLG  GI+DFK H FF  ++W+N+R+  AP+IP+VSS  DTSNF+ DD    N     P   + F G HLP IGFTFT +  F++ GS +S  +  +L         +EN                                    G+   L  ++ +     L EE+ ++K      ++LE+QL +  T      +S  R+                +++QLV   E+L +Q +    + +++++ + +  E    LN+   EL S + ++ ++ +D EE+++V  +  + ++   +   + +  LE  L+    +  KE++  +H              L +++    P    E Q   + + ++RSE ++ +     E +R      L+  N+   +  S+     +++E+  LK+    + +E++ ++        ++ E+ +  + +E  ++ A N +L S V  L+ +N +L   LQ++++K     H+  +     + V   +++      L +++  E+E L++  +         G R     +  W++R+  K D      L   L++E RA+  ++++L + K                      E+  + K++E K++ D   K                   +L     SAS         +L P V              P++ PS PV L    ++ ++G   K       H FS  +F  P +C +CTS M+G   QG  C+ C+FSCH  C  +     C       K   G +++ GIGT Y+ ++KVPKP G+++GW+R +  +CD KLF +D+ EG + TQ P +  +  +V+DL+  EF V  V   +V+HA ++D+  I +++   + + S    + +L E+ + K   + ++E  ++ + K+     +    +++  ++L +    + +L+AAI+D   +  G EEGL  +++T     +  + K VY IE            +  K+++  +LL G     H + P    +G   + F + K   + G Q       ++A  T    S +      +  A K  +  Y +      H K  +++    V  + +    ++L +G     ++ S+   G P       +   D +  ++ Q +F+++  VE+   EYL+ F   G++++   R++R  +L W
Sbjct:    1 MSAKVRLKK-----LEQLLLDGPWRNDSALSVETLLDVLVCLYTECSHSALRRDKYVAEFLEWAKPFTQLVKDMQLHREDFEIIKVIGRGAFGEVAVVKMKNTERIYAMKILNKWEMLKRAETACFREERDVLVNG---DCQWITALHYAFQDENYLYLVMDYYVGGDLLTLLSKFEDKLPEDMARFYIGEMVLAIDSIHQLHYVHRDIKPDNVLLDVNGHIRLADFGSCLKMNDDGTVQSSVAVGTPDYISPEILQAMEDGMGKYGPECDWWSLGVCMYEMLYGETPFYAESLVETYGKIMNHEERFQFPSHVTDVSEEAKDLIQRLICSRERRLGQNGIEDFKKHAFFEGLNWENIRNLEAPYIPDVSSPSDTSNFDVDDDMLRNIEILPPGSHTGFSGLHLPFIGFTFTTESCFSDRGSLKSMTQSNTLTKDEDVQRDLENSLQIEAYERRIRRLEQEKLELSRKLQESTQTVQSLHGSTRALGNSNRDKEIKRLNEELERMKSKMADSNRLERQLEDTVTLRQEHEDSTHRLKGLEKQYRLARQEKEELHKQLVEASERLKSQTKELKDAHQQRKRALQEFSE----LNERMSELRSLKQKVSRQLRDKEEEMEVAMQKIDSMRQDLRKSEKSRKELEARLEDAAAEASKERKLREHSESFCKQMERELEALKVKQGGRGPGAASEHQ---QEISKIRSELEKKVLFYEEELVRREASHVLEVKNVKKEVHDSESHQLALQKEVLMLKDKLEKSKRERHSEMEEAIGTVKDKYERERAMLFDENKKLTAENEKLCSFVDKLTAQNRQLEDELQDLASKKESVAHWEAQIAEIIQWVSDEKDARGYLQALASKMTEELETLRSSSL---------GSR---TLDPLWKVRRSQKLDMSARLELQSALEAEIRAKQLVQEELRKVKDSSLAFESKLKESEAKNRELLEEMQSLRKRMEEKFRADTGLKLPDFQDSIFEYFNTAPLAHDLTFRTSSASDQETQASKMDLSPSVSVATSTEQQEDMARPQQRPS-PVPLPSTQALAMAGPKPKA------HQFSIKSFPSPTQCSHCTSLMVGLIRQGYACEVCAFSCHVSC-KDSAPQVCPIPPEQSKRPLGVDVQRGIGTAYKGYVKVPKPTGVKKGWQRAYAVVCDCKLFLYDLPEGKS-TQ-PGVVAS--QVLDLRDEEFAVSSVLASDVIHATRRDIPCIFRVTASLLGSPSKTSSLLILTENENEKRKWVGILEGLQAILHKNRLKSQVVHVAQEAYDSSLPL---IKAVLAAAIVDGDRIAVGLEEGLYVIELTRDVIVRAADCKKVYQIE------------LAPKEKI-AILLCGRNHHVHLY-PWSSFDGAEASNFDI-KLPETKGCQ-------LIATGTLRKSSST-----CLFVAVKRLILCYEIQRTKPFHRKFSELVAPGHVQWMAV--FKDRLCVGYPSGFSLLSIQGDGPP----LDLVNPTDPSLAFLSQQSFDALCAVELKSEEYLLCFSHMGLYVDPQGRRSRMQELMW 1464          
BLAST of Serine/threonine kinase vs. UniProt/SwissProt
Match: sp|Q3UU96|MRCKA_MOUSE (Serine/threonine-protein kinase MRCK alpha OS=Mus musculus OX=10090 GN=Cdc42bpa PE=1 SV=2)

HSP 1 Score: 680.248 bits (1754), Expect = 0.000e+0
Identity = 516/1670 (30.90%), Postives = 811/1670 (48.56%), Query Frame = 2
Query:   32 MSIKLTLKQRHENLIKEFLLNYKSSV-PDSVTLEFLIDSLFCTYYECRLPFHKDEKNVAQFIKSIKGTVDKIESLRIRRSDFDTIRVIGRGAFGKVSVVRFKEKGEIYAMKSLHKYDILKKIDAACFQEERDVLFQAMKIKSPWITRLHYAFQDEFYLYFVMDFYNGGDMLTLLSKFNDRLPEEITKFYIAEVVMSIDVVHKLGYLHRDIKPDNLLLDSLGHIVLADFGSCVKLRPNGTTITERAVGTPDYISPEILRSAE-GHGPYGVECDWWSLGIVIHEMLYGELPFYNEDFSETYWQIMNFETCFQIPTEYDDVSDEAEDLIKQLICKKECRLGNKGIDDFKNHPFFREIDWDNLRSYNAPFIPEVSSAEDTSNFEFDD---FNANHEGPPLSSNFKGCHLPCIGFTFTKDFIFNEMGSEESSVRLKSLMENIGAPALLNGNHNESNSDALLEEVNQLKITCSQLEKQLNECRTNSVQRIFSHPVYQQLVTDKEKLLTQCQNYDYSLREK-------EQKMDDLIETNRLLNKERDELTSDRLQILQKKQDIEEDLKVMTENFNQLKSTNKAI-----NRXXXXXXXXXXXXXXXXXXXXXXXXHLSIQKNQSQPDIQVEK--------QRFE----------EVMLQLRSENDQMLEKMRLKCSNLTNSLE----------------QSDQTIFNIKEEIKSLKEIFTNKEKNLKLS-HDNEIEQLKISVAEEQSRILASNTQLKSQVKSLSEENVELRSSLQEISNKNMKFHFRLKTILDKEIVKTSENSELLTELDREVELLKTLCVDND---------GDQK---AQGERQ------------DNNG--------------------------NESWRLRKCVKADKIEISNLNLTLQSERRARADLEKKLTQQKSEICDISKQLEKYKQDVNEKDNL-----IANLKSASQNLEPHVPKEIPSNPVTLSEFNSILSGSLDK-TVVNC-------------------------NQHVFSHSTFNRPIKCDYCTSHMLGQYYQGVKCKECSFSCHHYCLSNVLNDKCYTRKSAGKGA---NLKNGIGTMYENFIKVPKPGGIRRGWKRQFMALCDLKLFFFDVKEGSTGTQMPDISRNPCRVIDLKYTEFKVVKVSRDEVMHAPKKDVEFIIKIS---IENSSTMLPIYVLFESVDNKEDCIKVIEEARSYIKKDPHY-RMIFTEKSCLNNLDISMNYRQILSAAIIDQSTLLFGTEEGL--LKVTDSGYNKIGEKKPVYIIESLDQQELQLVAVIQSKQRVLKLLLSGILDGAHDWEPIIVENGKSCTTFVVGKSYVSPGNQFAPYADTMLANSTFHIKSPSNDRIWIMCAAFKNSVEVYHLNLKLTRHEKLRQILCNTSVTSLQIAGHGEQLLIGMHDSVAIYSLWETGSPXXXXXXXXXXXXXNFQYIFQTNFESMLIVEISFNEYLILFECAGIFINRNHRQTR-PDLQWPDKPTRFTYRAPYLLCFTEMAGLFAYEITEHSCNLVQALPLRSSKPLDRSGHILTTANEFIQAIDLIYVHLVSANEEKISIGKTIDKTSSSNTLSIFKFLNKRKPSYNKQEDSFDTNDAISPNPAGNSTKSTGLKYRDKPTLKSNRQISVPQNFRHLSHMGPDVPCQLI 4612
            MS ++ L+Q     +++F+L+  +       ++E L+D L C Y EC     + EKN+ ++++  K    K++ +R+ R DF+ ++VIGRGAFG+V+VV+ K   +++AMK L+K+++LK+ + ACF+EERDVL       S WIT LHYAFQD+  LY VMD+Y GGD+LTLLSKF DRLPEE+ +FY+AE+V++ID VH+L Y+HRDIKPDN+L+D  GHI LADFGSC+KL  +GT  +  AVGTPDYISPEIL++ E G G YG ECDWWSLG+ ++EMLYGE PFY E   ETY +IMN +  FQ P +  DVS+ A+DLI++LIC +E RLG  GI+DFK HPFF  IDWDN+R+  AP+IPEVSS  DTSNF+ DD    N+    PP  + F G HLP +GFT+T   + ++      +    SL  ++     L+ N      +  ++ + Q K+   +L ++L E  T +VQ +    V   L   K+  +   +     LR++       EQ++++     R L+    ++ +   QI   +Q+ EE  K + +   +LK+ +K +      R+  + EF     +   +  +++     ++  + + D+ ++K        +R E          E ++   S++ ++ E+       L N LE                +  Q I  +K +++  K IF  +E + +   H +EI+ LK  + + + + LA N ++      L +   E +S  +E  N+  + + R K +L      T EN +L +ELD+   L ++L + N           D+K   A  E Q            D  G                          +  W++R+  K D      L   L +E RA+  ++++L + K+     S  L + K   +EK NL     I  L   ++ L      E   +  +   F +  + +LD+  + +C                           H F   +F  P KC  CTS M+G   QG  C+ C FSCH  C+ N     C       KG    + + G+GT YE  +++PKP G+++GW+R    +CD KLF +D+ EG        IS    +VID++  EF V  V   +V+HA +KD+  I +++   +   S    I +L +S + +   + V+ E    +KK+    R ++  K   ++    +   Q  +AAIID   +  G EEGL  + VT     ++G+ K ++ IE +     QLVAVI  + R ++L     LDG  + +   +   K C T   GK  V  G                         +  +C A K  V  Y L    TRH K ++I    +V  + I    E L +G       Y L   G P       L   D    +I     +++  VEIS  EYL+ F   GI+ +   R++R  +L WP  P+   Y APYL  ++E A +  +++  +S   +Q LPL+  +PL+  G +       ++ I LIY     A  +++ + +T D +      +I    NKR+ S+                P     +      RD P ++ N+ IS P NF H++HMGP    Q++
Sbjct:    1 MSGEVRLRQ-----LEQFILDGPAQTNGQCFSVETLLDILICLYDECNNSPLRREKNILEYLEWAKPFTSKVKQMRLHREDFEILKVIGRGAFGEVAVVKLKNADKVFAMKILNKWEMLKRAETACFREERDVLVNG---DSKWITTLHYAFQDDNNLYLVMDYYVGGDLLTLLSKFEDRLPEEMARFYLAEMVIAIDSVHQLHYVHRDIKPDNILMDMNGHIRLADFGSCLKLMEDGTVQSSVAVGTPDYISPEILQAMEDGKGRYGPECDWWSLGVCMYEMLYGETPFYAESLVETYGKIMNHKERFQFPAQVTDVSENAKDLIRRLICSREHRLGQNGIEDFKKHPFFSGIDWDNIRNCEAPYIPEVSSPTDTSNFDVDDDCLKNSETMPPPTHTAFSGHHLPFVGFTYTSSCVLSDRSCLRVTAGPTSLDLDVSVQRTLDNNLATEAYERRIKRLEQEKL---ELTRKLQES-TQTVQALQYSTVDGPLTASKDLEIKSLKEEIEKLRKQVAEVNHLEQQLEEANSVRRELDDAFRQIKASEKQIKTLQQEREELNKELVQASERLKNQSKELKDAHCQRKLAMQEFMEINERLTELHTQKQKLARHVRDKEEEVDLVMQKAESLRQELRRAERAKKELEVHTEALIAEASKDKKLREQSEHYSKQLENELEGLKQKQISYSPGICSIEHQQEITKLKTDLEK-KSIFYEEEISKREGIHASEIKNLKKELHDSEGQQLALNKEILVLKDKLEKTRRESQSEREEFENEFKQQYEREKVLL------TEENKKLTSELDKLTSLYESLSLRNQHLEEEVKDLADKKESVAHWEAQITEIIQWVSDEKDARGYLQALASKMTEELEALRNSSLGTRATDMPWKMRRFAKLDMSARLELQSALDAEIRAKQAIQEELNKVKA-----SNILTECKLKDSEKKNLELLSEIEQLIKDTEELRSEKGIEHQDSQHSFLAFLNTPTDALDQFEIADCAPLPAHTPTLRKKGCPASTGFPPKRKTHQFFVKSFTAPTKCHQCTSLMVGLIRQGCSCEVCGFSCHITCV-NKAPTVCPVPPEQTKGPLGIDPQKGVGTAYEGHVRIPKPAGVKKGWQRALAVVCDFKLFLYDIAEGKASQPTSVIS----QVIDMRDEEFSVSSVLASDVIHASRKDIPCIFRVTASQLSAPSNKCSILMLADSENERSKWVGVLSELHKILKKNKFRDRSVYVPKEAYDSTLPLIKTTQ--AAAIIDHERIALGNEEGLFVVHVTKDEIVRVGDNKKIHQIELIPSD--QLVAVISGRNRHVRLFPMSALDG-RETDFYKLAETKGCQTIAAGK--VRHGA------------------------LSCLCVAMKRQVLCYELFQSKTRHRKFKEIQVPCNVQWMAI--FSEHLCVGFQSGFLRYPLNGEGGP----CNMLHSNDHTLSFISHQPMDALCAVEISNKEYLLCFNSIGIYTDCQGRRSRQQELMWPANPSSCCYNAPYLSVYSENA-VDIFDV--NSMEWIQTLPLKKVRPLNTEGSLNLLG---LETIRLIYFKNKMAEGDELVVPETSDNSRKQMVRNIN---NKRRYSFRV--------------PEEERMQQRREMLRD-PEMR-NKLISNPTNFNHIAHMGPGDGIQIL 1579          
BLAST of Serine/threonine kinase vs. UniProt/SwissProt
Match: sp|Q9Y5S2|MRCKB_HUMAN (Serine/threonine-protein kinase MRCK beta OS=Homo sapiens OX=9606 GN=CDC42BPB PE=1 SV=2)

HSP 1 Score: 629.017 bits (1621), Expect = 0.000e+0
Identity = 502/1703 (29.48%), Postives = 823/1703 (48.33%), Query Frame = 2
Query:   32 MSIKLTLKQRHENLIKEFLLNYKSSVPDSVTLEFLIDSLFCTYYECRLPFHKDEKNVAQFIKSIKGTVDKIESLRIRRSDFDTIRVIGRGAFGKVSVVRFKEKGEIYAMKSLHKYDILKKIDAACFQEERDVLFQAMKIKSPWITRLHYAFQDEFYLYFVMDFYNGGDMLTLLSKFNDRLPEEITKFYIAEVVMSIDVVHKLGYLHRDIKPDNLLLDSLGHIVLADFGSCVKLRPNGTTITERAVGTPDYISPEILRSAE-GHGPYGVECDWWSLGIVIHEMLYGELPFYNEDFSETYWQIMNFETCFQIPTEYDDVSDEAEDLIKQLICKKECRLGNKGIDDFKNHPFFREIDWDNLRSYNAPFIPEVSSAEDTSNFEFDD--FNANHEGPPLS-SNFKGCHLPCIGFTFTKDFIFNEMGSEES-------------------SVRLKSLMENI-------------------------GAPALLNGNHNESNSDALLEEVNQLK---ITCSQLEKQLNEC------RTNSVQRIFS----HPVYQQLVTDKEKLLTQCQNYDYSLREKEQKMDDLIETNRL-------LNKERDELTSDRLQILQKKQDIEEDLKVMTENFNQLKSTNKAINRXXXXXXXXXXXXXXXXXXXXXXXXH--------------LSIQKN--------QSQPDIQVEKQRFEEVMLQLRSENDQMLEKMRLKCSNLTNSLEQSDQTIFNIKEEIKSLKEIFTNKEKNLKLSHDNEIEQL-----------KISVAEEQSRILASNTQLKSQVKSLSEENVELRSSLQEISNKNMKF-HFRLKTILDKEIVKTSENSE-----LLTELDREVELLKTLCVDNDGDQKAQGERQDNNGNESWRLRKCVKADKIEISNLNLTLQSERRARA--------------DLEKKLTQQKSEICDISKQLEKYKQDVNEKDNLIANLK---------------------------SASQNLEPHVPKEIPSNPVTLSEFNSILS--------------GSLDKTVVNCNQHVFSHSTFNRPIKCDYCTSHMLGQYYQGVKCKECSFSCHHYCLSNVLNDKCYTRKSAGK---GANLKNGIGTMYENFIKVPKPGGIRRGWKRQFMALCDLKLFFFDVKEGSTGTQMPDISRNPCRVIDLKYTEFKVVKVSRDEVMHAPKKDVEFIIKIS---IENSSTMLPIYVLFESVDNKEDCIKVIEEARSYIKKDPHYRMIFTEKSCLNNLDISMNY-RQILSAAIIDQSTLLFGTEEGL--LKVTDSGYNKIGEKKPVYIIESLDQQELQLVAVIQSKQRVLKLLLSGILDGAHDWEPIIVENGKSCTTFVVGKSYVSPGNQFAPYADTMLANSTFHIKSPSNDRIWIMCAAFKNSVEVYHLNLKLTRHEKLRQILCNTSVTSLQIAGHGEQLLIGMHDSVAIYSLWETGSPXXXXXXXXXXXXXNFQYIFQTNFESMLIVEISFNEYLILFECAGIFINRNHRQTRP-DLQWPDKPTRFTYRAPYLLCFTEMAGLFAYEITEHSCNLVQALPLRSSKPLDRSGHILTTANEFIQAIDLIYVHLVSANEEKISIGK-TIDKTSSSNTLSIFKFLNKRKPSYNKQEDSFDTNDAISPNPAGNSTKSTGLKYRDKPTLKSNRQISVPQNFRHLSHMGPDVPCQ-LIDL 4618
            MS K+ LK+     +++ LL+       ++++E L+D L C Y EC     + +K VA+F++  K     ++ +++ R DF+ I+VIGRGAFG+V+VV+ K    IYAMK L+K+++LK+ + ACF+EERDVL         WIT LHYAFQDE +LY VMD+Y GGD+LTLLSKF D+LPE++ +FYI E+V++ID +H+L Y+HRDIKPDN+LLD  GHI LADFGSC+K+  +GT  +  AVGTPDYISPEIL++ E G G YG ECDWWSLG+ ++EMLYGE PFY E   ETY +IMN E  FQ P+   DVS+EA+DLI++LIC +E RLG  GI+DFK H FF  ++W+N+R+  AP+IP+VSS  DTSNF+ DD         PP S + F G HLP IGFTFT +  F++ GS +S                   S+++++    I                         G+   L+ ++ +     L EE+ +LK      ++LE+QL +       R +S QR+      H V +Q   +KE+L  Q       L+ + +++ D  +  +L       LN+   EL + + ++ ++ +D EE+++V T+  + ++   +   + +  LE +LD    +  KE++  +H              L +++         + Q +I   K   E+ +L    E  +      L+  N+   +  S+     +++EI  LK+     EK+ +  H NE+E+            +  + +E  ++ A N +L S V  L+ +N +L   LQ+++ K     H+  +     + V   +++      L +++  E+E L++  +         G R     +  W++R+  K D      L   L++E RA+                LE KL   +++  ++ +++E  K+ + EK      LK                           ++ Q  +   P+  PS  V  SE    ++               +L         H FS  +F+ P +C +CTS M+G   QG  C+ CSF+CH  C        C       K   G +++ GIGT Y+  +KVPKP G+++GW+R +  +CD KLF +D+ EG + TQ   I+    +V+DL+  EF V  V   +V+HA ++D+  I +++   +   S    + +L E+ + K   + ++E  +S + K+     +      L   D S+   + IL+AAI+D   +  G EEGL  ++VT     +  + K V+ IE   ++  ++V ++  +   + L     LDGA     I +   K C                      ++A +T    S +      +  A K  +  Y +      H K  +I+   SV  L +    ++L +G      + S+   G P       +   D +  ++ Q +F+++  VE+   EYL+ F   G++++   R+ R  +L WP  P   +    ++  ++E  G+  +++   +   VQ + LR  +PL+  G  L   N   +   LIY       + K S     +  TS ++   + +  +KR+  +                P     +      RD P L+S + IS P NF H++HMGP    Q L+DL
Sbjct:    1 MSAKVRLKK-----LEQLLLDGPWRNESALSVETLLDVLVCLYTECSHSALRRDKYVAEFLEWAKPFTQLVKEMQLHREDFEIIKVIGRGAFGEVAVVKMKNTERIYAMKILNKWEMLKRAETACFREERDVLVNG---DCQWITALHYAFQDENHLYLVMDYYVGGDLLTLLSKFEDKLPEDMARFYIGEMVLAIDSIHQLHYVHRDIKPDNVLLDVNGHIRLADFGSCLKMNDDGTVQSSVAVGTPDYISPEILQAMEDGMGKYGPECDWWSLGVCMYEMLYGETPFYAESLVETYGKIMNHEERFQFPSHVTDVSEEAKDLIQRLICSRERRLGQNGIEDFKKHAFFEGLNWENIRNLEAPYIPDVSSPSDTSNFDVDDDVLRNTEILPPGSHTGFSGLHLPFIGFTFTTESCFSDRGSLKSIMQSNTLTKDEDVQRDLEHSLQMEAYERRIRRLEQEKLELSRKLQESTQTVQSLHGSSRALSNSNRDKEIKKLNEEIERLKNKIADSNRLERQLEDTVALRQEREDSTQRLRGLEKQHRVVRQ---EKEELHKQLVEASERLKSQAKELKDAHQQRKLALQEFSELNERMAELRAQKQKVSRQLRDKEEEMEVATQKVDAMRQEMRRAEKLRKELEAQLDDAVAEASKERKLREHSENFCKQMESELEALKVKQGGRGAGATLEHQQEISKIKSELEKKVLFYEEELVRREASHVLEVKNVKKEVHDSESHQLALQKEILMLKDKL---EKSKRERH-NEMEEAVGTIKDKYERERAMLFDENKKLTAENEKLCSFVDKLTAQNRQLEDELQDLAAKKESVAHWEAQIAEIIQWVSDEKDARGYLQALASKMTEELEALRSSSL---------GSR---TLDPLWKVRRSQKLDMSARLELQSALEAEIRAKQLVQEELRKVKDANLTLESKLKDSEAKNRELLEEMEILKKKMEEKFRADTGLKLPDFQDSIFEYFNTAPLAHDLTFRTSSASEQETQAPKPEASPSMSVAASEQQEDMARPPQRPSAVPLPTTQALALAGPKPKAHQFSIKSFSSPTQCSHCTSLMVGLIRQGYACEVCSFACHVSCKDGA-PQVCPIPPEQSKRPLGVDVQRGIGTAYKGHVKVPKPTGVKKGWQRAYAVVCDCKLFLYDLPEGKS-TQPGVIA---SQVLDLRDDEFSVSSVLASDVIHATRRDIPCIFRVTASLLGAPSKTSSLLILTENENEKRKWVGILEGLQSILHKNRLRNQVV--HVPLEAYDSSLPLIKAILTAAIVDADRIAVGLEEGLYVIEVTRDVIVRAADCKKVHQIELAPRE--KIVILLCGRNHHVHLYPWSSLDGAEGSFDIKLPETKGC---------------------QLMATATLKRNSGT-----CLFVAVKRLILCYEIQRTKPFHRKFNEIVAPGSVQCLAVL--RDRLCVGYPSGFCLLSIQGDGQP----LNLVNPNDPSLAFLSQQSFDALCAVELESEEYLLCFSHMGLYVDPQGRRARAQELMWPAAPVACSCSPTHVTVYSEY-GVDVFDV--RTMEWVQTIGLRRIRPLNSEG-TLNLLN--CEPPRLIYF------KSKFSGAVLNVPDTSDNSKKQMLRTRSKRRFVFKV--------------PEEERLQQRREMLRD-PELRS-KMISNPTNFNHVAHMGPGDGMQVLMDL 1607          
BLAST of Serine/threonine kinase vs. UniProt/SwissProt
Match: sp|O01583|MRCK_CAEEL (Serine/threonine-protein kinase mrck-1 OS=Caenorhabditis elegans OX=6239 GN=mrck-1 PE=2 SV=3)

HSP 1 Score: 623.239 bits (1606), Expect = 0.000e+0
Identity = 487/1631 (29.86%), Postives = 806/1631 (49.42%), Query Frame = 2
Query:   74 IKEFLLNYKSSVPDSVTLEFLIDSLFCTYYECRLPFHKDEKNVAQFIKSIKGTVDKIESLRIRRSDFDTIRVIGRGAFGKVSVVRFKEKGEIYAMKSLHKYDILKKIDAACFQEERDVLFQAMKIKSPWITRLHYAFQDEFYLYFVMDFYNGGDMLTLLSKFNDRLPEEITKFYIAEVVMSIDVVHKLGYLHRDIKPDNLLLDSLGHIVLADFGSCVKLRPNGTTITERAVGTPDYISPEILRSAE-GHGPYGVECDWWSLGIVIHEMLYGELPFYNEDFSETYWQIMNFETCFQIPTEYDD--VSDEAEDLIKQLICKKECRLGNKGIDDFKNHPFFREIDWDNLRSYNAPFIPEVSSAEDTSNFEFD----DFNA---NHEGPPLSSNFKGCHLPCIGFTFTKDFIFNEMGSEESSVRLKSLMENIGAPALLNGNHNESNSDALLEEVNQLKITCSQLEKQLNECRTNSVQRIFSHPVYQQLVTDKEKLLTQCQNY---------DYSLREKEQKMDDLIETNRLLNKERDELTSDRLQILQKKQDIEEDLKVMTENFNQLKSTNKAINRXXXXXXXXXXXXXXXXXXXXXXXXHLSIQKNQSQP----------DIQVEK----QRFEEVMLQLRS--ENDQMLEKMRLKCSNLTNSLEQSDQTIFNIKEEIKSLKEIFTNKEKNLKLSHDNEIEQLKISVAEEQSRILASNTQ--------LKSQVKSLSEENVEL-RSSLQEISNKNMKFHFRLKTILDKEIVKTSENSELLTELDREVELLKT---LCVDN--DGDQKAQGERQDNN--GNESWRLRKCVKAD-------KIEISNLNLTLQSERRARADLEKKLTQQKSEICDISKQL-------EKYKQDVNEKDNLIANLKSASQNLEPHVPKEIPSNPVTLSEFNSIL-----------------------SGSLDKTVVNCNQ--HVFSHSTFNRPIKCDYCTSHMLGQYYQGVKCKECSFSCHHYCLSNVLNDKCYTRKSAGK--GANLKNGIGTMYENFIKVPKPGGIRRGWKRQFMALCDLKLFFFDVKEGSTGTQMPDISRNPCRVIDLKYTEFKVVKVSRDEVMHAPKKDVEFIIKISIEN-------SSTMLPIYVLF--ESVDNKEDCIKVIEEARSYIKKDPHY-RMIFTEKSCLNNLDISMNYRQILSAAIIDQSTLLFG-TEEGLLKVTDS-------GYNKIGEKKPVYIIESLDQQELQLVAVIQSKQRVLKLLLSGILDGAHDWEPIIVENGKSCTTFVVGKSYVSPGNQFAPYADTMLANSTFHIKSPSNDRIWIMCAAFKNSVEVYHLNLKLTRHEKLRQILCNTSVTSLQIAGHGEQLLIGMHDSVAIYSLW-----ETGSPXXXXXXXXXXXXXN-----FQYI-FQTNFESMLIVEI--SFNEYLILFECAGIFINRNHRQTR-PDLQWPDKPTRFTYRAPYLLCFTE-MAGLFAYEITEHSCNLVQALPLRSSKPLDRSGHILTTANEFIQAIDLIYVHLVSANEEKISIGKTIDKTSSSNTLSIFKFLNKRKPSYNKQEDSFDTNDAISPNPAGNSTKSTGLKYRDKPTLKSNRQISVPQNFRHLSHMGP 4591
            ++   ++  S  P++++ E LIDSL C Y EC     + EK +A+F++S+K  + K + LR+ R DF+ ++VIG+GAFG+V+VVR +  GEIYAMK L+K++++K+ + ACF+EERDVL    +    WIT LHYAFQDE  LYFVMD+Y GGDMLTLLSKF D +PE + KFYIAE+V++ID +H+LGY+HRD+KPDN+LLD  GHI LADFGSC+++  +G+  +  AVGTPDYISPEILR+ E G G YG ECDWWSLGI ++EMLYG  PFY+E   +TY +IM+ +     P +  D  VS+EA+DLI+QLIC  + R G  G+ DF+ HPFF  IDW+ +R  N P++PEVSS EDTSNF+ D    DF       + P + + F G HLP +GF++T   + ++  S    +R  ++ +     A L     E + D  + E+   K   ++L ++L E +T   Q +  +P  ++   + E  + Q ++          D +L +++QK  D I       K+  EL     Q++ +K +I+ +L  + ++ +Q+      + +++D ++ EL  +    + EK+ +K L  +  +++           +I+ EK    ++ EEV ++ R   E D  L +  +   N   SL+ +++     + EIK LK+    +  +     + E++QL+    E   ++L  N +        L+ +++ LS++   L R  L E      + H  +   + +E     E   L  ++  EVE LK    L   N         G R+ NN    +   L++ ++A+       K E+ N      +      D EK++     E+  + +Q          +   +   D +I+       +    + +E+ S   T S  N+IL                       SG      ++  +  H F       P KC +CTS ++G   QG+ C+ C ++CH  C   V +  C   +   +  G +   G+GT YE  +K P+ GG+R+GW+  ++ +CD KL+ +D        +M D+      V+D++  +F V  VS  +V+HA K D+  I +++           S+    Y LF  E+ + K   +  + E ++ +++     R  F  K   +   +  + R     AIID+S ++ G ++ GL  +  S       G  K  +++ V  +E  + ++L ++ V  +K R ++++ S  LDG  D + I V + K C    VG +  +PG +   +A                        AFK SV ++ ++    RH+K + +    +  S+ I     +L +G   S   +SL        GS             +N      Q++  QT++E+ LIV +  S +EYL++F   G+++N   R++R P++ +P +   F Y  PYL  F+E    +F   + E     VQ + LRS+KPL   G IL+T    +     I+V L +  +++ SI   ++  S S      + + +RK ++                      ++ G   R     +S+ QIS P +F H+ HMGP
Sbjct:   17 LENIYMDGPSKKPEALSFETLIDSLICLYDECCNSTLRKEKCIAEFVESVKTVISKAKKLRLSRDDFEVLKVIGKGAFGEVAVVRMRGVGEIYAMKILNKWEMVKRAETACFREERDVLVYGDR---RWITNLHYAFQDEKNLYFVMDYYIGGDMLTLLSKFVDHIPESMAKFYIAEMVLAIDSLHRLGYVHRDVKPDNVLLDMQGHIRLADFGSCLRILADGSVASNVAVGTPDYISPEILRAMEDGRGRYGKECDWWSLGICMYEMLYGTTPFYSERLVDTYGKIMSHQDMLDFPDDEIDWVVSEEAKDLIRQLICSSDVRFGRNGLSDFQLHPFFEGIDWNTIRDSNPPYVPEVSSPEDTSNFDVDVCEDDFTPCLQETQPPRVLAAFTGNHLPFVGFSYTHGSLLSDARSLTDEIR--AIAQRCQGDAELM----EKSVDGFMVELENEK---AELVQKLKEAQTIIAQHVAENPRSEE-DRNYESTIAQLKDEIQILNKRLEDEALAQQQQKPKDEIVAES--EKKLKELKERNKQLVMEKSEIQRELDNINDHLDQVLVEKATVVQQRDDMQAELADVGDSLLTEKDSVKRLQDEAEKAKKQVADFEEKLKEIETEKIALIKKQEEVTIEARKSVETDDHLSEEVVAAKNTIASLQATNE---ERETEIKKLKQRMDEERASHTAQSEQEMKQLEAHY-ERAQKMLQDNVEQMNVENRGLRDEIEKLSQQMAALPRGGLNE-----QQLH-EIFNWVSEEKATREEMENLTRKITGEVESLKNNSPLTTSNYIQNTPSGWGSRRMNNVARKDGLDLQRQLQAEIDAKLKLKAELKNSQEQYLTSAARLDDTEKRMASLMREVAMLKQQKNIENSSDSAFSSTMGRGDLMISMNNDYEMSNSSLMRQEMISRQSTPSYENAILLHDHQVPKRVDDLRYKQKPMKTASGIFSPVSISAMERGHNFERMKIKTPTKCGHCTSILIGLDRQGLFCQSCQYACHVSCAERV-SQSCPVPEEERRPLGIDPTRGVGTAYEGLVKTPRAGGVRKGWQTAYVVVCDFKLYLYDCTVDRQ-NKMQDVKNEIRLVLDMRDPDFTVCGVSEADVIHAQKGDIPKIFRVTTTQILNSSSEYSSSSKFYTLFMAETEEEKRKWVVALSELKTLLRRSKLADRKAFLVKEVFDVTTLP-SIRVAQCCAIIDRSKIVIGFSDHGLYCIEISRQLLIPVGGEKENKQRCVETVEYDEAEQLLMMIVGPAKDRHVRIVPSAALDG-RDLKWIKVNDTKGCHLLAVGTN--NPGGRAGFFA-----------------------VAFKKSVTIFQIDRSEKRHKKWKDLAMPGTPQSIAI--FNGRLYVGFSHSFRSWSLVGVDSSPVGSGDASGAVLQHISLVNMEDTSLQFLNQQTSYEAKLIVNVPGSPDEYLLVFNMIGLYVNEMGRRSRLPEVMFPTQAKYFAYHEPYLCVFSENEVDIFNVTLAE----WVQTINLRSAKPLSGDG-ILSTC---LCNDSPIFVLLQNVLQDQDSIEVPVNLASGSTD---GRKVTRRKFTF----------------------RTIGKDDRSASERRSHIQISTPSDFMHIVHMGP 1558          
BLAST of Serine/threonine kinase vs. UniProt/SwissProt
Match: sp|Q9W1B0|GEK_DROME (Serine/threonine-protein kinase Genghis Khan OS=Drosophila melanogaster OX=7227 GN=gek PE=1 SV=1)

HSP 1 Score: 616.305 bits (1588), Expect = 0.000e+0
Identity = 495/1619 (30.57%), Postives = 799/1619 (49.35%), Query Frame = 2
Query:  122 TLEFLIDSLFCTYYECRLPFHKDEKNVAQFIKSIKGTVDKIESLRIRRSDFDTIRVIGRGAFGKVSVVRFKEKGEIYAMKSLHKYDILKKIDAACFQEERDVLFQAMKIKSPWITRLHYAFQDEFYLYFVMDFYNGGDMLTLLSKFNDRLPEEITKFYIAEVVMSIDVVHKLGYLHRDIKPDNLLLDSLGHIVLADFGSCVKLRPNGTTITERAVGTPDYISPEILRSAE-GHGPYGVECDWWSLGIVIHEMLYGELPFYNEDFSETYWQIMNFETCFQIPTEYD---DVSDEAEDLIKQLICKKECRLGNKGIDDFKNHPFFREIDWDNLRSYNAPFIPEVSSAEDTSNFEFDDFNAN-HEGPPLSSN--FKGCHLPCIGFTFTKDFIFNEMGSE-ESSVRLKSLMENIGAP--ALLNGNHNESNSD-----ALLEEVNQLKITCSQLEKQLNEC-----------RTNSVQRIFSHPVYQQLVTDKEKLLTQCQNYDYSLREKEQKMDDLIETNRLLNKERDELTSDRLQILQKKQDIEEDLKVMTENFNQLKSTNKAINRXXXXXXXXXXXXXXXXXXXXXXXXHLSIQKNQSQPDIQVEKQRFEEVMLQLRSENDQMLEKMRLKCSNLTNSLEQSDQTIFNIKEEIK--SLKEIFTNKEKNLKLSHDNEIEQLKISVAEEQSRILASNTQLKSQ-VKSLSEEN----VELRSSLQEISNKNMKFHFRLKTILDKEIVKTSENSELLTELDREVELLKTLC------VDNDGDQKAQGERQDNNG--NESWRLRKCVKADKI---EISNLNLTLQSERRARADLEKK-------LTQQKSEICDISKQLEKYKQDVNEK--------------------------------DNLIANL--------------KSASQNLEPHVP-KEIPSNPVTLSEFNSILSGSLDKTVVNCNQHVFSHSTFNRPIKCDYCTSHMLGQYYQGVKCKECSFSCHHYCLSNVLNDKCYTRKSAGK---GANLKNGIGTMYENFIKVPKPGGIRRGWKRQFMALCDLKLFFFDVKEGSTGTQMPDISRNPCRVIDLKYTEFKVVKVSRDEVMHAPKKDVE--FIIKISIENSSTMLPIYVLFESVDNKEDCIKVIEEARSYIKKD--PHYRMIFTEKSCLNNLDISMNYRQILSAAIIDQSTLLFGTEEGLLKVTDSGYN--KIGEKKPVYIIESLDQQELQLVAVIQSKQRVLKLLLSGILDGAHDWEPIIVENGKSCTTFVVGKSYVSPGNQFAPYADTMLANSTFHIKSPSNDRIWIMCAAFKNSVEVYHLNLKLTRHEKLRQILCNTSVTSLQIAGHGEQLLIGMHDSVAIYSLWETGSPXXXXXXXXXXXXXNFQYIFQTNFESMLIVEI------SFNEYLILFECAGIFINRNHRQTRP-DLQWPDKPTRFTYRAPYLLCFTEM-AGLFAYEITEHSCNLVQALPLRSSKPLDRSGH-ILTTANEFIQAIDLIYVHLVSANEEKISIGKTIDKTSSSNTLSIFKFLNKRK-PSYNKQEDSFDTNDAISPNPAGNSTKSTGLKYRDKPTLKSNRQISVPQNFRHLSHMGPDVPCQ---LIDL 4618
            +L++L+D+    Y EC     + EK V+ F+K  K  V  +  LR+ R DFD +++IGRGAFG+V VV+     ++YAMK L+K+++LK+ + ACF+EERDVL    +    WIT LHYAFQD   LY VMD+Y GGD+LTLLSKF D+LPE++ KFYI E++++I+ +H++ Y+HRDIKPDN+LLD  GH+ LADFGSC++L  +GT  +  AVGTPDYISPEILR+ E G G YG ECDWWSLG+ ++EMLYGE PFY E   ETY +IMN + CF +P++      VS+ ++DL+ +LIC  E RLG  GI DF +HP+F  IDW N+R   AP++PEVSS  DTSNF+ DD +    +  P S+N  F G HLP IGFTF+          + +SS      ++ I +P  A+L  N++E+  D     AL +++  LK   ++L KQ NE            +    QR  +   Y ++     +L  Q Q     +R+KE+++D  ++ N  L  E           L+K      +L++  E+     +  K +    +    +L    ++     E    LSI    S  +I+  + +F E +   ++ ++  LE +R + S L N+     + +   +E +K   ++ I  + E  L+L   +++E  K S  EE+ R L+S   LKS+ +K L  E+     ELR   + I+    +    ++ + D++  +    + L T++  E+E LK +       VDN   +  + ++ D     N    L++ ++A  +   E+S     L S ++   D +K+         ++++E+ D+ K   +Y +    K                                DN   N               K A +N + H   KE   + ++  E + ++  S  K   N   H F   TF+ P KC++CTS M+G   QGV C+ C F+CH  C   V    C       K   G +   GIGT YE ++KVPK G I+RGW RQF+ +CD KLF +D+        +P +S +  +V+D++  EF V  V   +V+HA KKDV   F IK ++ +    L   +L ++   K   +  + E    +K++  P+   IF     L+N  +S+  R  L + II  + +L GTE+GL  +    Y   +IGE K +  +  ++++  Q++ ++  KQR L+LL    L+ A D E I V   K+C +   G     P          ++ +    +K P+N             + VY +N   TRH+K  +         LQI     +L++        Y L    + + L+H + +       ++  +  +++ ++EI      +F EYL++F+   I+++   R++R  ++ +P  PT  T+   +LL F++    +F  +  E     VQ++ L+ S PL+  G+ +L++ N+    + L  +H                    +  L  ++  N++  PS  ++    + N  I  +                   + ++ IS P NF H+SHMGP    Q   L+DL
Sbjct:   50 SLDYLLDTFIVLYDECSNSSLRREKGVSDFLKLSKPFVHIVRKLRLSRDDFDILKIIGRGAFGEVCVVQMISTEKVYAMKILNKWEMLKRAETACFREERDVLVFGDR---QWITNLHYAFQDNINLYLVMDYYCGGDLLTLLSKFEDKLPEDMAKFYITEMILAINSIHQIRYVHRDIKPDNVLLDKRGHVRLADFGSCLRLDKDGTVQSNVAVGTPDYISPEILRAMEDGKGRYGTECDWWSLGVCMYEMLYGETPFYAESLVETYGKIMNHQNCFNLPSQETLNYKVSETSQDLLCKLICIPENRLGQNGIQDFMDHPWFVGIDWKNIRQGPAPYVPEVSSPTDTSNFDVDDNDVRLTDSIPPSANPAFSGFHLPFIGFTFSLTSSSTLDSKKNQSSGFGDDTLDTISSPQLAILPSNNSETPVDSVQLKALNDQLAALKQEKAELSKQHNEVFERLKTQDSELQDAISQRNIAMMEYSEVTEKLSELRNQKQKLSRQVRDKEEELDGAMQKNDSLRNE-----------LRKSDKTRRELELHIEDAVIEAAKEKKLREHAEDCCRQLQMELRKGSSSVETTMPLSISSEMSSYEIERLELQFSEKLSHQQTRHNMELEALREQFSELENANLALTKELQQTQERLKYTQMESITDSAETLLELKKQHDLE--KSSWFEEKQR-LSSEVNLKSKSLKELQAEDDEIFKELRMKREAITLWERQMAEIIQWVSDEKDARGYLQA-LATKMTEELEYLKHVGTFNNNGVDNKNWRNRRSQKLDKMELLNLQSALQREIQAKNMISDELSQTRSDLISTQKEVRDYKKRYDSILHDFQKKETELRDLQKGGLEYSESFLNKSTHHGLSSAFFRDMSKNSEIIDSAESFGNESGDNFTPNFFQSGNSGMLFNYEPKYAGKNNKDHSSMKEASVSDLSREESDQLVKESQKKVPGNTAIHQFLVRTFSSPTKCNHCTSLMVGLTRQGVVCEICGFACHTICCQKVPT-TCPVPMDQTKRPLGIDPTRGIGTAYEGYVKVPKSGVIKRGWIRQFVVVCDFKLFLYDISPDRCA--LPSVSVS--QVLDMRDPEFSVGSVRESDVIHAAKKDVPCIFKIKTALIDGGLSLNTLMLADNESEKSKWVIALGELHRILKRNSLPN-TAIFKVNEILDNT-LSL-IRNALCSVIIYPNQILLGTEDGLFYINLDQYEIARIGESKKILQLWYIEEE--QILVILCGKQRNLRLLPIRALE-ASDVEWIKVVESKNCISACTGIIRRFP---------NIVYSFIIALKRPNN----------HTQIVVYEINRTRTRHQKTCEFTIGYMAQHLQILSD-MRLVVAHQSGFTAYFLRGEATAMSLVHPENQLCA----FLNYSGVDAVRVIEILCPSGGNFGEYLLVFQTLAIYVDLQGRKSRDREIMYPAFPTYITFCDGHLLVFSDTHLDIFNTQTAE----WVQSIGLKQSLPLNNLGNVVLSSVNDTPLIVYLSNIH--------------------TKGLLQYRDGNRKGLPSIKRRFSIREINKTIKSD-------------------RRSKMISAPTNFNHISHMGPGDGIQNQRLLDL 1572          
BLAST of Serine/threonine kinase vs. UniProt/SwissProt
Match: sp|Q7TT49|MRCKB_RAT (Serine/threonine-protein kinase MRCK beta OS=Rattus norvegicus OX=10116 GN=Cdc42bpb PE=1 SV=1)

HSP 1 Score: 598.971 bits (1543), Expect = 0.000e+0
Identity = 452/1530 (29.54%), Postives = 766/1530 (50.07%), Query Frame = 2
Query:   32 MSIKLTLKQRHENLIKEFLLNYKSSVPDSVTLEFLIDSLFCTYYECRLPFHKDEKNVAQFIKSIKGTVDKIESLRIRRSDFDTIRVIGRGAFGKVSVVRFKEKGEIYAMKSLHKYDILKKIDAACFQEERDVLFQAMKIKSPWITRLHYAFQDEFYLYFVMDFYNGGDMLTLLSKFNDRLPEEITKFYIAEVVMSIDVVHKLGYLHRDIKPDNLLLDSLGHIVLADFGSCVKLRPNGTTITERAVGTPDYISPEILRSAE-GHGPYGVECDWWSLGIVIHEMLYGELPFYNEDFSETYWQIMNFETCFQIPTEYDDVSDEAEDLIKQLICKKECRLGNKGIDDFKNHPFFREIDWDNLRSYNAPFIPEVSSAEDTSNFEFDD---FNANHEGPPLSSNFKGCHLPCIGFTFTKDFIFNEMGSEESSVRLKSL---------MENI-----------------------------------GAPALLNGNHNESNSDALLEEVNQLK---ITCSQLEKQLNECRT------NSVQRIFS------------HPVYQQLVTDKEKLLTQCQNYDYSLREKEQKMDDLIETNRLLNKERDELTSDRLQILQKKQDIEEDLKVMTENFNQLKSTNKAINRXXXXXXXXXXXXXXXXXXXXXXXXH--------------LSIQKNQSQPDIQVEKQRFEEVMLQLRSENDQML-----EKMR------LKCSNLTNSLEQSDQTIFNIKEEIKSLKEIF--TNKEKNLKL-----SHDNEIEQLKISVAEEQSRILASNTQLKSQVKSLSEENVELRSSLQEI-SNKNMKFHFRLKTILDKEIVKTSENSE-----LLTELDREVELLKTLCVDNDGDQKAQGERQDNNGNESWRLRKCVKADKIEISNLNLTLQSERRARA--------------DLEKKLTQQKSEICDISKQLEKYKQDVNEKDNLIANLK-------------------------SASQNLEPHVPKEIPSNPVTLS-----EFNSILSGSLDKTVVNCN------------QHVFSHSTFNRPIKCDYCTSHMLGQYYQGVKCKECSFSCHHYCLSNVLNDKCYTRKSAGK---GANLKNGIGTMYENFIKVPKPGGIRRGWKRQFMALCDLKLFFFDVKEGSTGTQMPDISRNPCRVIDLKYTEFKVVKVSRDEVMHAPKKDVEFIIKIS---IENSSTMLPIYVLFESVDNKEDCIKVIEEARSYIKKDPHYRMIFTEKSCLNNLDISMNYRQILSAAIIDQSTLLFGTEEGL--LKVTDSGYNKIGEKKPVYIIESLDQQELQLVAVIQSKQRVLKLLLSGILDGAHDWEPIIVENGKSCTTFVVGKSYVSPGNQFAPYADTMLANSTFHIKSPSNDRIWIMCAAFKNSVEVYHLNLKLTRHEKLRQILCNTSVTSLQIAGHGEQLLIGMHDSVAIYSLWETGSPXXXXXXXXXXXXXNFQYIFQTNFESMLIVEISFNEYLILFECAGIFINRNHRQTRP-DLQW 4105
            MS K+ LK+     +++ LL+       S+++E L+D L C Y EC     + +K VA+F++  K     ++ +++ R DF+ I+VIGRGAFG+V+VV+ K    IYAMK L+K+++LK+ + ACF+EERDVL         WIT LHYAFQDE YLY VMD+Y GGD+LTLLSKF D+LPE++ +FYI E+V++ID +H+L Y+HRDIKPDN+LLD  GHI LADFGSC+K+  +GT  +  AVGTPDYISPEIL++ E G G YG ECDWWSLG+ ++EMLYGE PFY E   ETY +IMN E  FQ P+   DVS+EA+DLI++LIC +E RLG  GI+DFK H FF  ++W+N+R+  AP+IP+VSS  DTSNF+ DD    N     P   + F G HLP IGFTFT +  F++ GS +S ++  +L         +EN                                    G+   L  ++ +     L EE+ ++K      ++LE+QL +  T      +S QR+                +++QLV   E+L +Q +    + +++++ + +  E    LN+   EL S + ++ ++ +D EE+++V  +  + ++   +   + +  LE  L+    +  KE++  +H              L +++    P   +E Q   + + ++RSE ++ +     E +R      L+  N+   + +S+     +++E+  LK+    + +E++ ++     +  ++ E+ +  + +E  ++ A N +L S V  L+ +N +L   LQ++ S K    H+  +     + V   +++      L +++  E+E L++  +         G R     +  W++R+  K D      L   L++E RA+                 E KL + +++  ++ ++++  K+ + EK      LK                         S++ + E    K   S  V+++     + ++  S     TV   N             H FS  +F  P +C +CTS M+G   QG  C+ C+FSCH  C  +     C       K   G +++ GIGT Y+ ++KVPKP G+++GW+R +  +CD KLF +D+ EG + TQ   I+    +V+DL+  EF V  V   +V+HA ++D+  I +++   + + S    + +L E+ + K   + ++E  ++ + K+     +        +  + +  + +L+AAI+D   +  G EEGL  +++T     +  + K VY IE            +  K++++ LLL G     H + P    +G   + F + K   + G Q       ++A  T    S +      +  A K  V  Y +      H K  +I+    V    +A   ++L +G     ++ S+   G P       +   D +  ++ Q +F+++  VE+   EYL+ F   G++++   R++R  +L W
Sbjct:    1 MSAKVRLKK-----LEQLLLDGPWRNESSLSVETLLDVLVCLYTECSHSALRRDKYVAEFLEWAKPFTQLVKDMQLHREDFEIIKVIGRGAFGEVAVVKMKNTERIYAMKILNKWEMLKRAETACFREERDVLVNG---DCQWITALHYAFQDENYLYLVMDYYVGGDLLTLLSKFEDKLPEDMARFYIGEMVLAIDSIHQLHYVHRDIKPDNVLLDVNGHIRLADFGSCLKMNDDGTVQSSVAVGTPDYISPEILQAMEDGMGKYGPECDWWSLGVCMYEMLYGETPFYAESLVETYGKIMNHEERFQFPSHVTDVSEEAKDLIQRLICSRERRLGQNGIEDFKKHAFFEGLNWENIRNLEAPYIPDVSSPSDTSNFDVDDDVLRNIEILPPGSHTGFSGLHLPFIGFTFTTESCFSDRGSLKSMIQSNTLTKDEDVQRDLENSLQIEAYERRIRRLEQEKLELSRKLQESTQTVQSLHGSTRALGNSNRDKEIKRLNEELERMKSKMADSNRLERQLEDTVTLRQEHEDSTQRLKGLEKQYRLARQEKEELHKQLVEASERLKSQTKELKDAHQQRKRALQEFSE----LNERMAELRSQKQKVSRQLRDKEEEMEVAMQKIDSMRQDIRKSEKSRKELEARLEDAVAEASKERKLREHSESFSKQMERELETLKVKQGGRGPGATLEHQ---QEISKIRSELEKKVLFYEEELVRREASHVLEVKNVKKEVHESESHQLALQKEVLMLKDKLEKSKRERHSEMEEAIGAMKDKYERERAMLFDENKKLTAENEKLCSFVDKLTAQNRQLEDELQDLASKKESVAHWEAQIAEIIQWVSDEKDARGYLQALASKMTEELETLRSSSL---------GSR---TLDPLWKVRRSQKLDMSARLELQSALEAEIRAKQLVHEELRKVKDTSLAFESKLKESEAKNRELLEEMQSLKKRMEEKFRADTGLKLPDFQDPIFEYFNTAPLAHDLTFRTSSASDQETQASKLDLSPSVSVATSTEQQEDAARSQQRPSTVPLPNTQALAMAGPKPKAHQFSIKSFPSPTQCSHCTSLMVGLIRQGYACEVCAFSCHVSC-KDSAPQVCPIPPEQSKRPLGVDVQRGIGTAYKGYVKVPKPTGVKKGWQRAYAVVCDCKLFLYDLPEGKS-TQPGVIA---SQVLDLRDDEFAVSSVLASDVIHATRRDIPCIFRVTASLLGSPSKTSSLLILTENENEKRKWVGILEGLQAILHKNRLRSQVVHVAQEAYDSSLPL-IKTVLAAAIVDGDRIAVGLEEGLYVIELTRDVIVRAADCKKVYQIE------------LAPKEKLI-LLLCGRNHHVHLY-PWTSFDGAEASNFDI-KLPETKGCQ-------LIATGTLRKSSST-----CLFVAVKRLVLCYEIQRTKPFHRKFNEIVAPGHVQ--WMAMFKDRLCVGYPSGFSLLSIQGDGQP----LDLVNPADPSLAFLSQQSFDALCAVELKSEEYLLCFSHMGLYVDPQGRRSRTQELMW 1464          
BLAST of Serine/threonine kinase vs. TrEMBL
Match: A0A4S2MD18 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_000895 PE=3 SV=1)

HSP 1 Score: 792.341 bits (2045), Expect = 0.000e+0
Identity = 534/1556 (34.32%), Postives = 830/1556 (53.34%), Query Frame = 2
Query:   47 TLKQRHENLIKEFLLNYKSSVPDSVTLEFLIDSLFCTYYECRLPFHKDEKNVAQFIKSIKGTVDKIESLRIRRSDFDTIRVIGRGAFGKVSVVRFKEKGEIYAMKSLHKYDILKKIDAACFQEERDVLFQAMKIKSPWITRLHYAFQDEFYLYFVMDFYNGGDMLTLLSKFNDRLPEEITKFYIAEVVMSIDVVHKLGYLHRDIKPDNLLLDSLGHIVLADFGSCVKLRPNGTTITERAVGTPDYISPEILRSAE-GHGPYGVECDWWSLGIVIHEMLYGELPFYNEDFSETYWQIMNFETCFQIPTEYDDVSDEAEDLIKQLICKKECRLGNKGIDDFKNHPFFREIDWDNLRSYNAPFIPEVSSAEDTSNFEFDDFNANHEGPPLSSNFKGCHLPCIGFTFTKDFIFNEMGSEESSVRLKSLM--------------------ENIGAPAL---LNGNHNESNSDALLEEVNQLKITCSQLEKQLNEC-RTNSVQRIFSHPVYQQLVTDKEKLLTQCQNYDYSLREKEQKMDDLIETNRLLNKE----RDELTSDR---LQILQKKQDIEEDLKVMTENFNQLKSTNKAINRXXXXXXXXXXXXXXXXXXXXXXXXHLSIQKNQSQPDIQVEKQRFEEVMLQLRS-ENDQMLEKM----RLKCSNLTNSLEQSDQTIFNIKEEIKSLKEIFTNKEKNLKLSHDNEIEQLKISVAEEQSRILASNTQLKSQVKSLSEENVELRSSLQEISNKNMKFHFRLKTILDKEIVKTSENSELLTELDREVELLKTLCVDNDGDQKAQGERQ-----------DNNGNES-------------------WRLRKCVKADKIEISNLNLTLQSERRARADLEKKLTQQKSEICDISKQLEKYKQDVNEKDNLIAN-----LKSASQ---------------NLEPH-------------VPKEIP---------SNPVTLSEFNSILSGSLDKT-VVNCNQHVFSHSTFNRPIKCDYCTSHMLGQYYQGVKCKECSFSCHHYCL-SNVLNDKCYTRKSAGKGANLKNGIGTMYENFIKVPKPGGIRRGWKRQFMALCDLKLFFFDVK-----EGSTGTQMPD-----------------------ISRNPCRVIDLKYTEFKVVKVSRDEVMHAPKKDVEFIIKISIENSSTMLPIYVLFESVDNKEDCIKVIEEARSYIKKDPHYRMIFTEKSCLNNLDI----SMNYRQILSAAIIDQSTLLFGTEEGLLKVTDSGYNKI---GEKKPVYIIESLDQQELQLVAVIQSKQRVLKLLLSGILDGAHDWEPIIVENGKSCTTFVVGKSYVSPGNQFAPYADTMLANSTFHIKSPSNDRIWIMCAAFKNSVEVYHLNLKLTRHEKLRQILCNTSVTSLQIAGHGEQLLIGMHDSVAIYSLWETGSPXXXXXXXXXXXXXNFQYIFQTNFESMLIVEISFNEYLILFECAGIFINRNHRQTRPD-LQWPDK---PTRFTYRAPYLLCFTEMAGLFAYEITEHSCNLVQALPLRSSKPLDRSGHI 4264
            +L++R   L K +      S P  V++E+L+D++ C  YECRLP  K E+N A+F+ ++K  V+KIES  I R++F+TIR+IG GAFG+VSVVR++  G +YA+KSLHK+D+LK+ D ACFQEERDV+ +A+  KSPWI +LH+AFQD+ +LYF+MDFYNGGDMLT+LSKF+DR+PE I +FYIAE+V++I+ +H LGY+HRDIKPDN+L++S GH+VLADFGSC+KL  NG      AVGTPDYISPEILR+ E GHG YGVECD+WSLG+VIHE+L+GE PFY+E+  ETY QIMNFE  F++P +  DVS+ A DLI++LIC ++ RLG  G  +FK HPFF EI WD +R    P+IPEV   EDTSNF+       HEGPPL   F+GC + CIGFTFT     NE+ S       +SLM                    E+   PA+   ++  H++ N ++ L+ V QL+  C + E ++ +  +T SV  +       Q     E L TQ  +    L     K + L  +NR   +     R ELT  +    ++L   +D EE+ +V+ +     +S  + ++ E+  L  +L  L+ + +  ++   +   + + +   I+ + + F      L + E+ Q    +    RL  +    +L  +++ +   K+E++S+K     +++      ++  +QL+ ++ +  + +         ++ +L     EL +S   I N   +  + LK   D E V   +       +  E+E L+  C+  +    A  E             +N  NE+                   WR RK  K +K+E SNL + L +E RAR   E +L + ++++ +++ QL+  +  + E++ ++       L+ ++Q               +L PH               + +P         S P   S  ++  SGS+  +   + + H F+  +F  P KC  CTS +LGQ +QGV+C+ C FSCH  C  S  +        +   G +   G G + E+ +++PK G I+RGW R +M L D++LF FDV       GS G+  P                         S NP RVIDL+   F V +V   +V+HA + ++  I+KI+++N     P+++LF++    +  +K I++A   I+++   R I  +  C+   D+    ++  +QI  A ++D+  +L G++EG L V D  +  I   G+KKPV+ IE+L+ +ELQLV VIQ K R LKLLL   ++G    E I V + K+C+ FV G S                           ++ + ++CAA + SV VY +    +RH ++R+ILC  +V ++ I   G+ L +G     A+Y +W  G    L+  DL D+D  F +  Q  F++ L V++  NE+L++FE  GI++N + ++TR D L WP K    + F +  PYL  FTE+ GL  + IT  S   V +L  R  +PL    H+
Sbjct:    7 SLEERVAELTKLYSPGSSCSEP-VVSIEYLLDTIVCLAYECRLPQLKSERNCAKFLSAVKQCVEKIESCWINRNEFETIRLIGSGAFGEVSVVRWRADGGVYALKSLHKFDMLKRSDRACFQEERDVMVKALVHKSPWIAKLHHAFQDDKFLYFLMDFYNGGDMLTMLSKFDDRIPENIARFYIAEMVLAINALHDLGYVHRDIKPDNVLIESSGHVVLADFGSCLKLGANGLVQNNTAVGTPDYISPEILRATEDGHGTYGVECDFWSLGVVIHELLFGETPFYSENLVETYSQIMNFEEHFRMPDDCPDVSENARDLIRRLICDRKRRLGRGGAHEFKEHPFFSEIRWDTIRQETPPYIPEVRCPEDTSNFDIAQTPRTHEGPPLGPMFRGCQVACIGFTFTNGSPLNELASASPVTTAQSLMDSCTVSKMITSTRPDFVESEESTEKPAVQSTMDSEHSK-NLESQLQLVEQLRSQCREYELRIQQLEKTCSVSDVAHEDNSTQDSLYSETLKTQLADLQCQLDSLNDKYEQLGVSNRKAEETIIQLRTELTEQQETNCKLLANLRDFEEENEVLCKRAADAQSALRQLDAEQQELLSDLASLRAERVAHRQYGHNTEYESSGALIPIKNDSKAFSSTPASLDNVEHGQTSSHLSAYDRLHETETHYNL--ANERLATAKQELQSMKAARQAEQREWSRERESLGQQLQSAMVDRANAL--------RELHALQANYSELEAS---ILNWERRL-YELKQWADDERVAKDKLHVFTCRVVSELEALRLACLGPEASLPAAEENMHYDYQPVCNGTNNVTNETISFGMDSPAASVTGDGTLDWRQRKSCKVNKMERSNLQVALNNEVRAREQAELRLQEVETKLKEVTDQLKMKETKIEEQERMLEAFNDQLLQVSNQASLLHMQNGVTDDVLSLSPHHVSNAEQTCRATESRRSLPLLSLDNLQHSTPAHRSSLDN--SGSIAPSQYSSTSAHDFTLDSFTGPTKCRVCTSLILGQRFQGVRCQNCGFSCHQRCRHSAPVGCPAPLISAPNPGLDGIYGFGAVLESIVQMPKSGIIKRGWTRHYMFLTDMRLFVFDVTTENSVNGSFGSLSPSNPSFPWSRYPSPSNSVNNVSCVFTSNNPTRVIDLRSPGFSVTRVRDADVIHAKRNEISRILKITLDNRLPAAPLFLLFDTSHLCDRWLKAIDDAARLIQRN--LRKI-PDAECIQLQDVCDSSALLLKQIRCACVLDEHRVLIGSDEG-LHVVDVKHGTIIRRGDKKPVFQIEALN-EELQLVVVIQEKTRRLKLLLLATIEGISS-EQIKVVDPKTCSQFVCGMS--------------------------RSNTVCLLCAAGRRSVWVYEIARVRSRHRRVREILCPDNVQAVNIVRGGDWLCVGCPSYFALYHIWSEGPAQALLRTDLVDLDPTFAFFQQNAFDAYLGVQVDDNEFLLIFENCGIYVNTSRQRTRTDNLMWPAKLISTSPFAFTWPYLYVFTEV-GLVVFNIT--SGLWVASLCGRQVRPLSSDAHL 1509          
BLAST of Serine/threonine kinase vs. TrEMBL
Match: A0A4S2MD13 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_000895 PE=3 SV=1)

HSP 1 Score: 792.341 bits (2045), Expect = 0.000e+0
Identity = 534/1556 (34.32%), Postives = 831/1556 (53.41%), Query Frame = 2
Query:   47 TLKQRHENLIKEFLLNYKSSVPDSVTLEFLIDSLFCTYYECRLPFHKDEKNVAQFIKSIKGTVDKIESLRIRRSDFDTIRVIGRGAFGKVSVVRFKEKGEIYAMKSLHKYDILKKIDAACFQEERDVLFQAMKIKSPWITRLHYAFQDEFYLYFVMDFYNGGDMLTLLSKFNDRLPEEITKFYIAEVVMSIDVVHKLGYLHRDIKPDNLLLDSLGHIVLADFGSCVKLRPNGTTITERAVGTPDYISPEILRSAE-GHGPYGVECDWWSLGIVIHEMLYGELPFYNEDFSETYWQIMNFETCFQIPTEYDDVSDEAEDLIKQLICKKECRLGNKGIDDFKNHPFFREIDWDNLRSYNAPFIPEVSSAEDTSNFEFDDFNANHEGPPLSSNFKGCHLPCIGFTFTKDFIFNEMGSEESSVRLKSLM--------------------ENIGAPAL---LNGNHNESNSDALLEEVNQLKITCSQLEKQLNEC-RTNSVQRIFSHPVYQQLVTDKEKLLTQCQNYDYSLREKEQKMDDLIETNR----LLNKERDELTSDR---LQILQKKQDIEEDLKVMTENFNQLKSTNKAINRXXXXXXXXXXXXXXXXXXXXXXXXHLSIQKNQSQPDIQVEKQRFEEVMLQLRS-ENDQMLEKM----RLKCSNLTNSLEQSDQTIFNIKEEIKSLKEIFTNKEKNLKLSHDNEIEQLKISVAEEQSRILASNTQLKSQVKSLSEENVELRSSLQEISNKNMKFHFRLKTILDKEIVKTSENSELLTELDREVELLKTLCVDNDGDQKAQGERQ-----------DNNGNES-------------------WRLRKCVKADKIEISNLNLTLQSERRARADLEKKLTQQKSEICDISKQLEKYKQDVNEKDNLIAN-----LKSASQ---------------NLEPH-------------VPKEIP---------SNPVTLSEFNSILSGSLDKT-VVNCNQHVFSHSTFNRPIKCDYCTSHMLGQYYQGVKCKECSFSCHHYCL-SNVLNDKCYTRKSAGKGANLKNGIGTMYENFIKVPKPGGIRRGWKRQFMALCDLKLFFFDVK-----EGSTGTQMPD-----------------------ISRNPCRVIDLKYTEFKVVKVSRDEVMHAPKKDVEFIIKISIENSSTMLPIYVLFESVDNKEDCIKVIEEARSYIKKDPHYRMIFTEKSCLNNLDI----SMNYRQILSAAIIDQSTLLFGTEEGLLKVTDSGYNKI---GEKKPVYIIESLDQQELQLVAVIQSKQRVLKLLLSGILDGAHDWEPIIVENGKSCTTFVVGKSYVSPGNQFAPYADTMLANSTFHIKSPSNDRIWIMCAAFKNSVEVYHLNLKLTRHEKLRQILCNTSVTSLQIAGHGEQLLIGMHDSVAIYSLWETGSPXXXXXXXXXXXXXNFQYIFQTNFESMLIVEISFNEYLILFECAGIFINRNHRQTRPD-LQWPDK---PTRFTYRAPYLLCFTEMAGLFAYEITEHSCNLVQALPLRSSKPLDRSGHI 4264
            +L++R   L K +      S P  V++E+L+D++ C  YECRLP  K E+N A+F+ ++K  V+KIES  I R++F+TIR+IG GAFG+VSVVR++  G +YA+KSLHK+D+LK+ D ACFQEERDV+ +A+  KSPWI +LH+AFQD+ +LYF+MDFYNGGDMLT+LSKF+DR+PE I +FYIAE+V++I+ +H LGY+HRDIKPDN+L++S GH+VLADFGSC+KL  NG      AVGTPDYISPEILR+ E GHG YGVECD+WSLG+VIHE+L+GE PFY+E+  ETY QIMNFE  F++P +  DVS+ A DLI++LIC ++ RLG  G  +FK HPFF EI WD +R    P+IPEV   EDTSNF+       HEGPPL   F+GC + CIGFTFT     NE+ S       +SLM                    E+   PA+   ++  H++ N ++ L+ V QL+  C + E ++ +  +T SV  +       Q     E L TQ  +    L     K + L  +NR     + + R ELT  +    ++L   +D EE+ +V+ +     +S  + ++ E+  L  +L  L+ + +  ++   +   + + +   I+ + + F      L + E+ Q    +    RL  +    +L  +++ +   K+E++S+K     +++      ++  +QL+ ++ +  + +         ++ +L     EL +S   I N   +  + LK   D E V   +       +  E+E L+  C+  +    A  E             +N  NE+                   WR RK  K +K+E SNL + L +E RAR   E +L + ++++ +++ QL+  +  + E++ ++       L+ ++Q               +L PH               + +P         S P   S  ++  SGS+  +   + + H F+  +F  P KC  CTS +LGQ +QGV+C+ C FSCH  C  S  +        +   G +   G G + E+ +++PK G I+RGW R +M L D++LF FDV       GS G+  P                         S NP RVIDL+   F V +V   +V+HA + ++  I+KI+++N     P+++LF++    +  +K I++A   I+++   R I  +  C+   D+    ++  +QI  A ++D+  +L G++EG L V D  +  I   G+KKPV+ IE+L+ +ELQLV VIQ K R LKLLL   ++G    E I V + K+C+ FV G S                           ++ + ++CAA + SV VY +    +RH ++R+ILC  +V ++ I   G+ L +G     A+Y +W  G    L+  DL D+D  F +  Q  F++ L V++  NE+L++FE  GI++N + ++TR D L WP K    + F +  PYL  FTE+ GL  + IT  S   V +L  R  +PL    H+
Sbjct:    7 SLEERVAELTKLYSPGSSCSEP-VVSIEYLLDTIVCLAYECRLPQLKSERNCAKFLSAVKQCVEKIESCWINRNEFETIRLIGSGAFGEVSVVRWRADGGVYALKSLHKFDMLKRSDRACFQEERDVMVKALVHKSPWIAKLHHAFQDDKFLYFLMDFYNGGDMLTMLSKFDDRIPENIARFYIAEMVLAINALHDLGYVHRDIKPDNVLIESSGHVVLADFGSCLKLGANGLVQNNTAVGTPDYISPEILRATEDGHGTYGVECDFWSLGVVIHELLFGETPFYSENLVETYSQIMNFEEHFRMPDDCPDVSENARDLIRRLICDRKRRLGRGGAHEFKEHPFFSEIRWDTIRQETPPYIPEVRCPEDTSNFDIAQTPRTHEGPPLGPMFRGCQVACIGFTFTNGSPLNELASASPVTTAQSLMDSCTVSKMITSTRPDFVESEESTEKPAVQSTMDSEHSK-NLESQLQLVEQLRSQCREYELRIQQLEKTCSVSDVAHEDNSTQDSLYSETLKTQLADLQCQLDSLNDKYEQLGVSNRKAEETIIQLRTELTEQQETNCKLLANLRDFEEENEVLCKRAADAQSALRQLDAEQQELLSDLASLRAERVAHRQYGHNTEYESSGALIPIKNDSKAFSSTPASLDNVEHGQTSSHLSAYDRLHETETHYNL--ANERLATAKQELQSMKAARQAEQREWSRERESLGQQLQSAMVDRANAL--------RELHALQANYSELEAS---ILNWERRL-YELKQWADDERVAKDKLHVFTCRVVSELEALRLACLGPEASLPAAEENMHYDYQPVCNGTNNVTNETISFGMDSPAASVTGDGTLDWRQRKSCKVNKMERSNLQVALNNEVRAREQAELRLQEVETKLKEVTDQLKMKETKIEEQERMLEAFNDQLLQVSNQASLLHMQNGVTDDVLSLSPHHVSNAEQTCRATESRRSLPLLSLDNLQHSTPAHRSSLDN--SGSIAPSQYSSTSAHDFTLDSFTGPTKCRVCTSLILGQRFQGVRCQNCGFSCHQRCRHSAPVGCPAPLISAPNPGLDGIYGFGAVLESIVQMPKSGIIKRGWTRHYMFLTDMRLFVFDVTTENSVNGSFGSLSPSNPSFPWSRYPSPSNSVNNVSCVFTSNNPTRVIDLRSPGFSVTRVRDADVIHAKRNEISRILKITLDNRLPAAPLFLLFDTSHLCDRWLKAIDDAARLIQRN--LRKI-PDAECIQLQDVCDSSALLLKQIRCACVLDEHRVLIGSDEG-LHVVDVKHGTIIRRGDKKPVFQIEALN-EELQLVVVIQEKTRRLKLLLLATIEGISS-EQIKVVDPKTCSQFVCGMS--------------------------RSNTVCLLCAAGRRSVWVYEIARVRSRHRRVREILCPDNVQAVNIVRGGDWLCVGCPSYFALYHIWSEGPAQALLRTDLVDLDPTFAFFQQNAFDAYLGVQVDDNEFLLIFENCGIYVNTSRQRTRTDNLMWPAKLISTSPFAFTWPYLYVFTEV-GLVVFNIT--SGLWVASLCGRQVRPLSSDAHL 1509          
BLAST of Serine/threonine kinase vs. TrEMBL
Match: A0A504YH18 (CDC42BPB protein OS=Fasciola gigantica OX=46835 GN=FGIG_05120 PE=3 SV=1)

HSP 1 Score: 775.778 bits (2002), Expect = 0.000e+0
Identity = 528/1546 (34.15%), Postives = 812/1546 (52.52%), Query Frame = 2
Query:   65 ENLIKEFLLNYKSSVP----DSVTLEFLIDSLFCTYYECRLPFHKDEKNVAQFIKSIKGTVDKIESLRIRRSDFDTIRVIGRGAFGKVSVVRFKEKGEIYAMKSLHKYDILKKIDAACFQEERDVLFQAMKIKSPWITRLHYAFQDEFYLYFVMDFYNGGDMLTLLSKFNDRLPEEITKFYIAEVVMSIDVVHKLGYLHRDIKPDNLLLDSLGHIVLADFGSCVKLRPNGTTITERAVGTPDYISPEILRSAE-GHGPYGVECDWWSLGIVIHEMLYGELPFYNEDFSETYWQIMNFETCFQIPTEYDDVSDEAEDLIKQLICKKECRLGNKGIDDFKNHPFFREIDWDNLRSYNAPFIPEVSSAEDTSNFEFDDFNANHEGPPLSSNFKGCHLPCIGFTFTKDFIFNEMG-----SEESSVRLKSLMENIGAPALLNGNHNESNSDALLEEVNQLKITCSQLEKQLNECR-----TNSVQRIFSHPVYQQLVT---DKEKLLTQC-----QNYDY------------SLREKEQKMD----DLIETNRLLNKERDELTSDRLQILQKKQDIEEDLKVM-----------TENFNQLKSTNKAINRXXXXXXXXXXXXXXXXXXXXXXXXHLSIQKNQSQPDIQVE-KQRFEEVMLQLRSENDQM----LEKMRLKCSNLTNSLE-QSDQTIFNIKEEIKSLKEIFTNKEKNLKLSHDNEIEQLKISVAEEQSRILASNTQLKSQVKSLSEENVELRSSLQEISNKNMKF-----HFRLKTILDKEI-------VKTSENSELLTELDREVEL------LKTLCVDNDGDQKAQGERQDNNGNESWRLRKCVKADKIEISNLNLTLQSERRARADLEKKLTQQKSEICDISKQLEKYKQDVNEKDNLIANLK-------SASQ---------NLEPHV--------------------------------PKEIPSNPVTLSEFNSILSGSLDKTVVNCNQHVFSHSTFNRPIKCDYCTSHMLGQYYQGVKCKECSFSCHHYCLSNVLNDKCYTRKSAGKGANLKN--GIGTMYENFIKVPKPGGIRRGWKRQFMALCDLKLFFFDVK------------EGS-------------------TGTQMPD----ISRNPCRVIDLKYTEFKVVKVSRDEVMHAPKKDVEFIIKISIENSSTMLPIYVLFESVDNKEDCIKVIEEARSYIKKDPHYRMIFTEKSCLNNLDIS----MNYRQILSAAIIDQSTLLFGTEEGLLKVTDSGYNKI---GEKKPVYIIESLDQQELQLVAVIQSKQRVLKLLLSGILDGAHDWEPIIVENGKSCTTFVVGKSYVSPGNQFAPYADTMLANSTFHIKSPSNDRIWIMCAAFKNSVEVYHLNLKLTRHEKLRQILCNTSVTSLQIAGHGEQLLIGMHDSVAIYSLWETGSPXXXXXXXXXXXXXNFQYIFQTNFESMLIVEISFNEYLILFECAGIFINRNHRQTRPD-LQWPDK---PTRFTYRAPYLLCFTEMAGLFAYEIT 4192
            E  IKE +  Y  S P     SV++E+L+D++ C  YECRLP H+ E+N  +F +S+K  V++IE   I R +F+TIR+IG GAFG+VSVVR+K  G+IYA+KSLHK+D+LK+ D ACFQEERDV+ +AM  KSPWI +LH+AFQDE +LYF+MDFYNGGDMLT+LSKF+D++PE+I +FYIAE+V++ID +H+LGY+HRDIKPDN+LL+  GHIVLADFGSC+KL  NG      AVGTPDYISPEILR+ E  HG YGVECD+WSLG+V++EML+GE PFY+E+  ETY  IMNFE  F IP +  +VS+ A DL+ +LIC ++ RLG  G+ DFK HPFF++IDWD++R    P+ PEV S +DTSNF+ +    NHEGPPL   F+GC + CIGFTFT     NE+G     S+ +     + + +I  P     + + S +++ L E   L+  C + E ++ +       +NS   + +  +   +     D E L T+C     QN DY              +E  QK+     D  E N  L K   +  S  +Q+  ++ D+  DL  +           T + N L+S++ A +           + ++            +  +N    D Q E  +R  ++   L+   D++     E   LK +  T   E   D+TI       + L+   T++   LK     E+  L+    E +S I       +S++  LS+   + R++  ++    ++        RL ++  + +       V T+  SE  T  +  V+         +LC+D+       GE         WRLRK  K +K+E SNL + L +E R R   E +  + ++++ ++  Q++     + E++ +I +LK       +A+Q         NL+  +                                P   P  P T  E +S  SG  + +    + H F+ +TF  P KC  CTS MLG  +QGV+C++C F CH  C        C    +   G +     G GT+ E  +++PK GGI+RGW R ++ L D++LF +D+              GS                    G+ M      +S +P R++D++   F V +VS  +V+HA + D+  I+K+ ++N      +++LF++ +  +  ++ ++++   +++  H R I  +  CL   ++     +  +QIL A ++D+  +L G ++G L V D  +  I   G+KKPV+ +E+L  ++LQ+V +IQ KQR LKLLL G ++G   ++PI +   K+C+ FV G   +S GN                       +I ++CAA + SV VY +     RH +LR+I C   V S+Q A  G+ L IG     A+Y+LW       L+  DL D+D +  +  Q    + L V++  +E+L++FE  G+++N + ++TRPD L WP K      F +  PYL  FTE AGL  YE+T
Sbjct:    9 EERIKELVSLYTESSPFFDHGSVSIEYLLDTIVCLSYECRLPQHRSERNCLKFSESVKPYVERIERCWISRDEFETIRLIGSGAFGEVSVVRWKNDGQIYALKSLHKFDMLKRSDRACFQEERDVMVKAMVKKSPWIAKLHHAFQDEKFLYFLMDFYNGGDMLTMLSKFDDKIPEDIARFYIAEIVLAIDSLHQLGYVHRDIKPDNVLLECSGHIVLADFGSCLKLSENGLVKNSTAVGTPDYISPEILRATEDDHGTYGVECDFWSLGVVMYEMLFGETPFYSENLIETYGHIMNFEEHFTIPDDGTEVSEPARDLMCRLICDRKRRLGRNGLSDFKTHPFFKKIDWDHIREQTPPYKPEVKSPDDTSNFDIEQSTRNHEGPPLGPIFRGCQVACIGFTFTNGSPLNELGTRHTKSDHNPDGTVTELASIKMPTTSGPDVSTSEAESSLIE---LQARCREYELRIQQLESSLPISNSTDSVITTALPNSVAAVEKDLEALSTRCQQLEAQNGDYFESITTLKAELLEQQEANQKLSAELRDFEEENESLCKRASDAQSTIMQLETERTDLLSDLSRLRAELAAHRQYSTTSSNLLRSSDFADSELLHNSSSVTGRNEQTKGFSSTPALLDNGAENHDT-DTQFELYERIRDLETTLKVTTDRLNCNKQEFHALKAARQTEQKEWDQDRTILE-----QRLQNALTDQSSTLK-----ELNDLQAKYTELESSI----GNWESKLYELSQWADDERAAKDKLHAFTVRVVSELEALRLASLGPEGMMTNHDNNVTTTSTSEYQTAWNGAVQPSASTNETASLCMDSPA-MSMTGE-----STLDWRLRKSSKMNKMERSNLQVALNNEVRVREQAELRSQEAEAKLKELFDQVKMKDMKIQEQERIIESLKDQLLEASAANQSRLLRINNGNLDDSICLNQRVSKLDANGSLNETTERPLQAMELSALHPTSTPLAPHTSWEPSS-RSGQTNHST---SAHKFTLTTFTDPTKCHACTSLMLGLRWQGVRCQDCGFQCHQRC-RQTATSACPAPSATLLGNSFDGGCGFGTVLEGVVQMPKAGGIKRGWTRHYLFLSDMRLFVYDITVDPSSHTCDNNVNGSIHSVSQTTSLFPWSRLHSPNGSMMSVSSTFLSNSPNRIVDMRSPGFSVSRVSDMDVIHAKRNDIPKILKVILDNRLPSACLFLLFDNQNLADRWLRAMDDSARLVQR--HMRKI-PDDECLRMQEVCDPGFLMVKQILCACVLDEDRILLGADDG-LHVADIKHGTIVRRGDKKPVFQVEAL-AEDLQVVVIIQEKQRRLKLLLLGTIEGMQ-FDPIKLSEPKTCSQFVCG---MSRGN-----------------------KISLLCAAGRRSVWVYEIARVRGRHRRLREITCPDMVQSIQFARGGDWLCIGCPSFFALYNLWTDAPAQALLRTDLVDLDPSLSFFQQVACNAHLSVQVDDDEFLLVFESCGVYVNTHRQRTRPDHLMWPAKLLAGNPFGFMWPYLYVFTE-AGLVVYEVT 1492          
BLAST of Serine/threonine kinase vs. TrEMBL
Match: A0A3Q0KR06 (Serine/threonine kinase OS=Schistosoma mansoni OX=6183 PE=3 SV=1)

HSP 1 Score: 759.599 bits (1960), Expect = 0.000e+0
Identity = 556/1754 (31.70%), Postives = 843/1754 (48.06%), Query Frame = 2
Query:   74 IKEFLLNYKSSVP----DSVTLEFLIDSLFCTYYECRLPFHKDEKNVAQFIKSIKGTVDKIESLRIRRSDFDTIRVIGRGAFGKVSVVRFKEKGEIYAMKSLHKYDILKKIDAACFQEERDVLFQAMKIKSPWITRLHYAFQDEFYLYFVMDFYNGGDMLTLLSKFNDRLPEEITKFYIAEVVMSIDVVHKLGYLHRDIKPDNLLLDSLGHIVLADFGSCVKLRPNGTTITERAVGTPDYISPEILRSAE-GHGPYGVECDWWSLGIVIHEMLYGELPFYNEDFSETYWQIMNFETCFQIPTEYDDVSDEAEDLIKQLICKKECRLGNKGIDDFKNHPFFREIDWDNLRSYNAPFIPEVSSAEDTSNFEFDDFNANHEGPPLSSNFKGCHLPCIGFTFTKDFIFNEMGSEESSVRLKSLME------------NIGAPALLNGNHNESNSD---------ALLEEVNQLKITCSQLEKQLNEC-------RTNSVQRIFSHPVYQQLVTDKEK-------------LLTQCQNYDYSLREKEQKMDDLIETNRLLNKERDELTSDRLQILQKKQDIEEDLKVMTENFNQLKSTNKAINRXXXXXXXXXXXXXXXXXXXXXXXXHLSIQKNQSQPDIQVEKQRFEEVMLQ--LRSENDQMLEKMRLKCSNLTNSLEQSDQTIFNIKEEIKSLKEIFTNKEKNLKLSHDN------EIEQLKISVAEEQSRILASNTQLKSQVK-SLSEENVELRSSLQEISNKNMKFH----------FRLKTILDKEIVKTSENSELLTELDREVELLKTLCVDNDGDQKA------QGERQDNNGNE----------------SWRLRKCVKADKIEISNLNLTLQSERRARADLEKKLTQQKSEICDISKQLEKYKQDVNEKDNLIANLKSA--------------------SQNLEPHVPKE---------IP----SNPVTLSEFNSILSGSLDKTVVNCNQ---HVFSHSTFNRPIKCDYCTSHMLGQYYQGVKCKECSFSCHHYCLSNV------LNDKCYTRKSAGKGANLKNGIGTMYENFIKVPKPGGIRRGWKRQFMALCDLKLFFFDVKE--------GSTGTQMPDI--------------------------SRNPCRVIDLKYTEFKVVKVSRDEVMHAPKKDVEFIIKISIENSSTMLPIYVLFESVDNKEDCIKVIEEARSYIKKDPHYRMIFT--EKSCLNNLDISMN-----YRQILSAAIIDQSTLLFGTEEGL--LKVTDSGYNKIGEKKPVYIIESLDQQELQLVAVIQSKQRVLKLLLSGILDGAHDWEPIIVENGKSCTTFVVGKSYVSPGNQFAPYADTMLANSTFHIKSPSNDRIWIMCAAFKNSVEVYHLNLKLTRHEKLRQILCNTSVTSLQIAGHGEQLLIGMHDSVAIYSLWETGSPXXXXXXXXXXXXXNFQYIFQTNFESMLIVEISFNEYLILFECAGIFINRNHRQTRPD-LQWPDK---PTRFTYRAPYLLCFTEMAGLFAYEI-------TEHSCNLVQALPLRSSKPL-----------------------DRSGHILTTANEFIQAIDLIYVHLVSANEEKISIGKTIDKTSSSN--------------TLSIFKFLNKRKPS-----YNKQEDSFD-TNDAISPNPAGN------------STKSTGLKYRDKPTLKSNRQISVPQNFRHLSHMGPDVP-CQLIDL 4618
            I E +  Y  S P    +S+++E+L+D++ C  YEC+LP HK+E+N  +F  ++K  VDKIES  I +S+F+TIR+IG GAFG VSVV++K  G+IYA+KSLHKYD+LK+ D ACFQEERDV+ +AM  KS W+ +LH+ FQDE +LYF+MDFYNGGDMLT+LSKF+D++PE I +FY++E+V++ID +H+LGY+HRDIKPDN+LL S GHIVLADFGSC+KL  NG      AVGTPDYISPEILR++E GHG YGVECD+WSLG+V++EML+GE PFY+E+  ETY  IMNFE  F IPT+   +S+ A DLI+ LIC ++ R G  GID+ K H FF  IDW+++     P+IPEV+S +DTSNF+ +  + NHEGPPL   F+GC + CIGFTFT +   NE+G     +  K  +E            +I  P+  +G  + SN+          AL+E +  LK  C   E Q+ E        R +   ++   P    +  D  K             +  Q +     L+E E +   +  T  LL  E  E    R ++  + Q  EE      EN    K  + A    + L     + L +      E   H       +  D+     + E   L+  +++ N  +        +NL N  + S     N       L+E     E  LK   +N      E +  K+    EQ   +     L+ ++K S+ ++ V L + L  +   N +            F L   +D E     +       L  E++ L+   +  D +Q        Q   + NN N                  WR RK  K +K+E  +  + L +E +AR   E  L + ++ + ++  Q+ +    + E+D +I +L S                     + N  P    E         +P    S+P T +   +  + +LD +  +      H F+  TF +P KC  C S +LGQ +QGV+C++C   CHH C  +V      LN  C              G G  +E+ +K+PK GGI+RGW +  + L D +LFF+DV          G +G  +                             S +P R++DL+ + F V  V+  +V+HA ++D+  I+K+ +++     P+++LFES    E   K+I++    ++     R I T  E  CL   D+S++      +QI  A+++D+   L GT+EGL  + +  +   +IG +KPVY +E+L  +ELQL   IQ KQR LKL+L G  +G  + +PI +   K CT F    S                           N+ + ++C A   S+ ++ +     RH++L++I C   V S+     G+ + +G  +  A++S+W  G   +L+  DL D+D +  +   +  E+   V++  +E+L+ FE  G+++N N ++TRPD L WP K    T  ++  PYL  FTE AGL  +         T  SC  VQ L + +   L                         +G + T +  ++   DL+           I + +T D    S                 SIF    + + S     Y+  EDS   T+  ISP    N            S +ST        T + +  IS P +FRH+SHMGP +    L+DL
Sbjct:    8 INELVSLYTKSSPLLEDNSLSVEYLLDTIVCLSYECKLPQHKNERNCIKFYNAVKKYVDKIESCWISKSEFETIRLIGSGAFGDVSVVKWKNDGKIYALKSLHKYDMLKRSDRACFQEERDVMVKAMVSKSLWLAKLHHTFQDEKFLYFLMDFYNGGDMLTMLSKFDDKIPENIVQFYVSEMVLAIDSLHQLGYVHRDIKPDNVLLQSSGHIVLADFGSCLKLGENGLVKNNTAVGTPDYISPEILRASEDGHGTYGVECDYWSLGVVMYEMLFGETPFYSENLIETYSHIMNFEKHFTIPTDCVKISESACDLIRHLICDRKRRFGRNGIDELKGHAFFNGIDWEHIHEQIPPYIPEVTSPDDTSNFDIEQSSRNHEGPPLGPIFRGCQVACIGFTFTNNSPLNELGPTHYRMTSKDKLECPEEISKPEGSDDISPPSDDSGILDPSNASKFSSGTREPALIELIKALKTKCENYEMQITELKDTLSCYRESKGDQVSVKPELDPITIDLGKQDVSSGDSSTVNTITRQVEILSQKLKESEAQNQLISATVDLLKNELSEQHEIREKLQSEVQAFEE------ENETLCKRASDAQLAIRLLESEHSELLSEIARLRGELASHREYDNRTALNDVHDLLHKNESRSLENGVKNHNISISSSSSSSSTNLVNGTQHSH---INNHSSDSDLRERLYESETKLKRVMENLIAVRHEAQSFKLGWESEQKEWMKERELLEEKIKISVDQKTVALENELTTLKENNAELENNIGNWERHLFELNQWVDDEREAKEKLHNFTMRLVSELDTLRASGLVQDYNQNGVCPNGYQSSWRANNVNSLAYDSPAQSVIVDSTLDWRQRKSTKLNKMERWSHEVALNNEVKAREQAELLLQEVEARLKEMYDQINQKDLKIKEQDRIIEHLNSQLLEASNQARLCRMNNDSVNDAANFMPKATSEKNAMDNRRSLPSLDISSPYTSTPGQNSWT-TLDASGTSQTSTLTHKFTFVTFLQPTKCHVCGSLILGQKWQGVQCQDCQLKCHHRCRMSVHIVCTALNSNCIDGSP---------GFGADFESDVKMPKLGGIKRGWMKYRVFLSDKRLFFYDVVSESSNIAALGGSGNSLSPTFQNFHLSNSHNVSLSSLNTSTNSMFQSNSPSRIVDLRSSGFSVSYVTASDVIHAKQQDIPKILKVVVDDYLPSAPLFLLFESSALCECWFKLIQDVLKLVQ-----RHISTDNESQCLQVRDVSVSSVSVILKQINCASVLDEYRFLAGTDEGLYIVDIRQNINTRIGARKPVYQVEAL-AEELQLAVAIQGKQRFLKLILVGSFEGM-NLKPIKITEPKLCTRFTCSMS--------------------------RNNTVCLICVASNRSLFIFEIARVQGRHKRLKEISCPYIVQSINFVRDGDWICVGSSNYFAMFSIWTDGPAQVLLRGDLIDLDSSLAFFQHSPSEAHCAVQLGNDEFLLAFENCGVYMNSNRKKTRPDNLMWPAKLISGTAVSFSYPYLYVFTE-AGLVVFNAVTSCWVSTLSSCR-VQPLSMDAHLCLAHLSSASVSNSSSRKSAIGSIIDSSTGSVATPSPPYVSPNDLVSSQQQQQLLRLIHLPQTSDSKEMSKQQVSALRSRRLQMPQFSIFGVTGRMRKSSRFNLYSLVEDSLSGTSHGISPERVRNFRSQSQHRTPQSSVQSTVSLNPTSGTSRISNLISGPSDFRHISHMGPQITGAPLLDL 1707          
BLAST of Serine/threonine kinase vs. TrEMBL
Match: A0A074ZJE8 (Kinase domain protein OS=Opisthorchis viverrini OX=6198 GN=T265_08652 PE=4 SV=1)

HSP 1 Score: 731.095 bits (1886), Expect = 0.000e+0
Identity = 515/1555 (33.12%), Postives = 807/1555 (51.90%), Query Frame = 2
Query:   35 SIKLTLKQRHENLIKEFLLNYKSSVPDSVTLEFLIDSLFCTYYECRLPFHKDEKNVAQFIKSIKGTVDKIESLRIRRSDFDTIRVIGRGAFGKVSVVRFKEKGEIYAMKSLHKYDILKKIDAACFQEERDVLFQAMKIKSPWITRLHYAFQDEFYLYFVMDFYNGGDMLTLLSKFNDRLPEEITKFYIAEVVMSIDVVHKLGYLHRDIKPDNLLLDSLGHIVLADFGSCVKLRPNGTTITERAVGTPDYISPEILRSAE-GHGPYGVECDWWSLGIVIHEMLYGELPFYNEDFSETYWQIMNFETCFQIPTEYDDVSDEAEDLIKQLICKKECRLGNKGIDDFKNHPFFREIDWDNLRSYNAPFIPEVSSAEDTSNFEFDDFNANHEGPPLSSNFKGCHLPCIG-------------FTFTKDFIFNEMGSEESSVRLKSLMEN---IGAPAL---LNGNHNESNSDALLEEVNQLKITCSQLEKQLNEC-RTNSVQRIFSHPVYQQLVTDKEKLLTQCQNYDYSLREKEQKMDDLIETNRLLNKE----RDELTSDR---LQILQKKQDIEEDLKVMTENFNQLKSTNKAINRXXXXXXXXXXXXXXXXXXXXXXXXHLSIQKNQSQPDIQVEKQRFEEVMLQLRS-ENDQMLEKM----RLKCSNLTNSLEQSDQTIFNIKEEIKSLKEIFTNKEKNLKLSHDNEIEQLKISVAEEQSRILASNTQLKSQVKSLSEENVELRSSLQEISNKNMKFHFRLKTILDKEIVKTSENSELLTELDREVELLKTLCVDNDGDQKAQGERQ------------------------------DNNGNESWRLRKCVKADKIEISNLNLTLQSERRARADLEKKLTQQKSEICDISKQLEKYKQDVNEKDNL----------IANLKSASQ----------NLEPH-------------VPKEIP---------SNPVTLSEFNSILSGSLDKTV-VNCNQHVFSHSTFNRPIKCDYCTSHMLGQYYQGVKCKECSFSCHHYCLSNVLNDKCYTRKSAGKGANLKNGIGTMYENFIKVPKPGGIRRGWKRQFMALCDLKLFFFDVK-----EGSTGTQMPD-----------------------ISRNPCRVIDLKYTEFKVVKVSRDEVMHAPKKDVEFIIKISIENSSTMLPIYVLFESVDNKEDCIKVIEEARSYIKKDPHYRMIFTEKSCLNNLDI----SMNYRQILSAAIIDQSTLLFGTEEGLLKVTDSGYNKI---GEKKPVYIIESLDQQELQLVAVIQSKQRVLKLLLSGILDGAHDWEPIIVENGKSCTTFVVGKSYVSPGNQFAPYADTMLANSTFHIKSPSNDRIWIMCAAFKNSVEVYHLNLKLTRHEKLRQILCNTSVTSLQIAGHGEQLLIGMHDSVAIYSLWETGSPXXXXXXXXXXXXXNFQYIFQTNFESMLIVEISFNEYLILFECAGIFINRNHRQTRPD-LQWPDK---PTRFTYRAPYLLCFTEMAGLFAYEITEHSCNLVQALPLRSSKPLDRSGHI 4264
            S    L++R   L K +      S P  V++E+L+D++ C  YECRLP  K E+N A+F+ ++K  V KIES  I R++F+TIR+IG GAFG+VSVVR+K  G +YA+KSLHK+D+LK+ D ACFQEERDV+ +A+  KSPWI +LH+AFQD+ +LYF+MDFYNGGDMLT+LSKF+DR+PE I +FYIAE+V++I+ +H LGY+HRDIKPDN+L++S GH+VLADFGSC+KL  NG      AVGTPDYISPEILR+ E GHG YGVECD+WSLG+VIHE+L+GE PFY+E+  ETY QIMNFE  F +P +  DVS+ A DLI++LIC ++ RLG  G  +FK HPFF EI WD +R    P        EDTSNF+       HEGPPL   F+GC + CIG             FT   D   + M S+ ++      +E+      PA+   ++  H++   ++ L+ V QL+  C + E ++ +  +T SV  +       Q     E L TQ  +    L     K + L  ++R+  +     R ELT  +    ++L   +D EE+ +V+ +     +S  + ++ E+  L  +L  L+ + +  ++   +   + + +   I+ + + F      L + E+ Q   ++    RL+ +    +L  +++ +   K+E++S+K     +++      ++  +QL+ ++ +  + +         ++ +L     EL +S   I N   +  + LK   D E V   +       +  E+E L+  C+  +    A  E                                  +G   WR RK  K +K+E SNL + L +E RAR   E +L + ++++ +++ QL+  +  + E++ +          ++N  S S           +L PH               + +P         S P   S  ++  SGS+  +   + + H F+  +F  P KC  C+S +LGQ +QGV+C+ C FSCH  C  +V                              +PK G I+RGW R +M L D++LF FDV       GS G+  P                         S NP RV+DL+   F V +V   +V+HA + ++  I+KI+++N     P+++LF++    +  +K I++A   I+++   R I  +  C+   D+    ++  +QI  A ++D+  +L G++EGL  V D  +  I   G+KKPV+ IE+L++ ELQLV VIQ K R LKLLL   ++G    E I V + K+C+ FV G S                           ++ + ++CAA + SV VY +    +RH ++R+IL   +V ++ I   G  L +G     A+Y +W  G    L+  DL D+D  F +  Q  F++ + +++  NE+L++FE  GI++N + ++TR D L WP K    + F +  PYL  FTE+ GL  + IT  S   V +L  R  +PL    H+
Sbjct:    3 SAPRALEERVAELTKLYSPGSLCSEP-VVSIEYLLDTIVCLAYECRLPQLKSERNCAKFLNAVKECVAKIESCWINRNEFETIRLIGSGAFGEVSVVRWKADGGVYALKSLHKFDMLKRSDRACFQEERDVMVKALVHKSPWIAKLHHAFQDDKFLYFLMDFYNGGDMLTMLSKFDDRIPENIARFYIAEMVLAINALHDLGYVHRDIKPDNVLIESSGHVVLADFGSCLKLGANGLVQNNTAVGTPDYISPEILRATEDGHGTYGVECDFWSLGVVIHELLFGETPFYSENLVETYSQIMNFEEHFHMPDDCPDVSENARDLIRRLICDRKRRLGRGGPHEFKEHPFFNEIRWDTIRQVRCP--------EDTSNFDIAQTPRTHEGPPLGPMFRGCQVACIGFTFTNGSPLNELAFTGPLDTAQSTMDSKMTTSTRPDFVESEESTEKPAVQSTIDIKHSK-RLESQLQLVEQLRSQCREYELRIQQLEKTCSVSDVTHEDNSTQDSLYSETLKTQLSDLQCQLDSLNDKYEQLGVSSRIAEETIIQLRTELTEQQETNCKLLANLRDFEEENEVLCKRAADAQSALRQLDAEQQELLSDLASLRAERVAHRQYGHNTDYESSGALIPIKNDSKAFSSTPASLDNVEHGQTGSELSAYDRLRETETHYNL--ANERLATAKQELQSMKAARQAEQREWSRERESLGQQLQNAMVDRANAL--------RELHALQANYSELEAS---ILNWERRL-YELKQWADDERVAKDKLHVFTCRVVSELEALRLACLGPEASLPAAEENMHYDYQPVCNGTNNVTNETVSFGMDSPAASITGDGTLDWRQRKSSKVNKMERSNLQVALNNEVRAREQAELRLQEVETKLKEVTDQLKLKETKIEEQERMLEAFNDQLLQVSNQASLSHVQNGVADDALSLSPHHVLNAEQTCRGTESRRSLPLLSLDNLQHSTPAHRSSLDN--SGSIAPSQHSSTSAHDFTLDSFTGPTKCRVCSSLILGQRFQGVRCQNCGFSCHQRCRHSV-----------------------------PMPKGGIIKRGWTRHYMFLTDMRLFVFDVTTENSVNGSFGSLSPSNPSFPWSRYPSPSNSVNNVSCVFTSNNPTRVVDLRSPGFSVTRVRDADVIHAKRNEIPRILKITLDNRLPAAPLFLLFDTSHLCDRWLKAIDDAARLIQRN--LRKI-PDAECIQLQDVCDSSALLLKQIRCACVLDEHRVLIGSDEGL-HVVDVKHGTIIRRGDKKPVFQIEALNE-ELQLVVVIQEKTRRLKLLLLATIEGISS-EQIKVADPKTCSQFVCGMS--------------------------RSNTVCLLCAAGRRSVWVYEIARVRSRHRRVREILFPDNVQAVSIVRGGNWLCVGCPSYFALYHIWSEGPAQALLRTDLVDLDPTFAFFQQNAFDAYMGIQVDDNEFLLIFENCGIYVNTSRQRTRTDNLMWPAKLISTSPFAFTWPYLYVFTEV-GLVVFNIT--SGLWVASLCGRQVRPLSSDAHL 1467          
BLAST of Serine/threonine kinase vs. Ensembl Cavefish
Match: cdc42bpaa (CDC42 binding protein kinase alpha (DMPK-like) a [Source:ZFIN;Acc:ZDB-GENE-120727-12])

HSP 1 Score: 672.929 bits (1735), Expect = 0.000e+0
Identity = 501/1604 (31.23%), Postives = 801/1604 (49.94%), Query Frame = 2
Query:  122 TLEFLIDSLFCTYYECRLPFHKDEKNVAQFIKSIKGTVDKIESLRIRRSDFDTIRVIGRGAFGKVSVVRFKEKGEIYAMKSLHKYDILKKIDAACFQEERDVLFQAMKIKSPWITRLHYAFQDEFYLYFVMDFYNGGDMLTLLSKFNDRLPEEITKFYIAEVVMSIDVVHKLGYLHRDIKPDNLLLDSLGHIVLADFGSCVKLRPNGTTITERAVGTPDYISPEILRSAE-GHGPYGVECDWWSLGIVIHEMLYGELPFYNEDFSETYWQIMNFETCFQIPTEYDDVSDEAEDLIKQLICKKECRLGNKGIDDFKNHPFFREIDWDNLRSYNAPFIPEVSSAEDTSNFEFDD--FNANHEGPPLS-SNFKGCHLPCIGFTFTKDFIFNE-----------------------MGSEESSVRLKSL-----------------MENIGAP-ALLNGNHN-ESNSDALLEEVNQLK---ITCSQLEKQLNECRT------NSVQRIFS------------HPVYQQLVTDKEKLLTQCQNYDYSLREKEQKMDDLIETNRLLNKERDELTSDRLQILQKKQDIEEDLKVMTENFNQLKSTNKAINRXXXXXXXXXXXXXXXXXXXXXXXXHLSIQKNQSQPDIQ-VEKQRFEEVMLQLRSENDQMLEKMRLKCSNLTNSLE--------QSDQTIFNIKEEIKSL--------KEIFTNKEKNLKLSHDNEIEQLKISV----AEEQSRILASNTQLKSQVKSLSEENVELRSSLQEISNKNMKFHFRLKTILD-KEIVKTSEN--SELLTELDREVELLKTL-CVDNDGDQKAQGERQDNNGNES----WRLRKCVKADKIEISNLNLTLQSERRARADLEKKLTQQKSEICDISKQLEKYKQDVNEKDNLIANLKSASQNLEPHVPKEIPSNPVTLSEFNSILSGSLDKTVVNCNQHVFSHSTFNRPIKCDYCTSHMLGQYYQGVKCKECSFSCHHYCLSNVLNDKCYTRKSAGKGA---NLKNGIGTMYENFIKVPKPGGIRRGWKRQFMALCDLKLFFFDVKEGSTGTQMPDISRNPCRVIDLKYTEFKVVKVSRDEVMHAPKKDVEFIIKISIENSST----MLPIYVLFESVDNKEDCIKVIEEARSYIKKDP-HYRMIFTEKSCLNNLDISMNYRQILSAAIIDQSTLLFGTEEGL--LKVTDSGYNKIGEKKPVYIIESLDQQELQLVAVIQSKQRVLKLLLSGILDGAHDWEPIIVENGKSCTTFVVGKSYVSPGNQFAPYADTMLANSTFHIKSPSNDRIWIMCAAFKNSVEVYHLNLKLTRHEKLRQILCNTSVTSLQIAGHGEQLLIGMHDSVAIYSLWETGSPXXXXXXXXXXXXXNFQYIFQTNFESMLIVEISFNEYLILFECAGIFINRNHRQTR-PDLQWPDKPTRFTYRAPYLLCFTEMAGLFAYEITEHSCNLVQALPLRSSKPLDRSGHILTTANEFIQAIDLIYVHLVSANEEKISIGKTIDKTSSSNTLSIFKFLNKRKPSYNKQEDSFDTNDAISPNPAGNSTKSTGLKYRDKPTLKSNRQISVPQNFRHLSHMGPDVPCQLI 4612
            ++E L+D L C + EC     + EKN+A+F++  K    K++ +R+ R DF+ ++VIGRGAFG+V+VV+ K   +++AMK L+K+++LK+ + ACF+EERDVL       S WIT LHYAFQD+ +LY VMD+Y GGD+LTLLSKF DRLPE++++FY+AE+V++ID VH+L Y+HRDIKPDN+LLD  GHI LADFGSC+KL  +GT  +  AVGTPDYISPEIL++ E G G YG ECDWWSLG+ ++EMLYGE PFY E   ETY +IMN +  FQ P +  +VS+ A+DLI++LIC +E RLG  GI DFK HPFF  IDWDN+R+ +AP+IPEVSS  DTSNF+ +D    ++   PP S + F G HLP +GFT+T   + +                        + +E    R++ L                 ++N+  P A  +G+ N E     L EE+  L+       QLE+ L +  T       S + I S               +++L+   EKL  Q +    +  +++  M +  E    ++++  +L S + ++ ++ +D EE++  + +    L+   +   R +  +E + ++   +  KEK+  +       Q + +++ V++++         SE  Q L K+R      T   E        Q    + N+++E++          KE+   K+K  K   +++ E+ +         E+ RIL     L  + K LS E   L +S +++S  N +    ++ + D KE V   E   +E++  +  E +    L  +     ++ +G R  + G  S    W++R+  K D      L   L +E RA+  ++ +L + K+     S    + K   +EK N   NL+     L+  +     S   +LS F+S+              H F   +FN P KC+ CTS M+G   QG  C+ C+FSCH  C ++     C   +   KG    + + GIGT+YE  ++VPKP G+++GW++    +CD KLF +D+ EG        +S    +VID++  +F V  V   +V+HA +KD+  I +++    S        I VL ES   K   + V+ E    +KK+    R ++  K   ++    +   Q  SAAIID   +  G EEGL  + VT     K+G+ K ++ I+ +  +  QL+AVI  + R ++L     LD   D +   +   K C T V G                          +  +  +  +C A K  V  Y LN   TRH +L+++     V  + +   G++L +G       Y+L   G P       L   D    +I Q   +++  VEIS  E L+ F   G++++   R++R  +L WP  PT   Y APYL  ++E A +  +++  ++   +Q +PL+   PL+  G +       ++ + LIY    +A  +++ + +T D   +S    +    +KR+ S+                P     +      RD P ++ N+ IS P NF H+ HMGP    Q++
Sbjct:   27 SVEALLDVLVCLFDECNNSPLRREKNIAEFLEWAKPFTSKVKQMRLHREDFEILKVIGRGAFGEVAVVKVKNSDKVFAMKILNKWEMLKRAETACFREERDVLVNG---DSQWITTLHYAFQDDNFLYLVMDYYVGGDLLTLLSKFEDRLPEDMSRFYLAEMVLAIDSVHQLHYVHRDIKPDNILLDVNGHIRLADFGSCLKLMEDGTVQSSVAVGTPDYISPEILQAMEDGKGKYGPECDWWSLGVCMYEMLYGETPFYAESLVETYGKIMNHKERFQFPVQITEVSENAKDLIRRLICSREHRLGQNGIHDFKQHPFFTGIDWDNIRNCDAPYIPEVSSPSDTSNFDVEDDCLKSSETMPPPSIAAFSGHHLPFVGFTYTSHILSDRGCLRESTAPVPMDVCVQRSLEESLATEAYERRIRRLEQEKLELSRKLQESTKTVQNLQYPSAEGSGSANREFEIRGLKEEIETLRKQIADSGQLEQHLEQASTAHRDFEESTKHIRSLEKQLKSIKQEKEDTHKELLQSGEKLKAQAKELKEADSQRKLAMHEFSE----MSEKMTDLRSQKQRLSRQLRDKEEEMDAVNQKLEALRLEIRKAERARKEMETQAEERAAEAQKEKKLRERSEQYSRQLEEELEGVKQKQVGRSPAAGASEQHQELSKLRADLEKKTLFYEEELSRRDVQHANELKNLRKELRDAEAQQVSLKKEVMMLKDKLDKTRRESQTEREEFETDYKQKYERERIL-----LTEENKKLSSELDNLTASYEKLSCSNKQLEEEMRELADKKESVAHWEAQITEIIQWVSDEKDARGYLQALATKMTEELEGLRNTSLGARSTDMPWKMRRLAKLDMSARLELQSALDAEIRAKQTIQDELNKVKA-----SNMATECKLQESEKKN--QNLQGEIDGLKRDMDDLRTSRGTSLS-FHSLPKA-----------HQFVVKSFNTPTKCNQCTSLMVGLIRQGCTCEVCNFSCHVTC-ADKAPAVCPIPQDQMKGPLGIDPQKGIGTVYEGQVRVPKPAGVKKGWQKAHAVVCDFKLFLYDLAEGKAAQPSVVVS----QVIDMRDEDFSVSSVLASDVIHANRKDIPCIFRVTASQLSASGNKKCSILVLAESDQEKNKWVTVLNELHRLLKKNKLKERFVYVPKEAYDSTLPLIKTTQ--SAAIIDHERIALGNEEGLYVIHVTKDEIIKVGDSKKIHHIDLIPSE--QLLAVISGRNRHVRLFPMAALDD-RDTDFYKLPETKGCQTLVSG--------------------------TIRHGALTCLCVAMKRQVICYELNKSKTRHRRLKELQVPGVVQWMYL--QGDKLCVGYQAGFLRYNLQGDGPP----ANLLHPEDHTLAFIGQLGLDALCAVEISSKELLLCFSSIGVYVDCQGRRSRQQELMWPAVPTACCYNAPYLSVYSETA-VDVFDV--NTMEWIQTIPLKKVHPLNTDGSLNLLG---LETVRLIYFKNKTAEGDELVVPETSD---NSRKQMVRSMTSKRRFSFRV--------------PEEERLQQRREMLRD-PEMR-NKLISNPTNFNHVVHMGPGDGIQIL 1532          
BLAST of Serine/threonine kinase vs. Ensembl Cavefish
Match: cdc42bpb (CDC42 binding protein kinase beta (DMPK-like) [Source:ZFIN;Acc:ZDB-GENE-030131-3647])

HSP 1 Score: 624.394 bits (1609), Expect = 0.000e+0
Identity = 480/1601 (29.98%), Postives = 778/1601 (48.59%), Query Frame = 2
Query:  242 IESLRIRRSDFDTIRVIGRGAFGKVSVVRFKEKGEIYAMKSLHKYDILKKIDAACFQEERDVLFQAMKIKSPWITRLHYAFQDEFYLYFVMDFYNGGDMLTLLSKFNDRLPEEITKFYIAEVVMSIDVVHKLGYLHRDIKPDNLLLDSLGHIVLADFGSCVKLRPNGTTITERAVGTPDYISPEILRSAE-GHGPYGVECDWWSLGIVIHEMLYGELPFYNEDFSETYWQIMNFETCFQIPTEYDDVSDEAEDLIKQLICKKECRLGNKGIDDFKNHPFFREIDWDNLRSYNAPFIPEVSSAEDTSNFEFDD--FNANHEGPPLS-SNFKGCHLPCIGFTFTKDFIFNEMG------------------SEESSVRLKS------------------LMENIGAPALLNGNHNESNS-------DALLEEVNQLKITCS---QLEKQLNECRT-------NSVQ-----------RIFSHPVYQQLVTDKEKLLTQCQNYDYSLREKEQKMDDLIETNRLLNKERDELTSDRLQILQKKQDIEEDLKVMTENFNQLKSTNKAINRXXXXXXXXXXXXXXXXXXXXXXXXHLSIQKNQSQPDIQVEKQRFEEVMLQLRSENDQMLEKM-----------------RLKC-----SNLTNSLEQSDQTIFNIKEEIKSLKEIFTNKEKNLKLSHDNEIEQLKISVAEEQSRILASNTQLKSQ-------VKSLSEENVELRSSLQEISNKNMKFHFRLKTILDKEIVKTSENSELLTELDREVELLKTLC--VDNDGDQKAQGERQDNNGNESWRLRKCVKADKIEISNLNLTLQSERRARA--------------DLEKKLTQQKSEICDISKQLEKYKQDVNE--------------KDNLIA--NLKSASQNLEPHVPKEIPSNPVTLSEFNSILSGSLDKTVVNCNQHVFSHSTFNRPIKCDYCTSHMLGQYYQGVKCKECSFSCHHYCLSNVLNDKCYTRKSAGK---GANLKNGIGTMYENFIKVPKPGGIRRGWKRQFMALCDLKLFFFDVKEGSTGTQMPDISRNPCRVIDLKYTEFKVVKVSRDEVMHAPKKDVEFIIKISIENSST---MLPIYVLFESVDNKEDCIKVIEEARSYIKKDP-HYRMIFTEKSCLNNLDISMNYRQILSAAIIDQSTLLFGTEEGL--LKVTDSGYNKIGEKKPVYIIESLDQQELQLVAVIQSKQRVLKLLLSGILDGAHDWEPIIVENGKSCTTFVVGKSYVSPGNQFAPYADTMLANSTFHIKSPSNDRIWIMCAAFKNSVEVYHLNLKLTRHEKLRQILCNTSVTSLQIAGHGEQLLIGMHDSVAIYSLWETGSPXXXXXXXXXXXXXNFQYIFQTNFESMLIVEISFNEYLILFECAGIFINRNHRQTRP-DLQWPDKPTRFTYRAPYLLCFTEMAGLFAYEITEHSCNLVQALPLRSSKPLDRSGHILTTANEFIQAIDLIYVHLVSANEEKISIGKTIDKTSS--SNTLSIFKFLNKRKPSYNKQEDSFDTNDAISPNPAGNSTKSTGLKYRDKPTLKSNRQISVPQNFRHLSHMGPDVPCQ-LIDL 4618
            ++ +R+ R DF+ ++VIGRGAFG+V+VV+ K    +YAMK L+K+++LK+ + ACF+EERDVL         WIT LHYAFQD+ YLY VMD+Y GGD+LTLLSKF DRLPE+++KFY+AE+V++I  +H+  Y+HRDIKPDN+LLD  GHI LADFGSC+++  +GT  +  AVGTPDYISPEIL++ E G G YG ECDWWSLG+ ++EMLYGE PFY E   ETY +IMN E  FQ P+   DVS++A+DLI++LIC +E RLG  GI +FK H FF  IDW+N+RS  AP+IP+VSS  DTSNF+ DD         PP+S + F G HLP +GFT+T +  F++ G                  SE+  ++L++                  L E+  A   L G+   + +         L EE+++LK   +   +LE QL E  T       +S +           R     +++QLV   E+L +Q +    + ++++  M +  E    LN+   EL S + ++ ++ +D EE++ V+ +  + ++   +   + +  LE +L+  + +  KE++  +H  +   Q + +++  K R         +E  Q L K+                 R  C      NL   L  S+    ++ +E+  LK+     ++  +   D  +  LK     E++ +   N +L S+       V  L+ +N +L   LQ++++K        +++   E  + +E  + +++       L+ L   +  + +          + +  W++R+  K D      L   L +E RA+                 E KL    S   D+ +QLE  K+D+ E              +D++    N    + +L   V       P  L  F  +              H  S  TF+ P +C +CTS M+G   QG  C+ CSF CH  C  N     C       K   G +++ GIGT Y+ F+++PKP G+++GW+R +  +CD KLF ++V EG + TQ   ++    +V+DL+  EF V  V   +V+HA +KDV  I +++    S+    + + VL ES   K   + ++E  +S + K+    R++       +N   ++  +  LSAAI+D+  +  GTEEGL  +++T     +  + K V+ I+ + ++  ++V ++  + R + L   G L+GA     + +   K C     G   + PG                    P+      + AA K  V  Y +      H K+ ++     V  L +    E+L +G     A+ +L    SP       +   D +  ++ Q   +++  +E+  NE L+ F   GI+++   R++R  +L WP  P   +  + YL  +++  G+  +++  H+   VQ + LR  +PL+  G +     E  +   LIY    SA  + ++I +T D +      T S  KFL K                     P     +      RD P ++S + IS P NF H++HMGP    Q L+DL
Sbjct:    2 VKEMRLHRDDFEMLKVIGRGAFGEVAVVKMKNTERVYAMKILNKWEMLKRAETACFREERDVLVNG---DCQWITTLHYAFQDDNYLYLVMDYYVGGDLLTLLSKFEDRLPEDMSKFYVAEMVLAIHSIHQQHYVHRDIKPDNVLLDMNGHIRLADFGSCLRMMQDGTVQSSVAVGTPDYISPEILQAMEDGMGKYGPECDWWSLGVCMYEMLYGETPFYAESLVETYGKIMNHEERFQFPSHITDVSEDAKDLIQRLICSRERRLGQNGIQEFKKHAFFTGIDWENIRSTEAPYIPDVSSPSDTSNFDVDDDVLKNPDIAPPMSHTGFTGQHLPFVGFTYTTESCFSDRGRLRLAALADGGLGEGLRSSEDGGLQLEAFERRIRSLEQEKQELNRKLQESTQAAQSLYGSGRGTGTLGRDKEIKKLNEEIDRLKKKLADSDRLEHQLEEAVTLRQDYESSSTKLKALDKQVKALRQEKEDIHKQLVESLERLKSQTKELKDAHQQRKLAMQEFSE----LNERMAELRSQKQRLSRQLRDKEEEMDVVMQKIDAMRQDFRKTEKARKELEAQLEDARAEASKERKLREHSEVYSKQLEGELETLKVRGSGRASGASAETQQELTKVKSELDKKVLFYEEELVRREACHSTELKNLRKELHDSESQQLSLHKELLVLKDKLEKAKRERQTEMDEAVGTLKDKYERERNLLTEENRKLTSETDRLCTFVDKLTAQNRQLEDELQDLASKK-------ESVAHWE-AQIAEIIQWVSDEKDARGYLQALASKMTEELESLRSSSLGSRHLDPLWKVRRSQKLDMSARLELQSALDAEIRAKQLVQEELRKVKAANISFESKLKDADSRNRDLEEQLEGMKKDLEESRSRTDRGLKLPDFQDSIFEYFNTSPLAHDLTFRVSVHHGEYPSILKHFGCLFP--------QPKAHQLSIKTFSSPTQCTHCTSLMVGLIRQGYACEVCSFICHVSCKDNA-PQVCPIPPEQAKRPLGIDVQRGIGTAYKGFVRIPKPTGVKKGWQRAYAVVCDCKLFLYEVPEGKS-TQPVVVA---SQVLDLRDEEFSVSSVLASDVIHATRKDVPCIFRVTSSTLSSPVRAVSLLVLAESEAEKRKWVGILEGLQSILAKNRLKNRVVHVLHEAYDNSLPAI--KTTLSAAIVDRERIALGTEEGLFVVEITRDIIVRAADCKKVHQIDLIPKE--KMVVLLCGRNRHVHLHPWGALEGAEAAFDVKLTETKGCQALTTG--VLRPGG-------------------PA-----CLLAAIKRQVLCYEITRAKPHHRKMWEVQAPGVVQWLGMV--RERLCVGYPSGFALLALQGESSP----VSLVSPGDPSLAFLAQQPLDALHAMEVGANELLLCFSQLGIYVDAQGRRSRTQELMWPATPLACSSNSTYLTVYSDY-GVDVFDV--HTTEWVQTISLRKIRPLNVEGSLNLLGTEQPR---LIYFSNNSAGYD-LAIPETSDNSKKLMVRTRSKRKFLFK--------------------VPEEERIQQRREMLRD-PEMRS-KLISNPTNFNHVAHMGPGDGMQVLMDL 1509          
BLAST of Serine/threonine kinase vs. Ensembl Cavefish
Match: cdc42bpb (CDC42 binding protein kinase beta (DMPK-like) [Source:ZFIN;Acc:ZDB-GENE-030131-3647])

HSP 1 Score: 616.69 bits (1589), Expect = 0.000e+0
Identity = 490/1630 (30.06%), Postives = 793/1630 (48.65%), Query Frame = 2
Query:  251 LRIRRSDFDTIRVIGRGAFGKVSVVRFKEKGEIYAMKSLHKYDILKKIDAACFQEERDVLFQAMKIKSPWITRLHYAFQDEFYLYFVMDFYNGGDMLTLLSKFNDRLPEEITKFYIAEVVMSIDVVHKLGYLHRDIKPDNLLLDSLGHIVLADFGSCVKLRPNGTTITERAVGTPDYISPEILRSAE-GHGPYGVECDWWSLGIVIHEMLYGELPFYNEDFSETYWQIMNFETCFQIPTEYDDVSDEAEDLIKQLICKKECRLGNKGIDDFKNHPFFREIDWDNLRSYNAPFIPEVSSAEDTSNFEFDD--FNANHEGPPLS-SNFKGCHLPCIGFTFTKDFIFNEMG------------------SEESSVRLKS------------------LMENIGAPALLNGNHNESNS-------DALLEEVNQLKITCS---QLEKQLNECRT-------NSVQ-----------RIFSHPVYQQLVTDKEKLLTQCQNYDYSLREKEQKMDDLIETNRLLNKERDELTSDRLQILQKKQDIEEDLKVMTENFNQLKSTNKAINRXXXXXXXXXXXXXXXXXXXXXXXXHLSIQKNQSQPDIQVEK---------QRFEEVMLQLRSENDQML----EKM--RLKC-----SNLTNSLEQSDQTIFNIKEEIKSLKEIFTNKEKNLKLSHDNEIEQLKISVAEEQSRILASNTQLKSQ-------VKSLSEENVELRSSLQEI-SNKNMKFHFRLKTILDKEIVKTSENSE--LLTELDREVELLKTLCVDNDGDQKAQGERQDNNGNES------------WRLRKCVKADKIEISNLNLTLQSERRARA--------------DLEKKLTQQKSEICDISKQLEKYKQDVNE--------------KDNLIA--NLKSASQNL--------------------EPHVPKEIPSNPVTLSEF--NSILSGSLDKTVVNCNQHVFSHSTFNRPIKCDYCTSHMLGQYYQGVKCKECSFSCHHYCLSNVLNDKCYTRKSAGK--GANLKNGIGTMYENFIKVPKPGGIRRGWKRQFMALCDLKLFFFDVKEGSTGTQMPDISRNPCRVIDLKYTEFKVVKVSRDEVMHAPKKDVEFIIKISIENSST---MLPIYVLFESVDNKEDCIKVIEEARSYIKKDP-HYRMIFTEKSCLNNLDISMNYRQILSAAIIDQSTLLFGTEEGL--LKVTDSGYNKIGEKKPVYIIESLDQQELQLVAVIQSKQRVLKLLLSGILDGAHDWEPIIVENGKSCTTFVVGKSYVSPGNQFAPYADTMLANSTFHIKSPSNDRIWIMCAAFKNSVEVYHLNLKLTRHEKLRQILCNTSVTSLQIAGHGEQLLIGMHDSVAIYSLWETGSPXXXXXXXXXXXXXNFQYIFQTNFESMLIVEISFNEYLILFECAGIFINRNHRQTRP-DLQWPDKPTRFTYRAPYLLCFTEMAGLFAYEITEHSCNLVQALPLRSSKPLDRSGHILTTANEFIQAIDLIYVHLVSANEEKISIGKTIDKTSS--SNTLSIFKFLNKRKPSYNKQEDSFDTNDAISPNPAGNSTKSTGLKYRDKPTLKSNRQISVPQNFRHLSHMGPDVPCQ-LIDL 4618
            +R+ R DF+ ++VIGRGAFG+V+VV+ K    +YAMK L+K+++LK+ + ACF+EERDVL         WIT LHYAFQD+ YLY VMD+Y GGD+LTLLSKF DRLPE+++KFY+AE+V++I  +H+  Y+HRDIKPDN+LLD  GHI LADFGSC+++  +GT  +  AVGTPDYISPEIL++ E G G YG ECDWWSLG+ ++EMLYGE PFY E   ETY +IMN E  FQ P+   DVS++A+DLI++LIC +E RLG  GI +FK H FF  IDW+N+RS  AP+IP+VSS  DTSNF+ DD         PP+S + F G HLP +GFT+T +  F++ G                  SE+  ++L++                  L E+  A   L G+   + +         L EE+++LK   +   +LE QL E  T       +S +           R     +++QLV   E+L +Q +    + ++++  M +  E    LN+   EL S + ++ ++ +D EE++ V+ +  + ++   +   + +  LE +L+  + +  KE++  +H  +   Q + +++  K            ++ + +++SE D+ +    E++  R  C      NL   L  S+    ++ +E+  LK+     ++  +   D  +  LK     E++ +   N +L S+       V  L+ +N +L   LQ++ S K    H+  +     + V   +++   L     +  E L++L   + G +  QG        +S            W++R+  K D      L   L +E RA+                 E KL    S   D+ +QLE  K+D+ E              +D++    N    + +L                    EP  P    + PV  S    +S+L+    K       H  S  TF+ P +C +CTS M+G   QG  C+ CSF CH  C  N         + A +  G +++ GIGT Y+ F+++PKP G+++GW+R +  +CD KLF ++V EG + TQ   ++    +V+DL+  EF V  V   +V+HA +KDV  I +++    S+    + + VL ES   K   + ++E  +S + K+    R++       +N   ++  +  LSAAI+D+  +  GTEEGL  +++T     +  + K V+ I+ + ++  ++V ++  + R + L   G L+GA     + +   K C     G   + PG                    P+      + AA K  V  Y +      H K+ ++     V  L +    E+L +G     A+ +L    SP       +   D +  ++ Q   +++  +E+  NE L+ F   GI+++   R++R  +L WP  P   +  + YL  +++  G+  +++  H+   VQ + LR  +PL+  G +     E  +   LIY    SA    ++I +T D +      T S  KFL K                     P     +      RD P ++S + IS P NF H++HMGP    Q L+DL
Sbjct:    1 MRLHRDDFEMLKVIGRGAFGEVAVVKMKNTERVYAMKILNKWEMLKRAETACFREERDVLVNG---DCQWITTLHYAFQDDNYLYLVMDYYVGGDLLTLLSKFEDRLPEDMSKFYVAEMVLAIHSIHQQHYVHRDIKPDNVLLDMNGHIRLADFGSCLRMMQDGTVQSSVAVGTPDYISPEILQAMEDGMGKYGPECDWWSLGVCMYEMLYGETPFYAESLVETYGKIMNHEERFQFPSHITDVSEDAKDLIQRLICSRERRLGQNGIQEFKKHAFFTGIDWENIRSTEAPYIPDVSSPSDTSNFDVDDDVLKNPDIAPPMSHTGFTGQHLPFVGFTYTTESCFSDRGRLRLAALADGGLGEGLRSSEDGGLQLEAFERRIRSLEQEKQELNRKLQESTQAAQSLYGSGRGTGTLGRDKEIKKLNEEIDRLKKKLADSDRLEHQLEEAVTLRQDYESSSTKLKALDKQVKALRQEKEDIHKQLVESLERLKSQTKELKDAHQQRKLAMQEFSE----LNERMAELRSQKQRLSRQLRDKEEEMDVVMQKIDAMRQDFRKTEKARKELEAQLEDARAEASKERKLREHSEVYSKQLEGELETLKGSGRASGASAETQQELTKVKSELDKKVLFYEEELVRREACHSTELKNLRKELHDSESQQLSLHKELLVLKDKLEKAKRERQTEMDEAVGTLKDKYERERNLLTEENRKLTSETDRLCTFVDKLTAQNRQLEDELQDLASKKESVAHWEAQIAEIIQWVSDEKDARGYLQALASKMTEELESLRSSSLGSRHLQGSGMSTPTQKSLVAFRSTKRDPLWKVRRSQKLDMSARLELQSALDAEIRAKQLVQEELRKVKAANISFESKLKDADSRNRDLEEQLEGMKKDLEESRSRTDRGLKLPDFQDSIFEYFNTSPLAHDLTFRDSVSSSSASSLLAFWDEEPAKPP--ATTPVAPSPVYQSSLLTEPKPKA------HQLSIKTFSSPTQCTHCTSLMVGLIRQGYACEVCSFICHVSCKDNAPQVCPIPPEQAKRPLGIDVQRGIGTAYKGFVRIPKPTGVKKGWQRAYAVVCDCKLFLYEVPEGKS-TQPVVVA---SQVLDLRDEEFSVSSVLASDVIHATRKDVPCIFRVTSSTLSSPVRAVSLLVLAESEAEKRKWVGILEGLQSILAKNRLKNRVVHVLHEAYDNSLPAI--KTTLSAAIVDRERIALGTEEGLFVVEITRDIIVRAADCKKVHQIDLIPKE--KMVVLLCGRNRHVHLHPWGALEGAEAAFDVKLTETKGCQALTTG--VLRPGG-------------------PA-----CLLAAIKRQVLCYEITRAKPHHRKMWEVQAPGVVQWLGMV--RERLCVGYPSGFALLALQGESSP----VSLVSPGDPSLAFLAQQPLDALHAMEVGANELLLCFSQLGIYVDAQGRRSRTQELMWPATPLACSSNSTYLTVYSDY-GVDVFDV--HTTEWVQTISLRKIRPLNVEGSLNLLGTEQPR---LIYFSNNSAEGYDLAIPETSDNSKKLMVRTRSKRKFLFK--------------------VPEEERIQQRREMLRD-PEMRS-KLISNPTNFNHVAHMGPGDGMQVLMDL 1547          
BLAST of Serine/threonine kinase vs. Ensembl Cavefish
Match: cdc42bpb (CDC42 binding protein kinase beta (DMPK-like) [Source:ZFIN;Acc:ZDB-GENE-030131-3647])

HSP 1 Score: 446.047 bits (1146), Expect = 5.003e-129
Identity = 293/800 (36.62%), Postives = 439/800 (54.87%), Query Frame = 2
Query:  251 LRIRRSDFDTIRVIGRGAFGKVSVVRFKEKGEIYAMKSLHKYDILKKIDAACFQEERDVLFQAMKIKSPWITRLHYAFQDEFYLYFVMDFYNGGDMLTLLSKFNDRLPEEITKFYIAEVVMSIDVVHKLGYLHRDIKPDNLLLDSLGHIVLADFGSCVKLRPNGTTITERAVGTPDYISPEILRSAE-GHGPYGVECDWWSLGIVIHEMLYGELPFYNEDFSETYWQIMNFETCFQIPTEYDDVSDEAEDLIKQLICKKECRLGNKGIDDFKNHPFFREIDWDNLRSYNAPFIPEVSSAEDTSNFEFDD--FNANHEGPPLS-SNFKGCHLPCIGFTFTKDFIFNEMGSEESSVRLKSLMENIGAPALLNGNHNESNSDALLEEVNQLKITCSQLEKQLNECRTNSVQRIF-SHPVYQQLVTDKE--KLLTQCQNYDYSLREKEQKMDDLIETNRLLNKERDELTSDRLQILQK-----KQDIEEDLKVMTENFNQLKSTNKAINRXXXXXXXXXXXXXXXXXXXXXXXXHLSIQKNQSQPDIQVEKQRFEEVMLQLRSENDQMLEKMRLKCSNLTNSLEQSDQTIFNIKEEIKSLKEIFTNKEKNLKLSHDNEIEQLKISVAEEQSRILASNTQLKSQVKSL------SEENVELRSSLQEI-SNKNMKFHFRLKTILDKEIVKTSENSELLTEL----DREVELLKTLCVDNDGDQKAQGERQDNNGNESWRLRKCVKADKIEISNLNLTLQSERRARADLEKKLTQQKSEICDISKQLEKYKQDVNEKDNLIANLKS 2581
            +R+ R DF+ ++VIGRGAFG+V+VV+ K    +YAMK L+K+++LK+ + ACF+EERDVL         WIT LHYAFQD+ YLY VMD+Y GGD+LTLLSKF DRLPE+++KFY+AE+V++I  +H+  Y+HRDIKPDN+LLD  GHI LADFGSC+++  +GT  +  AVGTPDYISPEIL++ E G G YG ECDWWSLG+ ++EMLYGE PFY E   ETY +IMN E  FQ P+   DVS++A+DLI++LIC +E RLG  GI +FK H FF  IDW+N+RS  AP+IP+VSS  DTSNF+ DD         PP+S + F G HLP +GFT+T +  F++ G     +RL +L +      L +        +A    +  L+    +L ++L E  T + Q ++ S      L  DKE  KL  +       L + ++    L E   L  ++  E +S +L+ L K     +Q+ E+  K + E+  +LKS  K +                    +  + + L++Q          E     E M +LRS+  ++  ++R K   +   +++ D    + ++  K+ KE+    E       D   E  K     E S + +   QL+ ++++L      S  + E +  L ++ S  + K  F  + ++ +E   ++E   L  EL     +++ L K L V  D  +KA+ ERQ         L+   + ++  ++  N  L SE         KLT Q       ++QLE   QD+  K   +A+ ++
Sbjct:    1 MRLHRDDFEMLKVIGRGAFGEVAVVKMKNTERVYAMKILNKWEMLKRAETACFREERDVLVNG---DCQWITTLHYAFQDDNYLYLVMDYYVGGDLLTLLSKFEDRLPEDMSKFYVAEMVLAIHSIHQQHYVHRDIKPDNVLLDMNGHIRLADFGSCLRMMQDGTVQSSVAVGTPDYISPEILQAMEDGMGKYGPECDWWSLGVCMYEMLYGETPFYAESLVETYGKIMNHEERFQFPSHITDVSEDAKDLIQRLICSRERRLGQNGIQEFKKHAFFTGIDWENIRSTEAPYIPDVSSPSDTSNFDVDDDVLKNPDIAPPMSHTGFTGQHLPFVGFTYTTESCFSDRG----RLRLAALADGGLGEGLRSSEDGGLQLEAFERRIRSLEQEKQELNRKLQES-TQAAQSLYGSGRGTGTLGRDKEIKKLNEEIDRLKKKLADSDRLEHQLEEAVTL--RQDYESSSTKLKALDKQVKALRQEKEDIHKQLVESLERLKSQTKELK-------------------DAHQQRKLAMQ----------EFSELNERMAELRSQKQRLSRQLRDKEEEMDVVMQKIDAMRQDFRKTEKARKELEAQLE-------DARAEASKERKLREHSEVYSK--QLEGELETLKGSGRASGASAETQQELTKVKSELDKKVLFYEEELVRREACHSTELKNLRKELHDSESQQLSLHKELLVLKDKLEKAKRERQTEMDEAVGTLKDKYERERNLLTEENRKLTSETDRLCTFVDKLTAQ-------NRQLEDELQDLASKKESVAHWEA 745          

HSP 2 Score: 207.994 bits (528), Expect = 2.073e-53
Identity = 176/651 (27.04%), Postives = 301/651 (46.24%), Query Frame = 2
Query: 2702 HVFSHSTFNRPIKCDYCTSHMLGQYYQGVKCKECSFSCHHYCLSNVLNDKCYTRKSAGK--GANLKNGIGTMYENFIKVPKPGGIRRGWKRQFMALCDLKLFFFDVKEGSTGTQMPDISRNPCRVIDLKYTEFKVVKVSRDEVMHAPKKDVEFIIKISIENSST---MLPIYVLFESVDNKEDCIKVIEEARSYIKKDP-HYRMIFTEKSCLNNLDISMNYRQILSAAIIDQSTLLFGTEEGL--LKVTDSGYNKIGEKKPVYIIESLDQQELQLVAVIQSKQRVLKLLLSGILDGAHDWEPIIVENGKSCTTFVVGKSYVSPGNQFAPYADTMLANSTFHIKSPSNDRIWIMCAAFKNSVEVYHLNLKLTRHEKLRQILCNTSVTSLQIAGHGEQLLIGMHDSVAIYSLWETGSPXXXXXXXXXXXXXNFQYIFQTNFESMLIVEISFNEYLILFECAGIFINRNHRQTRP-DLQWPDKPTRFTYRAPYLLCFTEMAGLFAYEITEHSCNLVQALPLRSSKPLDRSGHILTTANEFIQAIDLIYVHLVSANEEKISIGKTIDKTSS--SNTLSIFKFLNKRKPSYNKQEDSFDTNDAISPNPAGNSTKSTGLKYRDKPTLKSNRQISVPQNFRHLSHMGPDVPCQ-LIDL 4618
            H  S  TF+ P +C +CTS M+G   QG  C+ CSF CH  C  N         + A +  G +++ GIGT Y+ F+++PKP G+++GW+R +  +CD KLF ++V EG + TQ   ++    +V+DL+  EF V  V   +V+HA +KDV  I +++    S+    + + VL ES   K   + ++E  +S + K+    R++       +N   ++  +  LSAAI+D+  +  GTEEGL  +++T     +  + K V+ I+ + ++  ++V ++  + R + L   G L+GA     + +   K C     G   + PG                    P+      + AA K  V  Y +      H K+ ++     V  L +    E+L +G     A+ +L    SP       +   D +  ++ Q   +++  +E+  NE L+ F   GI+++   R++R  +L WP  P   +  + YL  +++  G+  +++  H+   VQ + LR  +PL+  G +     E  +   LIY    SA    ++I +T D +      T S  KFL K                     P     +      RD P ++S + IS P NF H++HMGP    Q L+DL
Sbjct:  955 HQLSIKTFSSPTQCTHCTSLMVGLIRQGYACEVCSFICHVSCKDNAPQVCPIPPEQAKRPLGIDVQRGIGTAYKGFVRIPKPTGVKKGWQRAYAVVCDCKLFLYEVPEGKS-TQPVVVA---SQVLDLRDEEFSVSSVLASDVIHATRKDVPCIFRVTSSTLSSPVRAVSLLVLAESEAEKRKWVGILEGLQSILAKNRLKNRVVHVLHEAYDNSLPAI--KTTLSAAIVDRERIALGTEEGLFVVEITRDIIVRAADCKKVHQIDLIPKE--KMVVLLCGRNRHVHLHPWGALEGAEAAFDVKLTETKGCQALTTG--VLRPGG-------------------PA-----CLLAAIKRQVLCYEITRAKPHHRKMWEVQAPGVVQWLGMV--RERLCVGYPSGFALLALQGESSP----VSLVSPGDPSLAFLAQQPLDALHAMEVGANELLLCFSQLGIYVDAQGRRSRTQELMWPATPLACSSNSTYLTVYSDY-GVDVFDV--HTTEWVQTISLRKIRPLNVEGSLNLLGTEQPR---LIYFSNNSAEGYDLAIPETSDNSKKLMVRTRSKRKFLFK--------------------VPEEERIQQRREMLRD-PEMRS-KLISNPTNFNHVAHMGPGDGMQVLMDL 1537          
BLAST of Serine/threonine kinase vs. Ensembl Cavefish
Match: cdc42bpb (CDC42 binding protein kinase beta (DMPK-like) [Source:ZFIN;Acc:ZDB-GENE-030131-3647])

HSP 1 Score: 446.047 bits (1146), Expect = 6.313e-129
Identity = 292/798 (36.59%), Postives = 437/798 (54.76%), Query Frame = 2
Query:  251 LRIRRSDFDTIRVIGRGAFGKVSVVRFKEKGEIYAMKSLHKYDILKKIDAACFQEERDVLFQAMKIKSPWITRLHYAFQDEFYLYFVMDFYNGGDMLTLLSKFNDRLPEEITKFYIAEVVMSIDVVHKLGYLHRDIKPDNLLLDSLGHIVLADFGSCVKLRPNGTTITERAVGTPDYISPEILRSAE-GHGPYGVECDWWSLGIVIHEMLYGELPFYNEDFSETYWQIMNFETCFQIPTEYDDVSDEAEDLIKQLICKKECRLGNKGIDDFKNHPFFREIDWDNLRSYNAPFIPEVSSAEDTSNFEFDD--FNANHEGPPLS-SNFKGCHLPCIGFTFTKDFIFNEMGSEESSVRLKSLMENIGAPALLNGNHNESNSDALLEEVNQLKITCSQLEKQLNECRTNSVQRIF-SHPVYQQLVTDKE--KLLTQCQNYDYSLREKEQKMDDLIETNRLLNKERDELTSDRLQILQK-----KQDIEEDLKVMTENFNQLKSTNKAINRXXXXXXXXXXXXXXXXXXXXXXXXHLSIQKNQSQPDIQVEKQRFEEVMLQLRSENDQMLEKMRLKCSNLTNSLEQSDQTIFNIKEEIKSLKEIFTNKEKNLKLSHDNEIEQLKISVAEEQSRILASNTQLKSQVKSL------SEENVELRSSLQEI-SNKNMKFHFRLKTILDKEIVKTSENSELLTEL----DREVELLKTLCVDNDGDQKAQGERQDNNGNESWRLRKCVKADKIEISNLNLTLQSERRARADLEKKLTQQKSEICDISKQLEKYKQDVNEKDNLIANL 2575
            +R+ R DF+ ++VIGRGAFG+V+VV+ K    +YAMK L+K+++LK+ + ACF+EERDVL         WIT LHYAFQD+ YLY VMD+Y GGD+LTLLSKF DRLPE+++KFY+AE+V++I  +H+  Y+HRDIKPDN+LLD  GHI LADFGSC+++  +GT  +  AVGTPDYISPEIL++ E G G YG ECDWWSLG+ ++EMLYGE PFY E   ETY +IMN E  FQ P+   DVS++A+DLI++LIC +E RLG  GI +FK H FF  IDW+N+RS  AP+IP+VSS  DTSNF+ DD         PP+S + F G HLP +GFT+T +  F++ G     +RL +L +      L +        +A    +  L+    +L ++L E  T + Q ++ S      L  DKE  KL  +       L + ++    L E   L  ++  E +S +L+ L K     +Q+ E+  K + E+  +LKS  K +                    +  + + L++Q          E     E M +LRS+  ++  ++R K   +   +++ D    + ++  K+ KE+    E       D   E  K     E S + +   QL+ ++++L      S  + E +  L ++ S  + K  F  + ++ +E   ++E   L  EL     +++ L K L V  D  +KA+ ERQ         L+   + ++  ++  N  L SE         KLT Q  ++ D  + L   K+ V   +  IA +
Sbjct:    1 MRLHRDDFEMLKVIGRGAFGEVAVVKMKNTERVYAMKILNKWEMLKRAETACFREERDVLVNG---DCQWITTLHYAFQDDNYLYLVMDYYVGGDLLTLLSKFEDRLPEDMSKFYVAEMVLAIHSIHQQHYVHRDIKPDNVLLDMNGHIRLADFGSCLRMMQDGTVQSSVAVGTPDYISPEILQAMEDGMGKYGPECDWWSLGVCMYEMLYGETPFYAESLVETYGKIMNHEERFQFPSHITDVSEDAKDLIQRLICSRERRLGQNGIQEFKKHAFFTGIDWENIRSTEAPYIPDVSSPSDTSNFDVDDDVLKNPDIAPPMSHTGFTGQHLPFVGFTYTTESCFSDRG----RLRLAALADGGLGEGLRSSEDGGLQLEAFERRIRSLEQEKQELNRKLQES-TQAAQSLYGSGRGTGTLGRDKEIKKLNEEIDRLKKKLADSDRLEHQLEEAVTL--RQDYESSSTKLKALDKQVKALRQEKEDIHKQLVESLERLKSQTKELK-------------------DAHQQRKLAMQ----------EFSELNERMAELRSQKQRLSRQLRDKEEEMDVVMQKIDAMRQDFRKTEKARKELEAQLE-------DARAEASKERKLREHSEVYSK--QLEGELETLKGSGRASGASAETQQELTKVKSELDKKVLFYEEELVRREACHSTELKNLRKELHDSESQQLSLHKELLVLKDKLEKAKRERQTEMDEAVGTLKDKYERERNLLTEENRKLTSETDRLCTFVDKLTAQNRQLEDELQDLASKKESVAHWEAQIAEI 750          

HSP 2 Score: 207.994 bits (528), Expect = 2.583e-53
Identity = 177/652 (27.15%), Postives = 300/652 (46.01%), Query Frame = 2
Query: 2702 HVFSHSTFNRPIKCDYCTSHMLGQYYQGVKCKECSFSCHHYCLSNVLNDKCYTRKSAGK---GANLKNGIGTMYENFIKVPKPGGIRRGWKRQFMALCDLKLFFFDVKEGSTGTQMPDISRNPCRVIDLKYTEFKVVKVSRDEVMHAPKKDVEFIIKISIENSST---MLPIYVLFESVDNKEDCIKVIEEARSYIKKDP-HYRMIFTEKSCLNNLDISMNYRQILSAAIIDQSTLLFGTEEGL--LKVTDSGYNKIGEKKPVYIIESLDQQELQLVAVIQSKQRVLKLLLSGILDGAHDWEPIIVENGKSCTTFVVGKSYVSPGNQFAPYADTMLANSTFHIKSPSNDRIWIMCAAFKNSVEVYHLNLKLTRHEKLRQILCNTSVTSLQIAGHGEQLLIGMHDSVAIYSLWETGSPXXXXXXXXXXXXXNFQYIFQTNFESMLIVEISFNEYLILFECAGIFINRNHRQTRP-DLQWPDKPTRFTYRAPYLLCFTEMAGLFAYEITEHSCNLVQALPLRSSKPLDRSGHILTTANEFIQAIDLIYVHLVSANEEKISIGKTIDKTSS--SNTLSIFKFLNKRKPSYNKQEDSFDTNDAISPNPAGNSTKSTGLKYRDKPTLKSNRQISVPQNFRHLSHMGPDVPCQ-LIDL 4618
            H  S  TF+ P +C +CTS M+G   QG  C+ CSF CH  C  N     C       K   G +++ GIGT Y+ F+++PKP G+++GW+R +  +CD KLF ++V EG + TQ   ++    +V+DL+  EF V  V   +V+HA +KDV  I +++    S+    + + VL ES   K   + ++E  +S + K+    R++       +N   ++  +  LSAAI+D+  +  GTEEGL  +++T     +  + K V+ I+ + ++  ++V ++  + R + L   G L+GA     + +   K C     G   + PG                    P+      + AA K  V  Y +      H K+ ++     V  L +    E+L +G     A+ +L    SP       +   D +  ++ Q   +++  +E+  NE L+ F   GI+++   R++R  +L WP  P   +  + YL  +++  G+  +++  H+   VQ + LR  +PL+  G +     E  +   LIY    SA    ++I +T D +      T S  KFL K                     P     +      RD P ++S + IS P NF H++HMGP    Q L+DL
Sbjct:  976 HQLSIKTFSSPTQCTHCTSLMVGLIRQGYACEVCSFICHVSCKDNA-PQVCPIPPEQAKRPLGIDVQRGIGTAYKGFVRIPKPTGVKKGWQRAYAVVCDCKLFLYEVPEGKS-TQPVVVA---SQVLDLRDEEFSVSSVLASDVIHATRKDVPCIFRVTSSTLSSPVRAVSLLVLAESEAEKRKWVGILEGLQSILAKNRLKNRVVHVLHEAYDNSLPAI--KTTLSAAIVDRERIALGTEEGLFVVEITRDIIVRAADCKKVHQIDLIPKE--KMVVLLCGRNRHVHLHPWGALEGAEAAFDVKLTETKGCQALTTG--VLRPGG-------------------PA-----CLLAAIKRQVLCYEITRAKPHHRKMWEVQAPGVVQWLGMV--RERLCVGYPSGFALLALQGESSP----VSLVSPGDPSLAFLAQQPLDALHAMEVGANELLLCFSQLGIYVDAQGRRSRTQELMWPATPLACSSNSTYLTVYSDY-GVDVFDV--HTTEWVQTISLRKIRPLNVEGSLNLLGTEQPR---LIYFSNNSAEGYDLAIPETSDNSKKLMVRTRSKRKFLFK--------------------VPEEERIQQRREMLRD-PEMRS-KLISNPTNFNHVAHMGPGDGMQVLMDL 1558          
BLAST of Serine/threonine kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004595.1 (pep scaffold:Pmarinus_7.0:GL477044:11103:63873:-1 gene:ENSPMAG00000004137.1 transcript:ENSPMAT00000004595.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 372.089 bits (954), Expect = 2.553e-106
Identity = 206/543 (37.94%), Postives = 316/543 (58.20%), Query Frame = 2
Query:  134 LIDSLFCTYYECRLPFHKDEKNVAQFIKSIKGTVDKIESLRIRRSDFDTIRVIGRGAFGKVSVVRFKEKGEIYAMKSLHKYDILKKIDAACFQEERDVLFQAMKIKSPWITRLHYAFQDEFYLYFVMDFYNGGDMLTLLSKFNDRLPEEITKFYIAEVVMSIDVVHKLGYLHRDIKPDNLLLDSLGHIVLADFGSCVKLRPNGTTITERAVGTPDYISPEILRSAEGHGPYGVECDWWSLGIVIHEMLYGELPFYNEDFSETYWQIMNFETCFQIPTEYDDVSDEAEDLIKQLICKKECRLGNKGIDDFKNHPFFR--EIDWDNLRSYNAPFIPEVSSAEDTSNF-EFDDFNANHEGPPLSSNFKGCHLPCIGFTFTKDFIFNEMGSEESSVRLKSLMENIGAPALLNGNHNESNSDALLEEVNQLKITCSQLEKQL-----------NECRTNSVQRIFSHPVYQQLVTDKEKLLTQCQNYDYSLREKEQKMDDLIETNRLLNKERDELTSDRLQILQKKQDIEEDLKVMTENFNQLKSTNK 1720
            L D L+    +   P  +  KNV  F++     V K+  LR+R  D+D+++VIGRGAFG+V +VR K    +YAMK L+K +++K+ D+A F EERD++  A    SPWI +L Y+FQD+ YLY VM++  GGD++ L+S ++  +PE+  +FY AEVV+++D +H +GY+HRD+KPDN+LLD  GH+ LADFG+C+KL  +G    + AVGTPDYISPE+LRS  G G YG ECDWWS+G+ + EML G+ PFY E    TY +IM+ +     P +  D+S  A+ LI   + +++ RLG  G  + K H FF+  +  W+N+R  +AP +PE+SS  DTSNF E ++  +  E  P    F G  LP +GFT+ KD             +L S     G PA+  GN+ E    + +E  +++KI    LE+Q+            +CR N+  R+      ++L+ D E+     +N +  LR+ E+    L++   +  + R +  SD      KK+ ++ ++  + E   +LK  N+
Sbjct:    1 LQDGLYALVLDLDFPALRKNKNVESFLQRYGEAVGKVRDLRMRADDYDSVKVIGRGAFGEVQLVRHKVTKSVYAMKLLNKLEMIKRSDSAFFWEERDIMAFA---NSPWIVQLFYSFQDDRYLYMVMEYMPGGDLVNLMSNYD--VPEKWARFYTAEVVLAVDAIHSMGYIHRDVKPDNMLLDKSGHLKLADFGTCMKLNKDGMVRCDTAVGTPDYISPEVLRSQGGQGYYGRECDWWSVGVFLFEMLVGDTPFYAESLVGTYGKIMDHKKSLTFPVDL-DISKNAKSLICAFLTERDVRLGKNGFAEIKCHDFFKNDQWTWENIRETSAPVVPELSSDTDTSNFDEIENDKSADETFPQPKAFVGNQLPFVGFTYYKDH------------QLLS-----GVPAVA-GNNEEPLKSSQVEISHKMKI--EMLERQMKNAVQVKDEAEQKCR-NANSRL------EKLLKDLEEECVSRKNLEAQLRQMERD-KALVQHKMVEQQRRADAESD------KKRHLDGEVNSLKEQLEELKKKNQ 503          
BLAST of Serine/threonine kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003561.1 (pep scaffold:Pmarinus_7.0:GL478057:5187:43749:1 gene:ENSPMAG00000003167.1 transcript:ENSPMAT00000003561.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 368.622 bits (945), Expect = 4.196e-105
Identity = 174/407 (42.75%), Postives = 260/407 (63.88%), Query Frame = 2
Query:  194 KNVAQFIKSIKGTVDKIESLRIRRSDFDTIRVIGRGAFGKVSVVRFKEKGEIYAMKSLHKYDILKKIDAACFQEERDVLFQAMKIKSPWITRLHYAFQDEFYLYFVMDFYNGGDMLTLLSKFNDRLPEEITKFYIAEVVMSIDVVHKLGYLHRDIKPDNLLLDSLGHIVLADFGSCVKLRPNGTTITERAVGTPDYISPEILRSAEGHGPYGVECDWWSLGIVIHEMLYGELPFYNEDFSETYWQIMNFETCFQIPTEYDDVSDEAEDLIKQLICKKECRLGNKGIDDFKNHPFFR--EIDWDNLRSYNAPFIPEVSSAEDTSNF-EFDDFNANHEGPPLSSNFKGCHLPCIGFTFTKDF-IFNEMGSEESSVRLKSLMENIGAPALLNGNHNESNSDALLEEVNQL 1402
            KN+  F+   +  V K+  LR+R +D+D ++VIGRGAFG+V +VR K   ++YAMK L K+++ K+ D+A F EERD++  A    SPW+ +L YAFQD  YLY VM++  GGD++ L+S ++  +PE+  +FY AEVV+++D +H +G++HRD+KPDN+LLD  GH+ LADFG+C+K+   G    + AVGTPDYISPE+L+S  G G YG ECDWWS+G+ ++EML G+ PFY +    TY +IM+ +     P +  D+S +A++LI   +  +E R+G  G+ + K HPFF+  +  W+N+R   AP +PE+ S  DTSNF E ++  A  E  P+   F G  LP +GFT+  D+ +F+  G+E +              AL+N     S  D L ++V QL
Sbjct:   50 KNIDNFLNRYEKAVGKVRDLRMRANDYDVVKVIGRGAFGEVQLVRHKATKKVYAMKLLSKFEMTKRSDSAFFWEERDIMAFA---NSPWVVQLFYAFQDHRYLYMVMEYMPGGDLVNLMSNYD--VPEKWARFYTAEVVLALDAIHSMGFIHRDVKPDNMLLDKNGHLKLADFGTCMKMDTEGMVRCDTAVGTPDYISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMDHKNALNFPDDV-DISKDAKNLICAFLIDREVRVGRNGVGEIKRHPFFKNDQWTWENIRETAAPVVPELVSDTDTSNFDEIEEDKAEDETFPVPKAFSGNQLPFVGFTYYSDYQLFSVNGTEVNR-------------ALMNQPRQSSVVDKLHQKVYQL 437          
BLAST of Serine/threonine kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006413.1 (pep scaffold:Pmarinus_7.0:GL485553:3974:11158:-1 gene:ENSPMAG00000005799.1 transcript:ENSPMAT00000006413.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 289.656 bits (740), Expect = 6.492e-88
Identity = 154/347 (44.38%), Postives = 217/347 (62.54%), Query Frame = 2
Query:  230 TVDKIESLRIRRSDFDTIRVIGRGAFGKVSVVRFKEKGEIYAMKSLHKYDILKKIDAACFQEERDVLFQAMKIKSPWITRLHYAFQDEFYLYFVMDFYNGGDMLTLLSKFNDRLPEEITKFYIAEVVMSIDVVHKLGYLHRDIKPDNLLLDSLGHIVLADFGSCVKLRPNGTTITERAVGTPDYISPEILRSAEGHGPYGVECDWWSLGIVIHEMLYGELPFYNEDFSETYWQIMNFETCFQIPTEYDDVSDEAEDLIKQLICKKECRLGNKGIDDFKNHPFFR--EIDWDNLRSYNAPFIPEVSSAEDTSNFEFDDFN----ANHEGPPLSSNFKGCHLPCIGFTF 1252
             V K+  LR+   DF+ ++VIGRGAFG V +VR K+   ++AMK L+K ++LK+ D+A F EERD++  A    S WI +L  AFQDE YLY VM++  GGD+++L+S ++  +PE+  +FY AEVV+++D +H +G++HRDIKPDN+LLD LGH+ LADFG+C+K+   G   +  AVGTPDYISPE+L+S  G G YG+  +   +G  +     G+ PFY E    TY +IM+       P +   VS EA  LI   +  +E RLG  G+D+ K HPFFR  +  W N+R   AP +PE++S  D S   FDD +    A  E   +   F G  LP IGFT+
Sbjct:    3 AVGKVHDLRMNVHDFELLKVIGRGAFGVVQLVRHKQTRRVHAMKRLNKGEMLKRSDSAFFWEERDIMAFA---NSSWIIQLFSAFQDERYLYMVMEYMPGGDLVSLMSNYD--VPEKWARFYTAEVVLALDAIHSMGFIHRDIKPDNMLLDRLGHLKLADFGTCMKMDAEGMVRSNTAVGTPDYISPEVLKSQGGDGYYGLH-EPPEIGNHLVAAHAGDTPFYAESLVGTYSKIMDHRNSLCFPDDA-SVSKEARSLICAFLTDREVRLGRTGVDEIKRHPFFRNDQWTWQNIRETVAPVVPELASDADASC--FDDISEQEKAEEEAFSVPKAFLGNQLPFIGFTY 340          
BLAST of Serine/threonine kinase vs. Ensembl Sea Lamprey
Match: stk38l (serine/threonine kinase 38 like [Source:ZFIN;Acc:ZDB-GENE-040426-798])

HSP 1 Score: 239.58 bits (610), Expect = 3.530e-70
Identity = 128/320 (40.00%), Postives = 183/320 (57.19%), Query Frame = 2
Query:  314 VSVVRFKEKGEIYAMKSLHKYDILKKIDAACFQEERDVLFQAMKIKSPWITRLHYAFQDEFYLYFVMDFYNGGDMLTLLSKFNDRLPEEITKFYIAEVVMSIDVVHKLGYLHRDIKPDNLLLDSLGHIVLADFGSCVKL------------------------------------RPNGTTITERAVGTPDYISPEILRSAEGHGPYGVECDWWSLGIVIHEMLYGELPFYNEDFSETYWQIMNFETCFQIPTEYDDVSDEAEDLIKQLICKKECRLGNKGIDDFKNHPFFREIDWDNLRSYNAPFIPEVSSAEDTSNFE 1165
            V +V+ K+ G IYAMK L K D+L+K   A  + ERD+L +A  +   W+ ++ Y+FQD   LY +M+F  GGDM+TLL K  D L EE T+FYIAE +++ID +H+LG++HRDIKPDNLLLDS GH+ L+DFG C  L                                    + N   +    VGTPDYI+PE+         Y   CDWWSLG+++ EML G  PF +E   ETY ++M++      P E   +S+++ DLI +  C+ E R+G  G+++ K H FF  +DW+++R   A    E+ S +DTSNF+
Sbjct:    1 VRLVQKKDTGHIYAMKVLRKADMLEKEQVAHIRAERDILVEADNL---WVVKMFYSFQDPKNLYLIMEFLPGGDMMTLLMK-KDTLTEEETQFYIAESILAIDSIHQLGFIHRDIKPDNLLLDSKGHVKLSDFGLCTGLKKAHRTEFYRDLTQAQPSDFSTSSKPMNSKRKAETWKKNRRQLAYSTVGTPDYIAPEVFLQTG----YNKLCDWWSLGVIMFEMLIGYPPFCSESPQETYRKVMHWRETLVFPPEV-PISEKSRDLILRFCCEAENRVGANGVEEIKTHAFFEGVDWEHMRERPAAIPIEIKSIDDTSNFD 311          
BLAST of Serine/threonine kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000997.1 (pep scaffold:Pmarinus_7.0:GL485486:573:10798:1 gene:ENSPMAG00000000902.1 transcript:ENSPMAT00000000997.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 227.639 bits (579), Expect = 2.143e-62
Identity = 191/664 (28.77%), Postives = 302/664 (45.48%), Query Frame = 2
Query: 2702 HVFSHSTFNRPIKCDYCTSHMLGQYYQGVKCKECSFSCHHYC------LSNVLNDKCYTRKSAGKGANLKNGIGTMYENFIKVPKPGGIRRGWKRQFMALCDLKLFFFDVKEGSTGTQMPDISRNPCRVIDLKYTEFKVVKVSRDEVMHAPKKDVEFIIKIS---IENSSTMLPIYVLFESVDNKEDCIKVIEEARSYIKKDP-HYRMIFTEKSCLNNLDISMNY-RQILSAAIIDQSTLLFGTEEG--LLKVTDSGYNKIGEKKPVYIIESLDQQELQLVAVIQSKQRVLKLLLSGILDGAHDWEPIIVENGKSCTTFVVGKSYVSPGNQFAPYADTMLANSTFHIKSPSNDRIWIMCAAFKNSVEVYHL--NLKLTRHEKLRQILCNTSVTSLQIAGHGEQLLIGMHDSVAIYSLWETGSPXXXXXXXXXXXXXNFQYIFQTNFESML-IVEI-----SFNEYLILFECAGIFINRNHRQTR-PDLQWPDKPTRFTYRAPYLLCFTE-MAGLFAYEITEHSCNLVQALPLRSSKPLDRSGHILTTANEFIQAIDLIYVHLVSANEEKISIGKTIDKTSSSNTLSIFKFLNKRKPSYNKQEDS-FDTNDAISPNPAGNSTKSTGLKYRDKPTLKSNRQISVPQNFRHLSHMGPDVPCQ-LIDL 4618
            H     TF+ P KC  C+S MLG   QG  C+ C FSCH  C      +  +  D+  TR+  G   + + G GT YE +++VPKP G+++GW+R +  +CDLKL  FD+ EG T   +P++  +   VID++  EF V  V   +V+HA +KDV  I +++   +    T L   +L ++   KE  + V+ E +  +K++    R ++  +    +    + Y +  LSAA+ID   +  G E+G  +L+VT+    ++ + K V  IE +   E QLVAVI  + R L+L L   L+G  + EP  V   K+C     G+          P   +   ++             ++C A K  +  Y L      TRH ++R+         L +   G  + +G     AIY+               +D  ++F           L  VEI        EYL+ F C GI+++R  R++R  +L WP  PT   Y  PYL  ++E    +F     E     +Q LPL+  KPL+  G +    +E ++   LIY     A  E + + +T D +       + +  ++R  SY   +D      + I                RD P L+S + IS P NF H++HMGP    Q L+DL
Sbjct:    3 HSLVVRTFSSPTKCSQCSSLMLGLVRQGCACEVCGFSCHVTCAEKAPQVCPIPADQ--TRRPLG--IDPQRGTGTAYEGYVRVPKPAGVKKGWQRAYAVVCDLKLVLFDIPEGKTA--LPNVGVS--HVIDMRDEEFSVSSVLASDVIHANRKDVPSIFRVTATQLTTPRTRLSTLILADTETEKERWVGVLSELQRLLKRNKLKDRAVYQAREAFES---GLPYIKTTLSAAVIDHDRIALGAEDGFYVLEVTNDVIVRVDDCKKVTQIELIP--EAQLVAVITGRNRQLRLYLWKALEGM-EHEPYKVPEAKNCQAIAAGR----------PSGLSAAGSA-------------LLCLAMKRQLVCYELMGGAARTRHRRIREYQLPNVAQWLAVLSEG--ICVGYQSGFAIYATGAGEEGSGHCLVQAEDPSLSFLAAGGGAPADALCCVEIVGGPGPAREYLLCFSCVGIYVDRQGRRSRQQELMWPAPPTACCYNPPYLSVYSENTVDIFNIITME----WIQTLPLKKIKPLNPQGTLNLLPSEPVR---LIYFQNKQAEGEDLHVPETSDNSRK----QLIRMRSRRHFSYRVPDDEKISLREMI---------------IRD-PELRS-KLISGPTNFNHVAHMGPGDGMQMLMDL 599          
BLAST of Serine/threonine kinase vs. Ensembl Yeast
Match: TPK3 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; partially redundant with Tpk1p and Tpk2p; localizes to P-bodies during stationary phase; TPK3 has a paralog, TPK1, that arose from the whole genome duplication [Source:SGD;Acc:S000001649])

HSP 1 Score: 211.075 bits (536), Expect = 3.459e-60
Identity = 123/319 (38.56%), Postives = 185/319 (57.99%), Query Frame = 2
Query:  266 SDFDTIRVIGRGAFGKVSVVRFKEKGEIYAMKSLHKYDILKKIDAACFQEERDVLFQAMKIKSPWITRLHYAFQDEFYLYFVMDFYNGGDMLTLLSKFNDRLPEEITKFYIAEVVMSIDVVHKLGYLHRDIKPDNLLLDSLGHIVLADFGSCVKLRPNGTTITERAVGTPDYISPEILRSAEGHGPYGVECDWWSLGIVIHEMLYGELPFYNEDFSETYWQIMNFETCFQIPTEYDDVSDEAEDLIKQLICKKEC-RLGN--KGIDDFKNHPFFREIDWDNL--RSYNAPFIPEVSSAE-DTSNFEF---DDFNANHEG 1195
            SDF  +R +G G+FG+V ++R    G  YA+K+L K+ I+K        +ER +L     +  P+I R+   FQD   ++ VMD+  GG++ +LL K + R P  + KFY AEV ++++ +H    ++RD+KP+N+LLD  GHI + DFG   K  P+   +T    GTPDYI+PE++ +     PY    DWWS G++I+EML G  PFYN +  +TY  I+N E  F  P  + D    A+DL+K+LI +    RLGN   G +D KNHP+F E+ W+ L  R    P+ P +   + DTS F+    ++FN   +G
Sbjct:   86 SDFQILRTLGTGSFGRVHLIRSNHNGRFYALKTLKKHTIVKLKQVEHTNDERRML---SIVSHPFIIRMWGTFQDSQQVFMVMDYIEGGELFSLLRK-SQRFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFG-FAKYVPD---VTYTLCGTPDYIAPEVVSTK----PYNKSVDWWSFGVLIYEMLAGYTPFYNSNTMKTYENILNAELKFP-PFFHPD----AQDLLKKLITRDLSERLGNLQNGSEDVKNHPWFNEVIWEKLLARYIETPYEPPIQQGQGDTSQFDRYPEEEFNYGIQG 387          
BLAST of Serine/threonine kinase vs. Ensembl Yeast
Match: TPK1 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; inhibited by regulatory subunit Bcy1p in the absence of cAMP; phosphorylates and inhibits Whi3p to promote G1/S phase passage; partially redundant with Tpk2p and Tpk3p; phosphorylates pre-Tom40p, which impairs its import into mitochondria under non-respiratory conditions; TPK1 has a paralog, TPK3, that arose from the whole genome duplication [Source:SGD;Acc:S000003700])

HSP 1 Score: 206.838 bits (525), Expect = 9.441e-59
Identity = 123/332 (37.05%), Postives = 192/332 (57.83%), Query Frame = 2
Query:  188 DEKNVAQFIKSIKGTVDKIESLRIRRSDFDTIRVIGRGAFGKVSVVRFKEKGEIYAMKSLHKYDILKKIDAACFQEERDVLFQAMKIKSPWITRLHYAFQDEFYLYFVMDFYNGGDMLTLLSKFNDRLPEEITKFYIAEVVMSIDVVHKLGYLHRDIKPDNLLLDSLGHIVLADFGSCVKLRPNGTTITERAVGTPDYISPEILRSAEGHGPYGVECDWWSLGIVIHEMLYGELPFYNEDFSETYWQIMNFETCFQIPTEYDDVSDEAEDLIKQLICKK-ECRLGN--KGIDDFKNHPFFREIDWDNLRSYN--APFIPEVSSAE-DTSNFE 1165
            +E+   QFI   + T  K  SL+    DF  +R +G G+FG+V ++R +  G  YAMK L K  +++        +ER +L     +  P+I R+   FQD   ++ +MD+  GG++ +LL K + R P  + KFY AEV ++++ +H    ++RD+KP+N+LLD  GHI + DFG   K  P+   +T    GTPDYI+PE++ +     PY    DWWS GI+I+EML G  PFY+ +  +TY +I+N E  F  P  ++   ++ +DL+ +LI +    RLGN   G +D KNHP+F+E+ W+ L S N   P+ P +   + DTS F+
Sbjct:   64 NEEQYKQFIAQARVTSGKY-SLQ----DFQILRTLGTGSFGRVHLIRSRHNGRYYAMKVLKKEIVVRLKQVEHTNDERLML---SIVTHPFIIRMWGTFQDAQQIFMIMDYIEGGELFSLLRK-SQRFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFG-FAKYVPD---VTYTLCGTPDYIAPEVVSTK----PYNKSIDWWSFGILIYEMLAGYTPFYDSNTMKTYEKILNAELRF--PPFFN---EDVKDLLSRLITRDLSQRLGNLQNGTEDVKNHPWFKEVVWEKLLSRNIETPYEPPIQQGQGDTSQFD 373          
BLAST of Serine/threonine kinase vs. Ensembl Yeast
Match: YPK1 (S/T protein kinase; phosphorylates, downregulates flippase activator Fpk1p; inactivates Orm1p and Orm2p by phosphorylation in response to compromised sphingolipid synthesis; involved in the TORC-dependent phosphorylation of ribosomal proteins Rps6a/b (S6); mutations affect receptor-mediated endocytosis and sphingolipid-mediated and cell integrity signaling pathways; human homolog SGK1 can complement a null mutant; human homolog SGK2 can complement a ypk1 ypk2 double mutant [Source:SGD;Acc:S000001609])

HSP 1 Score: 213.772 bits (543), Expect = 1.924e-58
Identity = 121/302 (40.07%), Postives = 182/302 (60.26%), Query Frame = 2
Query:  269 DFDTIRVIGRGAFGKVSVVRFKEKGEIYAMKSLHKYDILKKIDAACFQEERDVLFQAMKIKSPWITRLHYAFQDEFYLYFVMDFYNGGDMLTLLSKFNDRLPEEITKFYIAEVVMSIDVVHKLGYLHRDIKPDNLLLDSLGHIVLADFGSCVKLRPNGTTITERAVGTPDYISPEILRSAEGHGPYGVECDWWSLGIVIHEMLYGELPFYNEDFSETYWQIMNFETCFQIPTEYDDVSDEAEDLIKQLICKKEC-RLGNKGIDDFKNHPFFREIDWDNL--RSYNAPFIPEVSSAEDTSNFE 1165
            DFD ++VIG+G+FGKV  VR K+  ++YA+K++ K  I+ K +      ER VL    ++  P+I  L ++FQ    LYFV+ F NGG++   L K   R      +FY AE++ ++D +HKL  ++RD+KP+N+LLD  GHI L DFG C KL       T+   GTP+Y++PE+L    G G Y    DWW+LG++++EML G  P+Y+ED  + Y +I+     F  P  +D    +A+DL+  L+ +    RLG  G D+ +NHPFF ++ W  L  + Y  P+ P VS++ DTSNF+
Sbjct:  346 DFDLLKVIGKGSFGKVMQVRKKDTQKVYALKAIRKSYIVSKSEVTHTLAERTVL---ARVDCPFIVPLKFSFQSPEKLYFVLAFINGGELFYHLQK-EGRFDLSRARFYTAELLCALDNLHKLDVVYRDLKPENILLDYQGHIALCDFGLC-KLNMKDDDKTDTFCGTPEYLAPELLL---GLG-YTKAVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPLVF--PDGFD---RDAKDLLIGLLSRDPTRRLGYNGADEIRNHPFFSQLSWKRLLMKGYIPPYKPAVSNSMDTSNFD 633          
BLAST of Serine/threonine kinase vs. Ensembl Yeast
Match: YPK2 (Protein kinase similar to S/T protein kinase Ypk1p; functionally redundant with YPK1 at the genetic level; participates in a signaling pathway required for optimal cell wall integrity; involved in the TORC-dependent phosphorylation of ribosomal proteins Rps6a/b (S6); human homolog SGK2 can complement a ypk1 ypk2 double mutant [Source:SGD;Acc:S000004710])

HSP 1 Score: 212.616 bits (540), Expect = 5.355e-58
Identity = 122/302 (40.40%), Postives = 180/302 (59.60%), Query Frame = 2
Query:  269 DFDTIRVIGRGAFGKVSVVRFKEKGEIYAMKSLHKYDILKKIDAACFQEERDVLFQAMKIKSPWITRLHYAFQDEFYLYFVMDFYNGGDMLTLLSKFNDRLPEEITKFYIAEVVMSIDVVHKLGYLHRDIKPDNLLLDSLGHIVLADFGSCVKLRPNGTTITERAVGTPDYISPEILRSAEGHGPYGVECDWWSLGIVIHEMLYGELPFYNEDFSETYWQIMNFETCFQIPTEYDDVSDEAEDLIKQLICKKEC-RLGNKGIDDFKNHPFFREIDWDN--LRSYNAPFIPEVSSAEDTSNFE 1165
            DFD ++VIG+G+FGKV  VR K+  +IYA+K+L K  I+ K +      ER VL    ++  P+I  L ++FQ    LY V+ F NGG++   L +   R     ++FYIAE++ ++D +HKL  ++RD+KP+N+LLD  GHI L DFG C KL       T+   GTP+Y++PEIL    G G Y    DWW+LGI+++EM+ G  P+Y+E+    Y +I+     F  P  +D     A+DL+  L+ +    RLG  G D+ +NHPFF++I W    L+ Y  P+ P V S  DT+NF+
Sbjct:  343 DFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVL---ARVDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHL-QHEGRFSLARSRFYIAELLCALDSLHKLDVIYRDLKPENILLDYQGHIALCDFGLC-KLNMKDNDKTDTFCGTPEYLAPEILL---GQG-YTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPLLF--PDGFDPA---AKDLLIGLLSRDPSRRLGVNGTDEIRNHPFFKDISWKKLLLKGYIPPYKPIVKSEIDTANFD 630          
BLAST of Serine/threonine kinase vs. Ensembl Yeast
Match: TPK2 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; partially redundant with Tpk1p and Tpk3p; localizes to P-bodies during stationary phase; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000006124])

HSP 1 Score: 194.897 bits (494), Expect = 8.203e-55
Identity = 110/304 (36.18%), Postives = 174/304 (57.24%), Query Frame = 2
Query:  269 DFDTIRVIGRGAFGKVSVVRFKEKGEIYAMKSLHKYDILKKIDAACFQEERDVLFQAMKIKSPWITRLHYAFQDEFYLYFVMDFYNGGDMLTLLSKFNDRLPEEITKFYIAEVVMSIDVVHKLGYLHRDIKPDNLLLDSLGHIVLADFGSCVKLRPNGTTITERAVGTPDYISPEILRSAEGHGPYGVECDWWSLGIVIHEMLYGELPFYNEDFSETYWQIMNFETCFQIPTEYDDVSDEAEDLIKQLICKKECRLGN--KGIDDFKNHPFFREIDWDNL--RSYNAPFIPEVSSA-EDTSNFE 1165
            DF  +R +G G+FG+V +VR    G  YA+K L K  ++K        +ER +L     ++ P++ R+   FQD   ++ VMD+  GG++ +LL K + R P  + KFY AEV+++++ +H    ++RD+KP+N+LLD  GHI + DFG   +++    T+T    GTPDYI+PE++ +     PY    DWWSLG++I+EML G  PFY+    +TY +I+  +  +  P  + DV D    LI   + +   R+GN   G  D K HP+F E+ W+ L  +    P+ P ++S   DTS F+
Sbjct:   69 DFQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQVVKMKQVEHTNDERRML---KLVEHPFLIRMWGTFQDARNIFMVMDYIEGGELFSLLRK-SQRFPNPVAKFYAAEVILALEYLHAHNIIYRDLKPENILLDRNGHIKITDFGFAKEVQ----TVTWTLCGTPDYIAPEVITTK----PYNKSVDWWSLGVLIYEMLAGYTPFYDTTPMKTYEKILQGKVVYP-PYFHPDVVDLLSKLITADLTR---RIGNLQSGSRDIKAHPWFSEVVWERLLAKDIETPYEPPITSGIGDTSLFD 356          
BLAST of Serine/threonine kinase vs. Ensembl Nematostella
Match: EDO37677 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SF23])

HSP 1 Score: 320.472 bits (820), Expect = 2.232e-97
Identity = 165/395 (41.77%), Postives = 252/395 (63.80%), Query Frame = 2
Query:  119 VTLEFLIDSLFCTYYECRLP-FHKDEKNVAQFIKSIKGTVDKIESLRIRRSDFDTIRVIGRGAFGKVSVVRFKEKGEIYAMKSLHKYDILKKIDAACFQEERDVLFQAMKIKSPWITRLHYAFQDEFYLYFVMDFYNGGDMLTLLSKFNDRLPEEITKFYIAEVVMSIDVVHKLGYLHRDIKPDNLLLDSLGHIVLADFGSCVKLRPNGTTITERAVGTPDYISPEILRSAEGH-GPYGVECDWWSLGIVIHEMLYGELPFYNEDFSETYWQIMNFETCFQIPTEYDDVSDEAEDLIKQLICKKECRLGNKGIDDFKNHPFFREIDWDNLRSYNAPFIPEVSSAEDTSNF-EFD------------DFNANHEGPPLSSNFKGCHLPCIGFTFTK 1258
            V+ E L+D+    + EC      K +KN+A F+K  +  ++++  L + ++DF+ +  IGRG FG+V VV+ K  G++YAMK+L K   L +   A F+EER+++  A    +PWIT L YAFQD   LY VMD++ GGD+L+LLSK++D   E++ +FY+AE+VM+I  +H +G++HRD+KPDN+L+D  GHI LADFGS  +L  +    ++  VGTP+YI+PE+L S +G  G YGVECDWWSLG+V +EML+G+ PF  +    TY +IMNF++  + P+E   +S++A++LI  L+   E R+G +G+     H FF  I+W+ L++   P++P +   +DTSNF EF+             F +  +G      FKG  LP +GF+F K
Sbjct:   30 VSREALLDAFTVLFEECSSDHMKKKDKNIATFVKKYQPMINELRRLSLSKNDFNVVNTIGRGHFGEVQVVKDKATGDVYAMKTLKKSQTLSEEAVAFFEEEREIMATA---NNPWITSLQYAFQDSHSLYLVMDYHPGGDLLSLLSKYDDIFEEDMARFYLAEIVMAIHSLHTMGFVHRDVKPDNVLIDRTGHIKLADFGSSARLSADKKVFSKMPVGTPEYIAPEVLTSMDGSGGAYGVECDWWSLGVVAYEMLFGQTPFEADSVVVTYSKIMNFKSSLRFPSE-PKISEDAKELIHNLLTSSEGRIGYEGLG---CHKFFNGIEWNKLQNTLPPYVPTLDGTDDTSNFDEFEPDSDEMDQLKKYSFCSEEKG------FKGKDLPFVGFSFIK 411          
BLAST of Serine/threonine kinase vs. Ensembl Nematostella
Match: EDO32008 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SW88])

HSP 1 Score: 271.937 bits (694), Expect = 2.338e-82
Identity = 123/263 (46.77%), Postives = 183/263 (69.58%), Query Frame = 2
Query:  134 LIDSLFCTYYECRLPFHKDEKNVAQFIKSIKGTVDKIESLRIRRSDFDTIRVIGRGAFGKVSVVRFKEKGEIYAMKSLHKYDILKKIDAACFQEERDVLFQAMKIKSPWITRLHYAFQDEFYLYFVMDFYNGGDMLTLLSKFNDRLPEEITKFYIAEVVMSIDVVHKLGYLHRDIKPDNLLLDSLGHIVLADFGSCVKLRPNGTTITERAVGTPDYISPEILRSAEGHGPYGVECDWWSLGIVIHEMLYGELPFYNEDFSETY 922
            L+D +     +C  P  +  KNV  F++  +     I++ R+   DF T++VIGRGAFG+V +VR     ++YAMK L K++++K+ D+A F EER+++  +    S WI +LHYAFQDE YLY VMD+ +GGD++ L+S +   +PE+  KFY AEVV+++D +H +G++HRD+KPDN+LLD  GH+ LADFG+C+++  +G   ++ AVGTPDYISPE+L+S  G G YG ECDWWS+G+ ++EML G+ PFY +    TY
Sbjct:   21 LLDGIEALVNDCNFPQLRRNKNVENFLQRYEQPTRVIQTHRLNNDDFKTLKVIGRGAFGEVQLVRHTHTKKVYAMKLLSKFEMIKRSDSAFFWEEREIMAHS---NSNWIVKLHYAFQDEKYLYMVMDYMSGGDLVNLMSNYE--IPEKWAKFYCAEVVLALDAIHTMGFVHRDVKPDNMLLDGEGHLKLADFGTCMRMDRDGMVRSDTAVGTPDYISPEVLKSQGGEGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTY 278          
BLAST of Serine/threonine kinase vs. Ensembl Nematostella
Match: EDO42700 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0M7])

HSP 1 Score: 263.848 bits (673), Expect = 3.728e-77
Identity = 152/379 (40.11%), Postives = 221/379 (58.31%), Query Frame = 2
Query:  239 KIESLRIRRSDFDTIRVIGRGAFGKVSVVRFKEKGEIYAMKSLHKYDILKKIDAACFQEERDVLFQAMKIKSPWITRLHYAFQDEFYLYFVMDFYNGGDMLTLLSKFNDRLPEEITKFYIAEVVMSIDVVHKLGYLHRDIKPDNLLLDSLGHIVLADFGSCVKLR-------------------PNGTTITER----------------AVGTPDYISPEILRSAEGHGPYGVECDWWSLGIVIHEMLYGELPFYNEDFSETYWQIMNFETCFQIPTEYDDVSDEAEDLIKQLICKKECRLGNKGIDDFKNHPFFREIDWDNLRSYNAPFIPEVSSAEDTSNFEFDDFNANHEGPPLSSNFKGCHLPCIGFTFTKDFIF 1270
            +++  RI + DFD+++VIGRGAFG+V +V+ ++ G +YAMK L K D+L+K   A  + ERD+L +A   ++ W+ +++Y+FQD++YL+ VM+F  GGD++TLL K  D   EE T+FYIAE +++ID +H+LG++HRDIKPDNLLLDS GHI LADFG C  L+                    NG  +  +                 VGTPDYI+PE+    +G   Y   CD+WSLG++++EML G  PF +E   ETY ++MN+      P E   +S  A DLI +       RL N  I+D +  PFF+ +DW+NLR   A    +V S +DTSN  FD+F         S++   C       T +KD++F
Sbjct:   83 RLKRSRIGKEDFDSLKVIGRGAFGEVRLVQKQDTGHVYAMKILRKADMLEKEQVAHARAERDILAEA---ENQWVVKMYYSFQDDYYLFLVMEFLPGGDLMTLLMK-KDTFTEEETRFYIAEALLAIDSIHQLGFIHRDIKPDNLLLDSRGHIKLADFGLCTGLKKAHRTEFYRDISPADIKDFSNGDPLDSKRRAATWKRNRRQLAYSTVGTPDYIAPEVF-IQQG---YTKSCDFWSLGVIMYEMLIGYPPFCSESPQETYKKVMNWRETLVFPPEM-PISPNARDLISRQ------RLSN--IEDIRAQPFFKYVDWENLRDRPAALPIQVKSIDDTSN--FDEFPETDLDTSKSNSLLLC-------THSKDWVF 435          
BLAST of Serine/threonine kinase vs. Ensembl Nematostella
Match: EDO36034 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJR1])

HSP 1 Score: 243.432 bits (620), Expect = 1.721e-70
Identity = 139/382 (36.39%), Postives = 209/382 (54.71%), Query Frame = 2
Query:  191 EKNVAQFIKSIKGTVDKIESLRIRRSDFDTIRVIGRGAFGKVSVVRFKEKGEIYAMKSLHKYDILKKIDAACFQEERDVLFQAMKIKSPWITRLHYAFQDEFYLYFVMDFYNGGDMLTLLSKFNDRLPEEITKFYIAEVVMSIDVVHKLGYLHRDIKPDNLLLDSLGHIVLADFGSCV---------------KLRPNGTTITERA-----------------------------------------VGTPDYISPEILRSAEGHGPYGVECDWWSLGIVIHEMLYGELPFYNEDFSETYWQIMNFETCFQIPTEYDDVSDEAEDLIKQLICKKECRLGNKGIDDFKNHPFFREIDWDNL-RSYNAPFIPEVSSAEDTSNFE 1165
            +  + Q +K  +    +++  ++  S F+ IR IG GAFG+V +VR  +   +YAMK L K ++ ++  AA  + ERD+L +A    + W+ +L+Y+FQD+  LYFVMD+  GGD+++LL KF    PE+  KFYIAE+V++ID VH++G++HRDIKPDN+L+D  GHI L DFG C                 +R +     ERA                                         VGTP+YI+PE+L        Y   CDWWS+G++++EML G+ PF     +ET  +I+N+ET  +IP +   +S EA+DLI +L    + RLG+ G  + K HPFF  +DW  L +   AP+ P +    DT+NF+
Sbjct:   11 QSQMRQLLKQKETNYIRLKRTKMDISMFEKIRTIGIGAFGEVWLVRKTDTSMLYAMKILRKSEVFRRNQAAHVKAERDILAEA---DNEWVVKLYYSFQDQENLYFVMDYVPGGDLMSLLIKFGI-FPEDYAKFYIAELVLAIDSVHRMGFVHRDIKPDNILIDKDGHIKLTDFGLCTGFRWTHDSKYYEKGQHMRQDSMEPDERAWEEMRATCHCGDISIDKPYSEMKPLERRHFRKHMRCQAHSLVGTPNYIAPEVLLRIG----YRQSCDWWSVGVILYEMLVGQPPFLAPTPAETQLKIINWETELRIPHQA-RLSREAKDLILRLCTNADMRLGSNGASEIKAHPFFACVDWAYLAKRVQAPYTPVIRFPTDTANFD 383          
BLAST of Serine/threonine kinase vs. Ensembl Nematostella
Match: EDO37800 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEW2])

HSP 1 Score: 207.223 bits (526), Expect = 2.955e-58
Identity = 121/310 (39.03%), Postives = 184/310 (59.35%), Query Frame = 2
Query:  254 RIRRSDFDTIRVIGRGAFGKVSVVRFKEKGEIYAMKSLHKYDILKKIDAACFQEERDVLFQAMKIKSPWITRLHYAFQDEFYLYFVMDFYNGGDMLTLLSKFNDRLPEEITKFYIAEVVMSIDVVHKLGYLHRDIKPDNLLLDSLGHIVLADFGSCVK-LRPNGTTITERAVGTPDYISPEILRSAEGHGPYGVECDWWSLGIVIHEMLYGELPFYNEDFSETYWQIMNFETCFQIPTEYDDVSDEAEDLIKQLICK-KECRLGNKGID--DFKNHPFFREIDWDNL--RSYNAPFIPEVSSAEDTSNFE 1165
            + + SDF  ++VIG+G+FGKV + + K++ + YA+K L+K  I K+ +A     ER+VL Q   +  P++  LHY+FQ +  LYFV+D+ NGG++   L +     PE   +FY AE+  +I  +H L  ++RD+KP+N+LLDS GHIVL DFG C + +  +GTT T    GTP+Y++PE+LR  +    Y    DWW LG V++EM+YG  PFY+ D +E Y  I++     +      ++S  A  +++ L+ K K  RLG+   D  D + H FFR I+W  L  R    P+ P VS   D  +F+
Sbjct:   68 KAKPSDFLFLKVIGKGSFGKVFLSKNKQEDKFYAIKVLNKSAIRKRNEAKHIMAERNVLVQ--NVTHPFLVGLHYSFQTKDKLYFVLDYVNGGELFFHLQR-ERYFPESRARFYAAEIASAIGYLHGLQIIYRDLKPENILLDSKGHIVLTDFGLCKEGIDRSGTTST--FCGTPEYLAPEVLRKQD----YDKSVDWWCLGAVLYEMMYGLPPFYSRDTAEMYDNILHKPLRLRT-----NISQSARHILEGLLQKDKTKRLGSGEGDFEDIRTHSFFRSINWQQLVARGIEPPYNPNVSGQLDLKHFD 363          
BLAST of Serine/threonine kinase vs. Ensembl Medaka
Match: cdc42bpab (CDC42 binding protein kinase alpha [Source:NCBI gene;Acc:101159789])

HSP 1 Score: 669.078 bits (1725), Expect = 0.000e+0
Identity = 490/1634 (29.99%), Postives = 798/1634 (48.84%), Query Frame = 2
Query:  119 VTLEFLIDSLFCTYYECRLPFHKDEKNVAQFIKSIKGTVDKIESLRIRRSDFDTIRVIGRGAFGKVSVVRFKEKGEIYAMKSLHKYDILKKIDAACFQEERDVLFQAMKIKSPWITRLHYAFQDEFYLYFVMDFYNGGDMLTLLSKFNDRLPEEITKFYIAEVVMSIDVVHKLGYLHRDIKPDNLLLDSLGHIVLADFGSCVKLRPNGTTITERAVGTPDYISPEILRSAE-GHGPYGVECDWWSLGIVIHEMLYGELPFYNEDFSETYWQIMNFETCFQIPTEYDDVSDEAEDLIKQLICKKECRLGNKGIDDFKNHPFFREIDWDNLRSYNAPFIPEVSSAEDTSNFEFDD---FNANHEGPPLSSNFKGCHLPCIGFTFTKDFIFNEMGSEESSVRLKSLMENIGAPA--LLNGNHNESNSDALLEEVNQLKITCSQLEKQLNECRTNSVQRIFSHPVYQQLVTDKEKLLTQCQNYDYSLREK---EQKMDDLIETNRLLNKERDELTSDRLQILQKKQDIEEDLKVMTENFNQLKSTNKAINRXXXXXXXXX---XXXXXXXXXXXXXXXHLSIQKNQSQPDIQVEKQRFEEVMLQLR----SENDQMLEKMRLKCSNLTNSLEQSDQTIFNIKEEIKSLKEIFTNKEKNLKLSH-DNEIEQLKISVAEEQSRILASN-TQLK----------SQVKSLSEENVELRSSLQEISNKNMKFHFRLKTILDKEIVKTSENSEL---LTELDREVEL-----------LKTLC-------------------VDNDGDQKA-------------QGERQDNNGNES----WRLRKCVKADKIEISNLNLTLQSERRARADLEKKLTQQKSEICDISKQLEKYKQDVNEKDNLIANLKSASQNLE--------------------PHVPKEIPSNPVTLSEFNSILSGS------------LDKTVVNCNQ---------HVFSHSTFNRPIKCDYCTSHMLGQYYQGVKCKECSFSCHHYCLSNVLNDKCYTRKSAGKGA---NLKNGIGTMYENFIKVPKPGGIRRGWKRQFMALCDLKLFFFDVKEGSTGTQMPDISRNPCRVIDLKYTEFKVVKVSRDEVMHAPKKDVEFIIKISIEN----SSTMLPIYVLFESVDNKEDCIKVIEEARSYIKKDP-HYRMIFTEKSCLNNLDISMNYRQILSAAIIDQSTLLFGTEEGL--LKVTDSGYNKIGEKKPVYIIESLDQQELQLVAVIQSKQRVLKLLLSGILDGAHDWEPIIVENGKSCTTFVVGKSYVSPGNQFAPYADTMLANSTFHIKSPSNDRIWIMCAAFKNSVEVYHLNLKLTRHEKLRQILCNTSVTSLQIAGHGEQLLIG------MHDSVAIYSLWETGSPXXXXXXXXXXXXXNFQYIFQTNFESMLIVEISFNEYLILFECAGIFIN-RNHRQTRPDLQWPDKPTRFTYRAPYLLCFTEMAGLFAYEITEHSCNLVQALPLRSSKPLDRSGHILTTANEFIQAIDLIYVHLVSANEEKISIGKTIDKTSSSNTLSIFKFLNKRKPSYNKQEDSFDTNDAISPNPAGNSTKSTGLKYRDKPTLKSNRQISVPQNFRHLSHMGPDVPCQLI 4612
            +++E L+D L C Y EC     + EKN+ +F+   K    K++ +R+ + DF+ ++VIGRGAFG+V+VV+ K   +++AMK L+K+++LK+ + ACF+EERDVL         WIT LHYAFQD+  LY VMD+Y GGD+LTLLSKF DRLPE++ KFY+AE+V++ID VH+L Y+HRDIKPDN+LLD  GHI LADFGSC+KL  +GT  +  AVGTPDYISPEIL++ E G G YG ECDWWSLG+ ++EMLYGE PFY E   ETY +IMN +  FQ P +  DVS+EA+DLI++LIC +E RLG  GI+DFK HPFF  IDWDN+R+  AP+IPEVSS  DTSNF+ DD    N+    PP  + F G HLP +GFT+T    F++ G       L+ L    G      ++ +      D+L  E  + +I      ++L + +T   +++   P+      +   L T+ +     + E    E+K++D+  + R L      + +   Q+    Q+ +E  K + E  ++LKS +K +       +  +    +L       +   + L+ Q    + +++ + Q+ E + L++R    ++ + + E+   +        E+++Q    ++EE++ LK +     K  ++ H   E+E+  +   EE +R  A + T+LK          SQ  +L +E + L+  L +     M++  + +T   + ++ T EN +L   L +L R  E            +K L                    V ++ D +              +G +  + G  +    W++R+  K D      L   L +E +A+  ++ +LTQ K++      +L+  +    E    I +LK  ++ L                      H P+ + +  +    + S+   S                 + C           H F   +F+ P KC+ CTS M+G   QG  C+ C+FSCH  C ++     C   +   KG+   + + GIGT YE +++VPKP G+++GW+R    +CD KLF +++ EG        +S    +VID++  EF V  V   +V+HA +KD+  I +++  +    SS    I +L +S   +   + ++ E    +KK+    R ++  K   ++    +   Q  SAAIID   +  G EEGL  + VT     ++G+ K VY I+ + Q+   L+AVI  K R ++L+    LDG       +VE  K C     G                             N  +  +C A K  +  Y +      + +LR +    ++  + +   G++L +G      + D++A+ SL                 D    +I Q N E++  VEIS  E L+ F   G++++   HR  + +L WP  P    Y APYL  ++E A +  +++  ++   +Q +PL+  +PL+  G +       ++ + LIY     A  +++ + +T D++      S          + NK+  SF         P     +      RD P ++ N+ IS P NF H++HMGP    Q++
Sbjct:   26 LSVETLLDILVCLYDECNNSPLRREKNILEFLDWAKPFTSKVKQMRLHKEDFEILKVIGRGAFGEVAVVKVKNTDKVFAMKILNKWEMLKRAETACFREERDVLVNG---DCQWITTLHYAFQDDNNLYLVMDYYVGGDLLTLLSKFEDRLPEDMAKFYLAEMVLAIDSVHQLHYVHRDIKPDNILLDKKGHIRLADFGSCLKLMEDGTVQSSVAVGTPDYISPEILQAMEDGKGKYGPECDWWSLGVCMYEMLYGETPFYAESLVETYGKIMNHKERFQFPQQLTDVSEEAKDLIRRLICSREHRLGQNGIEDFKQHPFFSGIDWDNIRTCEAPYIPEVSSPTDTSNFDVDDDCLKNSETMPPPSHTAFSGHHLPFVGFTYTSKCTFSDRGC------LRQLSGERGQTGEDQVDLDVKRRLEDSLATEAYERRI------RRLEQEKTELSRKLHESPLSSTKEVEIRSLKTEIEILKKQIAESGQLEKKLEDVTSSRRDLEDSSKHVRTLEKQLKSLTQERDEMQKDLVEASDRLKSQSKELKEAHSQRKLAMQEFSELNSTLTDLRSAKQRLARQLRDKEEEMETQSQKVEALRLEVRKAERAKKEVLAEEHAAEAQKEKKIRERNEQYSRQLEEELEGLK-VQVASLKTQEVGHLRGEMERKTLLYEEELARREAQHSTELKTLRKELRDAESQQLTLQKEILMLKDKLDQARQIEMEYKQKYET---ERVLLTEENKKLSNDLDKLSRMFEKVSSSHQHLEDEMKELADKKESVAHWEAQITEIIQWVSDEKDARGYLQALATKMTEELEGLKNTSLGARATDMPWKMRRLAKLDMSARLELQSALDAEIKAKQAIQDELTQVKADCFSTEGKLQDMESKNKELLAEIEHLKKETEELRLRRESNICVINQLTLFLQLIDHQPRSVQTPTMRSGGYGSMGRCSPKVSFPPKRRSLFASVPIVCESGVCRLQPKAHQFVVKSFSAPTKCNQCTSLMVGLIRQGCMCEVCNFSCHVTC-ADKAPAVCPVPQDQTKGSLGIDPQRGIGTAYEGYVRVPKPTGVKKGWQRAMAVVCDFKLFLYELGEGKAAQPSVIVS----QVIDMRDEEFSVSSVLASDVIHASRKDIPCIFRVTASHLSASSSQKTSILMLADSDQERNKWVGLLGELHRILKKNKLKDRFVYVPKEAYDSTLPLIKGTQ--SAAIIDHERVALGNEEGLFVIHVTKDEIIRVGDNKKVYQIDPIPQE--HLLAVISGKNRHVRLVPIMALDGRETDCQKLVET-KGCQRIASGPV--------------------------RNGSLMCLCVAMKTKIICYEVRKSHPHYRRLRDVQAPAAIQWMGL--FGDRLYVGYQSGFVIPDNMAMVSLLHP-------------EDHTLAFIPQQNLEALCAVEISSKELLLCFSSIGVYVDSHGHRSRQQELMWPATPNAACYNAPYLSVYSENA-VDVFDV--NTMEWIQTIPLKKVRPLNVDGSLNLLG---LETVRLIYFRNKMAEGDELVVPETSDQSRKQMVRS----------NNNKRRFSFRV-------PEEERLQQRREMLRD-PEMR-NKLISNPTNFNHVAHMGPGDGIQIL 1564          
BLAST of Serine/threonine kinase vs. Ensembl Medaka
Match: cdc42bpb (CDC42 binding protein kinase beta [Source:NCBI gene;Acc:101168010])

HSP 1 Score: 640.188 bits (1650), Expect = 0.000e+0
Identity = 491/1649 (29.78%), Postives = 813/1649 (49.30%), Query Frame = 2
Query:  119 VTLEFLIDSLFCTYYECRLPFHKDEKNVAQFIKSIKGTVDKIESLRIRRSDFDTIRVIGRGAFGKVSVVRFKEKGEIYAMKSLHKYDILKKIDAACFQEERDVLFQAMKIKSPWITRLHYAFQDEFYLYFVMDFYNGGDMLTLLSKFNDRLPEEITKFYIAEVVMSIDVVHKLGYLHRDIKPDNLLLDSLGHIVLADFGSCVKLRPNGTTITERAVGTPDYISPEILRSAE-GHGPYGVECDWWSLGIVIHEMLYGELPFYNEDFSETYWQIMNFETCFQIPTEYDDVSDEAEDLIKQLICKKECRLGNKGIDDFKNHPFFREIDWDNLRSYNAPFIPEVSSAEDTSNFEFDD--FNANHEGPPLS-SNFKGCHLPCIGFTFTKDFIFNEMGS----------EESSV----------RLKSLMEN--------------IGAPALLNGNHNESNSDALLEEVNQLKITCS---QLEKQLNECRT------NSVQRIFS-HPVYQQLVTDKEKLLTQCQNYDYSLREKEQKMDDLIETNRLLNKERDELTSDRLQILQKKQ-------DIEEDLKVMTENFNQLKSTNKAINRXXXXXXXXXXXXXXXXXXXXXXXXHLSIQKNQSQPDIQVEKQRFEEVMLQLRSENDQMLEKMRLKC----------------------SNLTNSLEQSDQTIFNIKEEIKSLKEIFTNKEKNLKLSHDNEIEQLKISVAEEQSRILASNTQLKSQ-------VKSLSEENVELRSSLQEISNKNMKF-HFRLKTILDKEIVKTSENSE-----LLTELDREVELLKTLCVDNDGDQKAQGERQDNNGNESWRLRKCVKADKIEISNLNLTLQSERRARA--------------DLEKKLTQQKSEICDISKQLEKYKQDVNEKDN-----------------------LIANLKSASQNLEPHVPK--EIP-SNPVTLSEFNSILSG--------SLDKTVVNCNQHVFSHSTFNRPIKCDYCTSHMLGQYYQGVKCKECSFSCHHYCLSN--VLNDKCYTRKSAGKGANLKNGIGTMYENFIKVPKPGGIRRGWKRQFMALCDLKLFFFDVKEGSTGTQMPDISRNPCRVIDLKYTEFKVVKVSRDEVMHAPKKDVEFIIKIS---IENSSTMLPIYVLFESVDNKEDCIKVIEEARSYIKKDPHYRMIFTEKSCLNNLDISMNY-RQILSAAIIDQSTLLFGTEEGL--LKVTDSGYNKIGEKKPVYIIESLDQQELQLVAVIQSKQRVLKLLLSGILDGAHDWEPIIVENGKSCTTFVVGKSYVSPGNQFAPYADTMLANSTFHIKSPSNDRIWIMCAAFKNSVEVYHLNLKLTRHEKLRQILCNTSVTSLQIAGHGEQLLIGMHDSVAIYSLWETGSPXXXXXXXXXXXXXNFQYIFQTNFESMLIVEISFNEYLILFECAGIFINRNHRQTRP-DLQWPDKPTRFTYRAPYLLCFTEMAGLFAYEITEHSCNLVQALPLRSSKPLDRSGHILTTANEFIQAIDLIYVHLVSANEEKISIGK-TIDKTSSSNTLSIFKFLNKRKPSYNKQEDSFDTNDAISPNPAGNSTKSTGLKYRDKPTLKSNRQISVPQNFRHLSHMGPDVPCQ-LIDL 4618
            +++E L+D L C Y EC     K EK+V  F++ +K     ++ +R+ R DF+ ++VIGRGAFG+V+VV+ K    +YAMK L+K+++LK+ + ACF+EERDVL   +K  S WITRLHYAFQD+ +LY VMD+Y GGD+LTLLSKF DRLPE++ +FY+AE+V+++  +H+  Y+HRDIKPDN+LLD  GHI LADFGSC+ +  +G   +  AVGTPDYISPEIL++ E G G YG ECDWWSLG+ ++EML+GE PFY E   ETY +IMN E  FQ P+   DVS++A DLI++LIC +E RLG  GI DFK+H FF+ IDWDN+RS  AP+IP+VSS  DTSNF+ DD        GPP+S S F G HLP +GFTFT D  F++  S          +E  V          R++ L +               + AP+       +     L EE+++LK   +   +LE QL E  T      +S  ++ +     + L  +KE +  Q  +    +R   +++ D     +L  +E  EL+    ++   KQ       D EE+  V+ +  + ++   + +++ +  LE +LD+ K +  KE++  ++  +   Q + ++Q  K +  +      +E+ Q L +++ +                        N+   L++S+       +E+  L+E     +K  ++  D+ +  LK     E+S +   N +L ++       V  L+ +N +L   LQ++S+K     H+  +     + V   +++      L T++  E+E L++  +         G R     +  W++R+  K D      L   L++E RA+               +LE KL + +    +  +Q+E  K++V E  +                       L  +L   + +++P   K    P S+P  L E  + L          S   T  N   H  S  TF+ P +C +C+S M+G   QG  C+ CSF CH  C  +  ++      +    +G +++ GIGT Y  ++++PKP G+++GW+R F  + D KLF +DV EG + TQ   ++     V+DL+  +  V  V   +V+HA +KD+  I K++   + +  + + + VL ES   K+  ++++E  +S + K+            L   D S+   +  LSAA++D+  +  GTE+GL  +++T     +  + K V+ ++ + ++  +++AV+  + R + L   G+L+GA  +  I +   K C     G                           P+      + AA K  V+ Y +      ++K  ++    +V  L +    ++L +G     A+ +L    SP       +   D    ++ Q   +++  +E+  +E L+ F   GI+++   R++R  +L WP  P      + +L  ++E  G+  +++T  +   VQ + L   KPL+  G +   ++E   A  LIY    S      S G  TI +T+  +  ++ +  +KRK  +              P       +   LK    P L+S R IS P NF H++HMGP    Q L+DL
Sbjct:   23 LSVEALLDLLVCLYTECSSCPLKREKHVTDFLQWVKPFTTAVKDMRLHRDDFEMLKVIGRGAFGEVAVVKMKNTERVYAMKILNKWEMLKRAETACFREERDVL---VKGDSQWITRLHYAFQDDNFLYLVMDYYVGGDLLTLLSKFEDRLPEDMARFYVAEMVLAVHSIHQQHYVHRDIKPDNILLDVNGHIRLADFGSCLHMMEDGMVQSSVAVGTPDYISPEILQAMEDGMGRYGPECDWWSLGVCMYEMLFGETPFYAESLVETYGKIMNHEERFQFPSHVTDVSEDARDLIQRLICSRERRLGLNGISDFKSHSFFKGIDWDNIRSMEAPYIPDVSSPTDTSNFDVDDDVLKNPDIGPPVSHSGFSGQHLPFVGFTFTTDSCFSDRCSISKAALGVLQKEGEVKGRDVEAFERRIRCLEQEKQDLNRQLQESTLALQAPSRGGTLSRDKEIKKLNEEIDRLKKKLADSDRLEHQLEEAVTLRQDYESSASKLKALERQVKALRQEKEDVHKQLSDSLERMRSLTKELKDAHSQRKLALQEYSELSERMAELRSSKQKLSRQLRDKEEEADVLLQKMDAMRLEMRKMDKNRKELEAQLDEAKAEASKERKLRENSEVYSKQLETELQGLKSQQGQGSAAAGAESQQELSRLKAELDKKVLFYEQELLQRDLSHSTEMKNMRKDLQESEGAQLAANKELLQLREKLDKAKKERQIEMDDAVAALKEKYEREKSLLTEENRKLSAETDKLCSFVDDLTAQNRQLEDDLQDLSSKKESVAHWEAQIAEIIQWVSDEKDARGYLQALATKMTEELETLRSSSL---------GSR---PLDPLWKVRRSQKLDMSARLELQSALEAEIRAKQLLQEELRKVKAANINLESKLRESEDRSREAVEQMENLKKEVEESRSHPEKSLKLQDFQDSIFEYFNTSPLAPDLTFRTSDIDPMPLKADATPSSSPSELEEGRAALGPISPSPSFYSSTITAPNPKAHQLSIKTFSSPTQCTHCSSLMVGLIRQGYACEVCSFICHVSCKDHAPLICPIPAEQAKRPQGIDVQRGIGTAYRGYVRIPKPSGVKKGWQRAFAIVSDCKLFLYDVPEGKS-TQAGVVA---SLVLDLRDEDLSVSSVMASDVIHATRKDIPCIFKVASSQLMSQLSSVSLLVLAESEAEKKKWVRMLESLQSILSKNQLKSQQV--HRLLEAYDASLPLIKTTLSAAVLDRERIALGTEDGLFVVELTRDVIVRAADCKKVHQVDLVPKE--KIIAVLCGRNRHVHLHPWGVLEGAESFFDIKLAETKGCQALCTG---------------------VLRQGGPA-----YLLAAVKRQVQCYEITRAKPHYKKHWEVQAPGTVQWLGMV--RDRLCVGYPSGFALLTLQGESSP----ISLVSPADPTLAFLAQQPLDALHALEVGSSEVLLCFSQLGIYVDGQGRRSRAQELMWPATPLACCSNSSHLTVYSEY-GVDVFDVT--TMEWVQTISLCKIKPLNVEGTLNLLSSE---APRLIYFSNAS------SAGDLTIPETTEHSRKAMVRTRSKRKFLFK------------VPEEERLQQRREMLK---DPELRS-RMISNPTNFNHVAHMGPGDGMQVLMDL 1588          
BLAST of Serine/threonine kinase vs. Ensembl Medaka
Match: cdc42bpb (CDC42 binding protein kinase beta [Source:NCBI gene;Acc:101168010])

HSP 1 Score: 638.262 bits (1645), Expect = 0.000e+0
Identity = 490/1654 (29.63%), Postives = 814/1654 (49.21%), Query Frame = 2
Query:  119 VTLEFLIDSLFCTYYECRLPFHKDEKNVAQFIKSIKGTVDKIESLRIRRSDFDTIRVIGRGAFGKVSVVRFKEKGEIYAMKSLHKYDILKKIDAACFQEERDVLFQAMKIKSPWITRLHYAFQDEFYLYFVMDFYNGGDMLTLLSKFNDRLPEEITKFYIAEVVMSIDVVHKLGYLHRDIKPDNLLLDSLGHIVLADFGSCVKLRPNGTTITERAVGTPDYISPEILRSAE-GHGPYGVECDWWSLGIVIHEMLYGELPFYNEDFSETYWQIMNFETCFQIPTEYDDVSDEAEDLIKQLICKKECRLGNKGIDDFKNHPFFREIDWDNLRSYNAPFIPEVSSAEDTSNFEFDD--FNANHEGPPLS-SNFKGCHLPCIGFTFTKDFIFNEMGS----------EESSV----------RLKSLMEN--------------IGAPALLNGNHNESNSDALLEEVNQLKITCS---QLEKQLNECRT------NSVQRIFS-HPVYQQLVTDKEKLLTQCQNYDYSLREKEQKMDDLIETNRLLNKERDELTSDRLQILQKKQ-------DIEEDLKVMTENFNQLKSTNKAINRXXXXXXXXXXXXXXXXXXXXXXXXHLSIQKNQSQPDIQVEKQRFEEVMLQLRSENDQMLEKMRLKC----------------------SNLTNSLEQSDQTIFNIKEEIKSLKEIFTNKEKNLKLSHDNEIEQLKISVAEEQSRILASNTQLKSQ-------VKSLSEENVELRSSLQEISNKNMKF-HFRLKTILDKEIVKTSENSE-----LLTELDREVELLKTLCVDNDGDQKAQGERQDNNGNESWRLRKCVKADKIEISNLNLTLQSERRARA--------------DLEKKLTQQKSEICDISKQLEKYKQDVNEKDN-----------------------LIANLKSASQNLEP------HVPKEIPS----------NPVTLSEFNSILSGSLDKTVVNCNQHVFSHSTFNRPIKCDYCTSHMLGQYYQGVKCKECSFSCHHYCLSN--VLNDKCYTRKSAGKGANLKNGIGTMYENFIKVPKPGGIRRGWKRQFMALCDLKLFFFDVKEGSTGTQMPDISRNPCRVIDLKYTEFKVVKVSRDEVMHAPKKDVEFIIKIS---IENSSTMLPIYVLFESVDNKEDCIKVIEEARSYIKKDPHYRMIFTEKSCLNNLDISMNY-RQILSAAIIDQSTLLFGTEEGL--LKVTDSGYNKIGEKKPVYIIESLDQQELQLVAVIQSKQRVLKLLLSGILDGAHDWEPIIVENGKSCTTFVVGKSYVSPGNQFAPYADTMLANSTFHIKSPSNDRIWIMCAAFKNSVEVYHLNLKLTRHEKLRQILCNTSVTSLQIAGHGEQLLIGMHDSVAIYSLWETGSPXXXXXXXXXXXXXNFQYIFQTNFESMLIVEISFNEYLILFECAGIFINRNHRQTRP-DLQWPDKPTRFTYRAPYLLCFTEMAGLFAYEITEHSCNLVQALPLRSSKPLDRSGHILTTANEFIQAIDLIYVHLVSANEEKISIGK-TIDKTSSSNTLSIFKFLNKRKPSYNKQEDSFDTNDAISPNPAGNSTKSTGLKYRDKPTLKSNRQISVPQNFRHLSHMGPDVPCQ-LIDL 4618
            +++E L+D L C Y EC     K EK+V  F++ +K     ++ +R+ R DF+ ++VIGRGAFG+V+VV+ K    +YAMK L+K+++LK+ + ACF+EERDVL   +K  S WITRLHYAFQD+ +LY VMD+Y GGD+LTLLSKF DRLPE++ +FY+AE+V+++  +H+  Y+HRDIKPDN+LLD  GHI LADFGSC+ +  +G   +  AVGTPDYISPEIL++ E G G YG ECDWWSLG+ ++EML+GE PFY E   ETY +IMN E  FQ P+   DVS++A DLI++LIC +E RLG  GI DFK+H FF+ IDWDN+RS  AP+IP+VSS  DTSNF+ DD        GPP+S S F G HLP +GFTFT D  F++  S          +E  V          R++ L +               + AP+       +     L EE+++LK   +   +LE QL E  T      +S  ++ +     + L  +KE +  Q  +    +R   +++ D     +L  +E  EL+    ++   KQ       D EE+  V+ +  + ++   + +++ +  LE +LD+ K +  KE++  ++  +   Q + ++Q  K +  +      +E+ Q L +++ +                        N+   L++S+       +E+  L+E     +K  ++  D+ +  LK     E+S +   N +L ++       V  L+ +N +L   LQ++S+K     H+  +     + V   +++      L T++  E+E L++  +         G R     +  W++R+  K D      L   L++E RA+               +LE KL + +    +  +Q+E  K++V E  +                       L  +L   + +++P        P   PS           P++ S   S  S ++  T  N   H  S  TF+ P +C +C+S M+G   QG  C+ CSF CH  C  +  ++      +    +G +++ GIGT Y  ++++PKP G+++GW+R F  + D KLF +DV EG + TQ   ++     V+DL+  +  V  V   +V+HA +KD+  I K++   + +  + + + VL ES   K+  ++++E  +S + K+            L   D S+   +  LSAA++D+  +  GTE+GL  +++T     +  + K V+ ++ + ++  +++AV+  + R + L   G+L+GA  +  I +   K C     G                           P+      + AA K  V+ Y +      ++K  ++    +V  L +    ++L +G     A+ +L    SP       +   D    ++ Q   +++  +E+  +E L+ F   GI+++   R++R  +L WP  P      + +L  ++E  G+  +++T  +   VQ + L   KPL+  G +   ++E   A  LIY    S      S G  TI +T+  +  ++ +  +KRK  +              P       +   LK    P L+S R IS P NF H++HMGP    Q L+DL
Sbjct:   23 LSVEALLDLLVCLYTECSSCPLKREKHVTDFLQWVKPFTTAVKDMRLHRDDFEMLKVIGRGAFGEVAVVKMKNTERVYAMKILNKWEMLKRAETACFREERDVL---VKGDSQWITRLHYAFQDDNFLYLVMDYYVGGDLLTLLSKFEDRLPEDMARFYVAEMVLAVHSIHQQHYVHRDIKPDNILLDVNGHIRLADFGSCLHMMEDGMVQSSVAVGTPDYISPEILQAMEDGMGRYGPECDWWSLGVCMYEMLFGETPFYAESLVETYGKIMNHEERFQFPSHVTDVSEDARDLIQRLICSRERRLGLNGISDFKSHSFFKGIDWDNIRSMEAPYIPDVSSPTDTSNFDVDDDVLKNPDIGPPVSHSGFSGQHLPFVGFTFTTDSCFSDRCSISKAALGVLQKEGEVKGRDVEAFERRIRCLEQEKQDLNRQLQESTLALQAPSRGGTLSRDKEIKKLNEEIDRLKKKLADSDRLEHQLEEAVTLRQDYESSASKLKALERQVKALRQEKEDVHKQLSDSLERMRSLTKELKDAHSQRKLALQEYSELSERMAELRSSKQKLSRQLRDKEEEADVLLQKMDAMRLEMRKMDKNRKELEAQLDEAKAEASKERKLRENSEVYSKQLETELQGLKSQQGQGSAAAGAESQQELSRLKAELDKKVLFYEQELLQRDLSHSTEMKNMRKDLQESEGAQLAANKELLQLREKLDKAKKERQIEMDDAVAALKEKYEREKSLLTEENRKLSAETDKLCSFVDDLTAQNRQLEDDLQDLSSKKESVAHWEAQIAEIIQWVSDEKDARGYLQALATKMTEELETLRSSSL---------GSR---PLDPLWKVRRSQKLDMSARLELQSALEAEIRAKQLLQEELRKVKAANINLESKLRESEDRSREAVEQMENLKKEVEESRSHPEKSLKLQDFQDSIFEYFNTSPLAPDLTFRTSDIDPMPLKADATPSSSPSELEQEGRAALGPISPS--PSFYSSTI--TAPNPKAHQLSIKTFSSPTQCTHCSSLMVGLIRQGYACEVCSFICHVSCKDHAPLICPIPAEQAKRPQGIDVQRGIGTAYRGYVRIPKPSGVKKGWQRAFAIVSDCKLFLYDVPEGKS-TQAGVVA---SLVLDLRDEDLSVSSVMASDVIHATRKDIPCIFKVASSQLMSQLSSVSLLVLAESEAEKKKWVRMLESLQSILSKNQLKSQQV--HRLLEAYDASLPLIKTTLSAAVLDRERIALGTEDGLFVVELTRDVIVRAADCKKVHQVDLVPKE--KIIAVLCGRNRHVHLHPWGVLEGAESFFDIKLAETKGCQALCTG---------------------VLRQGGPA-----YLLAAVKRQVQCYEITRAKPHYKKHWEVQAPGTVQWLGMV--RDRLCVGYPSGFALLTLQGESSP----ISLVSPADPTLAFLAQQPLDALHALEVGSSEVLLCFSQLGIYVDGQGRRSRAQELMWPATPLACCSNSSHLTVYSEY-GVDVFDVT--TMEWVQTISLCKIKPLNVEGTLNLLSSE---APRLIYFSNAS------SAGDLTIPETTEHSRKAMVRTRSKRKFLFK------------VPEEERLQQRREMLK---DPELRS-RMISNPTNFNHVAHMGPGDGMQVLMDL 1589          
BLAST of Serine/threonine kinase vs. Ensembl Medaka
Match: cdc42bpab (CDC42 binding protein kinase alpha [Source:NCBI gene;Acc:101159789])

HSP 1 Score: 473.011 bits (1216), Expect = 9.632e-138
Identity = 287/775 (37.03%), Postives = 445/775 (57.42%), Query Frame = 2
Query:  119 VTLEFLIDSLFCTYYECRLPFHKDEKNVAQFIKSIKGTVDKIESLRIRRSDFDTIRVIGRGAFGKVSVVRFKEKGEIYAMKSLHKYDILKKIDAACFQEERDVLFQAMKIKSPWITRLHYAFQDEFYLYFVMDFYNGGDMLTLLSKFNDRLPEEITKFYIAEVVMSIDVVHKLGYLHRDIKPDNLLLDSLGHIVLADFGSCVKLRPNGTTITERAVGTPDYISPEILRSAE-GHGPYGVECDWWSLGIVIHEMLYGELPFYNEDFSETYWQIMNFETCFQIPTEYDDVSDEAEDLIKQLICKKECRLGNKGIDDFKNHPFFREIDWDNLRSYNAPFIPEVSSAEDTSNFEFDD---FNANHEGPPLSSNFKGCHLPCIGFTFTKDFIFNEMGSEESSVRLKSLMENIGAPA--LLNGNHNESNSDALLEE-----VNQLKITCSQLEKQLNECRTNSVQRIFSHPVYQQLVTDKEKLLTQCQNYDYSLREK--------EQKMDDLIETNRLLNKERDELTSDRLQILQKKQDIEEDLKVMTENFNQLKSTNKAINRXXXXXXXXX---XXXXXXXXXXXXXXXHLSIQKNQSQPDIQVEKQRFEEVMLQLR------SENDQMLEKMRLKCSNLTNSLEQSDQTIFNIKEEIKSLKEIFTNK-------EKNLKLSH-DNEIEQLKISVAEEQSRILASN-TQLKSQVKSLSEENVELRSSLQEISNKNMKF-HFRLKTILDKE--------------IVKTSENSELLTELDR 2287
            +++E L+D L C Y EC     + EKN+ +F+   K    K++ +R+ + DF+ ++VIGRGAFG+V+VV+ K   +++AMK L+K+++LK+ + ACF+EERDVL         WIT LHYAFQD+  LY VMD+Y GGD+LTLLSKF DRLPE++ KFY+AE+V++ID VH+L Y+HRDIKPDN+LLD  GHI LADFGSC+KL  +GT  +  AVGTPDYISPEIL++ E G G YG ECDWWSLG+ ++EMLYGE PFY E   ETY +IMN +  FQ P +  DVS+EA+DLI++LIC +E RLG  GI+DFK HPFF  IDWDN+R+  AP+IPEVSS  DTSNF+ DD    N+    PP  + F G HLP +GFT+T    F++ G       L+ L    G      ++ +      D+L  E     + +L+   ++L ++L+E  T +VQ    HP  +  ++  +++  +    +  + +K        E+K++D+  + R L      + +   Q+    Q+ +E  K + E  ++LKS +K +       +  +    +L       +   + L+ Q    + +++ + Q+ E + L++R       E + + E+   +        E+++Q    ++EE++ LK   +         ++  ++ H   E+E+  +   EE +R  A + T+LK+  K L +   +  +  +EI     K    R ++I+D+E              ++ T EN +L  +LD+
Sbjct:   26 LSVETLLDILVCLYDECNNSPLRREKNILEFLDWAKPFTSKVKQMRLHKEDFEILKVIGRGAFGEVAVVKVKNTDKVFAMKILNKWEMLKRAETACFREERDVLVNG---DCQWITTLHYAFQDDNNLYLVMDYYVGGDLLTLLSKFEDRLPEDMAKFYLAEMVLAIDSVHQLHYVHRDIKPDNILLDKKGHIRLADFGSCLKLMEDGTVQSSVAVGTPDYISPEILQAMEDGKGKYGPECDWWSLGVCMYEMLYGETPFYAESLVETYGKIMNHKERFQFPQQLTDVSEEAKDLIRRLICSREHRLGQNGIEDFKQHPFFSGIDWDNIRTCEAPYIPEVSSPTDTSNFDVDDDCLKNSETMPPPSHTAFSGHHLPFVGFTYTSKCTFSDRGC------LRQLSGERGQTGEDQVDLDVKRRLEDSLATEAYERRIRRLEQEKTELSRKLHES-TQTVQ-ALQHPTTESPLSSTKEVEIRSLKTEIEILKKQIAESGQLEKKLEDVTSSRRDLEDSSKHVRTLEKQLKSLTQERDEMQKDLVEASDRLKSQSKELKEAHSQRKLAMQEFSELNSTLTDLRSAKQRLARQLRDKEEEMETQSQKVEALRLEVRKAERAKKEVEVLAEEHAAEAQKEKKIRERNEQYSRQLEEELEGLKSKQSGSSVTPAAADQTQEVGHLRGEMERKTLLYEEELARREAQHSTELKTLRKELRDAESQQLTLQKEILMLKDKLDQARRRSIIDREEIEMEYKQKYETERVLLTEENKKLSNDLDK 789          

HSP 2 Score: 232.646 bits (592), Expect = 6.233e-61
Identity = 183/694 (26.37%), Postives = 316/694 (45.53%), Query Frame = 2
Query: 2579 SASQNLEP-----HVPKEIPSNPVTLSEFNSILSGSLDKTVVNCNQHVFSHSTFNRPIKCDYCTSHMLGQYYQGVKCKECSFSCHHYCLSNVLNDKCYTRKSAGKGA---NLKNGIGTMYENFIKVPKPGGIRRGWKRQFMALCDLKLFFFDVKEGSTGTQMPDISRNPCRVIDLKYTEFKVVKVSRDEVMHAPKKDVEFIIKISIEN----SSTMLPIYVLFESVDNKEDCIKVIEEARSYIKKDP-HYRMIFTEKSCLNNLDISMNYRQILSAAIIDQSTLLFGTEEGL--LKVTDSGYNKIGEKKPVYIIESLDQQELQLVAVIQSKQRVLKLLLSGILDGAHDWEPIIVENGKSCTTFVVGKSYVSPGNQFAPYADTMLANSTFHIKSPSNDRIWIMCAAFKNSVEVYHLNLKLTRHEKLRQILCNTSVTSLQIAGHGEQLLIGMHDSVAIYSLWETGSPXXXXXXXXXXXXXNFQYIFQTNFESMLIVEISFNEYLILFECAGIFIN-RNHRQTRPDLQWPDKPTRFTYRAPYLLCFTEMAGLFAYEITEHSCNLVQALPLRSSKPLDRSGHILTTANEFIQAIDLIYVHLVSANEEKISIGKTIDKTSSSNTLSIFKFLNKRKPSYNKQEDSFDTNDAISPNPAGNSTKSTGLKYRDKPTLKSNRQISVPQNFRHLSHMGPDVPCQLI 4612
            S + ++EP     H P+ + +  +    +     GS+ +       H F   +F+ P KC+ CTS M+G   QG  C+ C+FSCH  C ++     C   +   KG+   + + GIGT YE +++VPKP G+++GW+R    +CD KLF +++ EG        +S    +VID++  EF V  V   +V+HA +KD+  I +++  +    SS    I +L +S   +   + ++ E    +KK+    R ++  K   ++    +   Q  SAAIID   +  G EEGL  + VT     ++G+ K VY I+ + Q+   L+AVI  K R ++L+    LDG       +VE  K C     G                             N  +  +C A K  +  Y +N     + +LR +    ++  + +   G++L +G       YS+ +     + +   L   D    +I Q N E++  VEIS  E L+ F   G++++   HR  + +L WP  P    Y APYL  ++E A +  +++  ++   +Q +PL+  +PL+  G +       ++ + LIY     A  +++ + +T D++      S          + NK+  SF         P     +      RD P ++ N+ IS P NF H++HMGP    Q++
Sbjct: 1016 SMASDMEPIELIDHQPRSVQTPTMRSGGY-----GSMGRCSPKPKAHQFVVKSFSAPTKCNQCTSLMVGLIRQGCMCEVCNFSCHVTC-ADKAPAVCPVPQDQTKGSLGIDPQRGIGTAYEGYVRVPKPTGVKKGWQRAMAVVCDFKLFLYELGEGKAAQPSVIVS----QVIDMRDEEFSVSSVLASDVIHASRKDIPCIFRVTASHLSASSSQKTSILMLADSDQERNKWVGLLGELHRILKKNKLKDRFVYVPKEAYDSTLPLIKGTQ--SAAIIDHERVALGNEEGLFVIHVTKDEIIRVGDNKKVYQIDPIPQE--HLLAVISGKNRHVRLVPIMALDGRETDCQKLVET-KGCQRIASGPV--------------------------RNGSLMCLCVAMKTKIICYEVNRSKAHYRRLRDVQAPAAIQWMGL--FGDRLYVGYQSGFVRYSIPDN----MAMVSLLHPEDHTLAFIPQQNLEALCAVEISSKELLLCFSSIGVYVDSHGHRSRQQELMWPATPNAACYNAPYLSVYSENA-VDVFDV--NTMEWIQTIPLKKVRPLNVDGSLNLLG---LETVRLIYFRNKMAEGDELVVPETSDQSRKQMVRS----------NNNKRRFSFRV-------PEEERLQQRREMLRD-PEMR-NKLISNPTNFNHVAHMGPGDGIQIL 1637          
BLAST of Serine/threonine kinase vs. Ensembl Medaka
Match: cdc42bpab (CDC42 binding protein kinase alpha [Source:NCBI gene;Acc:101159789])

HSP 1 Score: 473.011 bits (1216), Expect = 1.069e-137
Identity = 287/775 (37.03%), Postives = 445/775 (57.42%), Query Frame = 2
Query:  119 VTLEFLIDSLFCTYYECRLPFHKDEKNVAQFIKSIKGTVDKIESLRIRRSDFDTIRVIGRGAFGKVSVVRFKEKGEIYAMKSLHKYDILKKIDAACFQEERDVLFQAMKIKSPWITRLHYAFQDEFYLYFVMDFYNGGDMLTLLSKFNDRLPEEITKFYIAEVVMSIDVVHKLGYLHRDIKPDNLLLDSLGHIVLADFGSCVKLRPNGTTITERAVGTPDYISPEILRSAE-GHGPYGVECDWWSLGIVIHEMLYGELPFYNEDFSETYWQIMNFETCFQIPTEYDDVSDEAEDLIKQLICKKECRLGNKGIDDFKNHPFFREIDWDNLRSYNAPFIPEVSSAEDTSNFEFDD---FNANHEGPPLSSNFKGCHLPCIGFTFTKDFIFNEMGSEESSVRLKSLMENIGAPA--LLNGNHNESNSDALLEE-----VNQLKITCSQLEKQLNECRTNSVQRIFSHPVYQQLVTDKEKLLTQCQNYDYSLREK--------EQKMDDLIETNRLLNKERDELTSDRLQILQKKQDIEEDLKVMTENFNQLKSTNKAINRXXXXXXXXX---XXXXXXXXXXXXXXXHLSIQKNQSQPDIQVEKQRFEEVMLQLR------SENDQMLEKMRLKCSNLTNSLEQSDQTIFNIKEEIKSLKEIFTNK-------EKNLKLSH-DNEIEQLKISVAEEQSRILASN-TQLKSQVKSLSEENVELRSSLQEISNKNMKF-HFRLKTILDKE--------------IVKTSENSELLTELDR 2287
            +++E L+D L C Y EC     + EKN+ +F+   K    K++ +R+ + DF+ ++VIGRGAFG+V+VV+ K   +++AMK L+K+++LK+ + ACF+EERDVL         WIT LHYAFQD+  LY VMD+Y GGD+LTLLSKF DRLPE++ KFY+AE+V++ID VH+L Y+HRDIKPDN+LLD  GHI LADFGSC+KL  +GT  +  AVGTPDYISPEIL++ E G G YG ECDWWSLG+ ++EMLYGE PFY E   ETY +IMN +  FQ P +  DVS+EA+DLI++LIC +E RLG  GI+DFK HPFF  IDWDN+R+  AP+IPEVSS  DTSNF+ DD    N+    PP  + F G HLP +GFT+T    F++ G       L+ L    G      ++ +      D+L  E     + +L+   ++L ++L+E  T +VQ    HP  +  ++  +++  +    +  + +K        E+K++D+  + R L      + +   Q+    Q+ +E  K + E  ++LKS +K +       +  +    +L       +   + L+ Q    + +++ + Q+ E + L++R       E + + E+   +        E+++Q    ++EE++ LK   +         ++  ++ H   E+E+  +   EE +R  A + T+LK+  K L +   +  +  +EI     K    R ++I+D+E              ++ T EN +L  +LD+
Sbjct:   26 LSVETLLDILVCLYDECNNSPLRREKNILEFLDWAKPFTSKVKQMRLHKEDFEILKVIGRGAFGEVAVVKVKNTDKVFAMKILNKWEMLKRAETACFREERDVLVNG---DCQWITTLHYAFQDDNNLYLVMDYYVGGDLLTLLSKFEDRLPEDMAKFYLAEMVLAIDSVHQLHYVHRDIKPDNILLDKKGHIRLADFGSCLKLMEDGTVQSSVAVGTPDYISPEILQAMEDGKGKYGPECDWWSLGVCMYEMLYGETPFYAESLVETYGKIMNHKERFQFPQQLTDVSEEAKDLIRRLICSREHRLGQNGIEDFKQHPFFSGIDWDNIRTCEAPYIPEVSSPTDTSNFDVDDDCLKNSETMPPPSHTAFSGHHLPFVGFTYTSKCTFSDRGC------LRQLSGERGQTGEDQVDLDVKRRLEDSLATEAYERRIRRLEQEKTELSRKLHES-TQTVQ-ALQHPTTESPLSSTKEVEIRSLKTEIEILKKQIAESGQLEKKLEDVTSSRRDLEDSSKHVRTLEKQLKSLTQERDEMQKDLVEASDRLKSQSKELKEAHSQRKLAMQEFSELNSTLTDLRSAKQRLARQLRDKEEEMETQSQKVEALRLEVRKAERAKKEVEVLAEEHAAEAQKEKKIRERNEQYSRQLEEELEGLKSKQSGSSVTPAAADQTQEVGHLRGEMERKTLLYEEELARREAQHSTELKTLRKELRDAESQQLTLQKEILMLKDKLDQARRRSIIDREEIEMEYKQKYETERVLLTEENKKLSNDLDK 789          

HSP 2 Score: 232.646 bits (592), Expect = 7.152e-61
Identity = 183/694 (26.37%), Postives = 316/694 (45.53%), Query Frame = 2
Query: 2579 SASQNLEP-----HVPKEIPSNPVTLSEFNSILSGSLDKTVVNCNQHVFSHSTFNRPIKCDYCTSHMLGQYYQGVKCKECSFSCHHYCLSNVLNDKCYTRKSAGKGA---NLKNGIGTMYENFIKVPKPGGIRRGWKRQFMALCDLKLFFFDVKEGSTGTQMPDISRNPCRVIDLKYTEFKVVKVSRDEVMHAPKKDVEFIIKISIEN----SSTMLPIYVLFESVDNKEDCIKVIEEARSYIKKDP-HYRMIFTEKSCLNNLDISMNYRQILSAAIIDQSTLLFGTEEGL--LKVTDSGYNKIGEKKPVYIIESLDQQELQLVAVIQSKQRVLKLLLSGILDGAHDWEPIIVENGKSCTTFVVGKSYVSPGNQFAPYADTMLANSTFHIKSPSNDRIWIMCAAFKNSVEVYHLNLKLTRHEKLRQILCNTSVTSLQIAGHGEQLLIGMHDSVAIYSLWETGSPXXXXXXXXXXXXXNFQYIFQTNFESMLIVEISFNEYLILFECAGIFIN-RNHRQTRPDLQWPDKPTRFTYRAPYLLCFTEMAGLFAYEITEHSCNLVQALPLRSSKPLDRSGHILTTANEFIQAIDLIYVHLVSANEEKISIGKTIDKTSSSNTLSIFKFLNKRKPSYNKQEDSFDTNDAISPNPAGNSTKSTGLKYRDKPTLKSNRQISVPQNFRHLSHMGPDVPCQLI 4612
            S + ++EP     H P+ + +  +    +     GS+ +       H F   +F+ P KC+ CTS M+G   QG  C+ C+FSCH  C ++     C   +   KG+   + + GIGT YE +++VPKP G+++GW+R    +CD KLF +++ EG        +S    +VID++  EF V  V   +V+HA +KD+  I +++  +    SS    I +L +S   +   + ++ E    +KK+    R ++  K   ++    +   Q  SAAIID   +  G EEGL  + VT     ++G+ K VY I+ + Q+   L+AVI  K R ++L+    LDG       +VE  K C     G                             N  +  +C A K  +  Y +N     + +LR +    ++  + +   G++L +G       YS+ +     + +   L   D    +I Q N E++  VEIS  E L+ F   G++++   HR  + +L WP  P    Y APYL  ++E A +  +++  ++   +Q +PL+  +PL+  G +       ++ + LIY     A  +++ + +T D++      S          + NK+  SF         P     +      RD P ++ N+ IS P NF H++HMGP    Q++
Sbjct: 1003 SMASDMEPIELIDHQPRSVQTPTMRSGGY-----GSMGRCSPKPKAHQFVVKSFSAPTKCNQCTSLMVGLIRQGCMCEVCNFSCHVTC-ADKAPAVCPVPQDQTKGSLGIDPQRGIGTAYEGYVRVPKPTGVKKGWQRAMAVVCDFKLFLYELGEGKAAQPSVIVS----QVIDMRDEEFSVSSVLASDVIHASRKDIPCIFRVTASHLSASSSQKTSILMLADSDQERNKWVGLLGELHRILKKNKLKDRFVYVPKEAYDSTLPLIKGTQ--SAAIIDHERVALGNEEGLFVIHVTKDEIIRVGDNKKVYQIDPIPQE--HLLAVISGKNRHVRLVPIMALDGRETDCQKLVET-KGCQRIASGPV--------------------------RNGSLMCLCVAMKTKIICYEVNRSKAHYRRLRDVQAPAAIQWMGL--FGDRLYVGYQSGFVRYSIPDN----MAMVSLLHPEDHTLAFIPQQNLEALCAVEISSKELLLCFSSIGVYVDSHGHRSRQQELMWPATPNAACYNAPYLSVYSENA-VDVFDV--NTMEWIQTIPLKKVRPLNVDGSLNLLG---LETVRLIYFRNKMAEGDELVVPETSDQSRKQMVRS----------NNNKRRFSFRV-------PEEERLQQRREMLRD-PEMR-NKLISNPTNFNHVAHMGPGDGIQIL 1624          
BLAST of Serine/threonine kinase vs. Planmine SMEST
Match: SMESG000049701.1 (SMESG000049701.1)

HSP 1 Score: 3165.17 bits (8205), Expect = 0.000e+0
Identity = 1637/1641 (99.76%), Postives = 1640/1641 (99.94%), Query Frame = 2
Query:   32 MSIKLTLKQRHENLIKEFLLNYKSSVPDSVTLEFLIDSLFCTYYECRLPFHKDEKNVAQFIKSIKGTVDKIESLRIRRSDFDTIRVIGRGAFGKVSVVRFKEKGEIYAMKSLHKYDILKKIDAACFQEERDVLFQAMKIKSPWITRLHYAFQDEFYLYFVMDFYNGGDMLTLLSKFNDRLPEEITKFYIAEVVMSIDVVHKLGYLHRDIKPDNLLLDSLGHIVLADFGSCVKLRPNGTTITERAVGTPDYISPEILRSAEGHGPYGVECDWWSLGIVIHEMLYGELPFYNEDFSETYWQIMNFETCFQIPTEYDDVSDEAEDLIKQLICKKECRLGNKGIDDFKNHPFFREIDWDNLRSYNAPFIPEVSSAEDTSNFEFDDFNANHEGPPLSSNFKGCHLPCIGFTFTKDFIFNEMGSEESSVRLKSLMENIGAPALLNGNHNESNSDALLEEVNQLKITCSQLEKQLNECRTNSVQRIFSHPVYQQLVTDKEKLLTQCQNYDYSLREKEQKMDDLIETNRLLNKERDELTSDRLQILQKKQDIEEDLKVMTENFNQLKSTNKAINRXXXXXXXXXXXXXXXXXXXXXXXXHLSIQKNQSQPDIQVEKQRFEEVMLQLRSENDQMLEKMRLKCSNLTNSLEQSDQTIFNIKEEIKSLKEIFTNKEKNLKLSHDNEIEQLKISVAEEQSRILASNTQLKSQVKSLSEENVELRSSLQEISNKNMKFHFRLKTILDKEIVKTSENSELLTELDREVELLKTLCVDNDGDQKAQGERQDNNGNESWRLRKCVKADKIEISNLNLTLQSERRARADLEKKLTQQKSEICDISKQLEKYKQDVNEKDNLIANLKSASQNLEPHVPKEIPSNPVTLSEFNSILSGSLDKTVVNCNQHVFSHSTFNRPIKCDYCTSHMLGQYYQGVKCKECSFSCHHYCLSNVLNDKCYTRKSAGKGANLKNGIGTMYENFIKVPKPGGIRRGWKRQFMALCDLKLFFFDVKEGSTGTQMPDISRNPCRVIDLKYTEFKVVKVSRDEVMHAPKKDVEFIIKISIENSSTMLPIYVLFESVDNKEDCIKVIEEARSYIKKDPHYRMIFTEKSCLNNLDISMNYRQILSAAIIDQSTLLFGTEEGLLKVTDSGYNKIGEKKPVYIIESLDQQELQLVAVIQSKQRVLKLLLSGILDGAHDWEPIIVENGKSCTTFVVGKSYVSPGNQFAPYADTMLANSTFHIKSPSNDRIWIMCAAFKNSVEVYHLNLKLTRHEKLRQILCNTSVTSLQIAGHGEQLLIGMHDSVAIYSLWETGSPXXXXXXXXXXXXXNFQYIFQTNFESMLIVEISFNEYLILFECAGIFINRNHRQTRPDLQWPDKPTRFTYRAPYLLCFTEMAGLFAYEITEHSCNLVQALPLRSSKPLDRSGHILTTANEFIQAIDLIYVHLVSANEEKISIGKTIDKTSSSNTLSIFKFLNKRKPSYNKQEDSFDTNDAISPNPAGNSTKSTGLKYRDKPTLKSNRQISVPQNFRHLSHMGPDVPCQLIDLXXXXXXXXXXXXXXIYLKDVRAQVNQLELDSNSIMTKXXXXXXXXXXXXXXXXXXGRXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQIMADFQLIQSSTINCTPGRSTNANN 4954
            MSIKLTLKQRHENLIKEFLLNYKSSVPDSVTLEFLIDSLFCTYYECRLPFHKDEKNVAQFIKSIKGTVDKIESLRIRRSDFDTIRVIGRGAFGKVSVVRFKEKGEIYAMKSLHKYDILKKIDAACFQEERDVLFQAMKIKSPWITRLHYAFQDEFYLYFVMDFYNGGDMLTLLSKFNDRLPEEITKFYIAEVVMSIDVVHKLGYLHRDIKPDNLLLDSLGHIVLADFGSCVKLRPNGTTITERAVGTPDYISPEILRSAEGHGPYGVECDWWSLGIVIHEMLYGELPFYNEDFSETYWQIMNFETCFQIPTEYDDVSDEAEDLIKQLICKKECRLGNKGIDDFKNHPFFREIDWDNLRSYNAPFIPEVSSAEDTSNFEFDDFNANHEGPPLSSNFKGCHLPCIGFTFTKDFIFNEMGSEESSVRLKSLMENIGAPALLNGNHNESNSDALLEEVNQLKITCSQLEKQLNECRTNSVQRIFSHPVYQQLVTDKEKLLTQCQNYDYSLREKEQK+DDLIETNRLLNK+RDELTSDRLQILQKKQDIEEDLKVMTENFNQLKSTNKAINREKDLLEFELDKLKKQWMKEKEEMKHLS QKNQSQPDIQVEKQRFEEVMLQLRSENDQMLEKMRLKCSNLTNSLEQSDQTIFNIKEEIKSLKEIFTNKEKNLKLSHDNEIEQLKISVAEEQSRILASNTQLKSQVKSLSEENVELRSSLQEISNKNMKFHFRLKTILDKEIVKTSENSELLTELDREVELLKTLCVDNDGDQKAQGERQDNNGNESWRLRKCVKADKIEISNLNLTLQSERRARADLEKKLTQQKSEICDISKQLEKYKQDVNEKDNLIANLKSASQNLEPHVPKEIPSNPVTLSEFNSILSGSLDKTVVNCNQHVFSHSTFNRPIKCDYCTSHMLGQYYQGVKCKECSFSCHHYCLS+VLNDKCYTRKSAGKGANLKNGIGTMYENFIKVPKPGGIRRGWKRQFMALCDLKLFFFDVKEGSTGTQMPDISRNPCRVIDLKYTEFKVVKVSRDEVMHAPKKDVEFIIKISIENSSTMLPIYVLFESVDNKEDCIKVIEEARSYIKKDPHYRMIFTEKSCLNNLDISMNYRQILSAAIIDQSTLLFGTEEGLLKVTDSGYNKIGEKKPVYIIESLDQQELQLVAVIQSKQRVLKLLLSGILDGAHDWEPIIVENGKSCTTFVVGKSYVSPGNQFAPYADTMLANSTFHIKSPSNDRIWIMCAAFKNSVEVYHLNLKLTRHEKLRQILCNTSVTSLQIAGHGEQLLIGMHDSVAIYSLWETGSPLLLIHKDLKDIDINFQYIFQTNFESMLIVEISFNEYLILFECAGIFINRNHRQTRPDLQWPDKPTRFTYRAPYLLCFTEMAGLFAYEITEHSCNLVQALPLRSSKPLDRSGHILTTANEFIQAIDLIYVHLVSANEEKISIGKTIDKTSSSNTLSIFKFLNKRKPSYNKQEDSFDTNDAISPNPAGNSTKSTGLKYRDKPTLKSNRQISVPQNFRHLSHMGPDVPCQLIDLKPKESMKMSDKEKSIYLKDVRAQVNQLELDSNSIMTKSNISQTSQSSMSQALSHSGRSSPSQSVTIPASSSASSDLFLSTSPSFSEQIMADFQLIQSSTINCTPGRSTNANN
Sbjct:    1 MSIKLTLKQRHENLIKEFLLNYKSSVPDSVTLEFLIDSLFCTYYECRLPFHKDEKNVAQFIKSIKGTVDKIESLRIRRSDFDTIRVIGRGAFGKVSVVRFKEKGEIYAMKSLHKYDILKKIDAACFQEERDVLFQAMKIKSPWITRLHYAFQDEFYLYFVMDFYNGGDMLTLLSKFNDRLPEEITKFYIAEVVMSIDVVHKLGYLHRDIKPDNLLLDSLGHIVLADFGSCVKLRPNGTTITERAVGTPDYISPEILRSAEGHGPYGVECDWWSLGIVIHEMLYGELPFYNEDFSETYWQIMNFETCFQIPTEYDDVSDEAEDLIKQLICKKECRLGNKGIDDFKNHPFFREIDWDNLRSYNAPFIPEVSSAEDTSNFEFDDFNANHEGPPLSSNFKGCHLPCIGFTFTKDFIFNEMGSEESSVRLKSLMENIGAPALLNGNHNESNSDALLEEVNQLKITCSQLEKQLNECRTNSVQRIFSHPVYQQLVTDKEKLLTQCQNYDYSLREKEQKIDDLIETNRLLNKDRDELTSDRLQILQKKQDIEEDLKVMTENFNQLKSTNKAINREKDLLEFELDKLKKQWMKEKEEMKHLSTQKNQSQPDIQVEKQRFEEVMLQLRSENDQMLEKMRLKCSNLTNSLEQSDQTIFNIKEEIKSLKEIFTNKEKNLKLSHDNEIEQLKISVAEEQSRILASNTQLKSQVKSLSEENVELRSSLQEISNKNMKFHFRLKTILDKEIVKTSENSELLTELDREVELLKTLCVDNDGDQKAQGERQDNNGNESWRLRKCVKADKIEISNLNLTLQSERRARADLEKKLTQQKSEICDISKQLEKYKQDVNEKDNLIANLKSASQNLEPHVPKEIPSNPVTLSEFNSILSGSLDKTVVNCNQHVFSHSTFNRPIKCDYCTSHMLGQYYQGVKCKECSFSCHHYCLSHVLNDKCYTRKSAGKGANLKNGIGTMYENFIKVPKPGGIRRGWKRQFMALCDLKLFFFDVKEGSTGTQMPDISRNPCRVIDLKYTEFKVVKVSRDEVMHAPKKDVEFIIKISIENSSTMLPIYVLFESVDNKEDCIKVIEEARSYIKKDPHYRMIFTEKSCLNNLDISMNYRQILSAAIIDQSTLLFGTEEGLLKVTDSGYNKIGEKKPVYIIESLDQQELQLVAVIQSKQRVLKLLLSGILDGAHDWEPIIVENGKSCTTFVVGKSYVSPGNQFAPYADTMLANSTFHIKSPSNDRIWIMCAAFKNSVEVYHLNLKLTRHEKLRQILCNTSVTSLQIAGHGEQLLIGMHDSVAIYSLWETGSPLLLIHKDLKDIDINFQYIFQTNFESMLIVEISFNEYLILFECAGIFINRNHRQTRPDLQWPDKPTRFTYRAPYLLCFTEMAGLFAYEITEHSCNLVQALPLRSSKPLDRSGHILTTANEFIQAIDLIYVHLVSANEEKISIGKTIDKTSSSNTLSIFKFLNKRKPSYNKQEDSFDTNDAISPNPAGNSTKSTGLKYRDKPTLKSNRQISVPQNFRHLSHMGPDVPCQLIDLKPKESMKMSDKEKSIYLKDVRAQVNQLELDSNSIMTKSNISQTSQSSMSQALSHSGRSSPSQSVTIPASSSASSDLFLSTSPSFSEQIMADFQLIQSSTINCTPGRSTNANN 1641          
BLAST of Serine/threonine kinase vs. Planmine SMEST
Match: SMESG000049701.1 (SMESG000049701.1)

HSP 1 Score: 3147.84 bits (8160), Expect = 0.000e+0
Identity = 1632/1641 (99.45%), Postives = 1635/1641 (99.63%), Query Frame = 2
Query:   32 MSIKLTLKQRHENLIKEFLLNYKSSVPDSVTLEFLIDSLFCTYYECRLPFHKDEKNVAQFIKSIKGTVDKIESLRIRRSDFDTIRVIGRGAFGKVSVVRFKEKGEIYAMKSLHKYDILKKIDAACFQEERDVLFQAMKIKSPWITRLHYAFQDEFYLYFVMDFYNGGDMLTLLSKFNDRLPEEITKFYIAEVVMSIDVVHKLGYLHRDIKPDNLLLDSLGHIVLADFGSCVKLRPNGTTITERAVGTPDYISPEILRSAEGHGPYGVECDWWSLGIVIHEMLYGELPFYNEDFSETYWQIMNFETCFQIPTEYDDVSDEAEDLIKQLICKKECRLGNKGIDDFKNHPFFREIDWDNLRSYNAPFIPEVSSAEDTSNFEFDDFNANHEGPPLSSNFKGCHLPCIGFTFTKDFIFNEMGSEESSVRLKSLMENIGAPALLNGNHNESNSDALLEEVNQLKITCSQLEKQLNECRTNSVQRIFSHPVYQQLVTDKEKLLTQCQNYDYSLREKEQKMDDLIETNRLLNKERDELTSDRLQILQKKQDIEEDLKVMTENFNQLKSTNKAINRXXXXXXXXXXXXXXXXXXXXXXXXHLSIQKNQSQPDIQVEKQRFEEVMLQLRSENDQMLEKMRLKCSNLTNSLEQSDQTIFNIKEEIKSLKEIFTNKEKNLKLSHDNEIEQLKISVAEEQSRILASNTQLKSQVKSLSEENVELRSSLQEISNKNMKFHFRLKTILDKEIVKTSENSELLTELDREVELLKTLCVDNDGDQKAQGERQDNNGNESWRLRKCVKADKIEISNLNLTLQSERRARADLEKKLTQQKSEICDISKQLEKYKQDVNEKDNLIANLKSASQNLEPHVPKEIPSNPVTLSEFNSILSGSLDKTVVNCNQHVFSHSTFNRPIKCDYCTSHMLGQYYQGVKCKECSFSCHHYCLSNVLNDKCYTRKSAGKGANLKNGIGTMYENFIKVPKPGGIRRGWKRQFMALCDLKLFFFDVKEGSTGTQMPDISRNPCRVIDLKYTEFKVVKVSRDEVMHAPKKDVEFIIKISIENSSTMLPIYVLFESVDNKEDCIKVIEEARSYIKKDPHYRMIFTEKSCLNNLDISMNYRQILSAAIIDQSTLLFGTEEGLLKVTDSGYNKIGEKKPVYIIESLDQQELQLVAVIQSKQRVLKLLLSGILDGAHDWEPIIVENGKSCTTFVVGKSYVSPGNQFAPYADTMLANSTFHIKSPSNDRIWIMCAAFKNSVEVYHLNLKLTRHEKLRQILCNTSVTSLQIAGHGEQLLIGMHDSVAIYSLWETGSPXXXXXXXXXXXXXNFQYIFQTNFESMLIVEISFNEYLILFECAGIFINRNHRQTRPDLQWPDKPTRFTYRAPYLLCFTEMAGLFAYEITEHSCNLVQALPLRSSKPLDRSGHILTTANEFIQAIDLIYVHLVSANEEKISIGKTIDKTSSSNTLSIFKFLNKRKPSYNKQEDSFDTNDAISPNPAGNSTKSTGLKYRDKPTLKSNRQISVPQNFRHLSHMGPDVPCQLIDLXXXXXXXXXXXXXXIYLKDVRAQVNQLELDSNSIMTKXXXXXXXXXXXXXXXXXXGRXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQIMADFQLIQSSTINCTPGRSTNANN 4954
            MSIKLTLKQRHENLIKEFLLNYKSSVPDSVTLEFLIDSLFCTYYECRLPFHKDEKNVAQFIKSIKGTVDKIESLRIRRSDFDTIRVIGRGAFGKVSVVRFKEKGEIYAMKSLHKYDILKKIDAACFQEERDVLFQAMKIKSPWITRLHYAFQDEFYLYFVMDFYNGGDMLTLLSKFNDRLPEEITKFYIAEVVMSIDVVHKLGYLHRDIKPDNLLLDSLGHIVLADFGSCVKLRPNGTTITERAVGTPDYISPEILRSAEGHGPYGVECDWWSLGIVIHEMLYGELPFYNEDFSETYWQIMNFETCFQIPTEYDDVSDEAEDLIKQLICKKECRLGNKGIDDFKNHPFFREIDWDNLRSYNAPFIPEVSSAEDTSNFEFDDFNANHEGPPLSSNFKGCHLPCIGFTFTKDFIFNEMGSEESSVRLKSLMENIGAPALLNGNHNESNSDALLEEVNQLKITCSQLEKQLNECRTNSVQRIFSHPVYQQLVTDKEKLLTQCQNYDYSLREKEQK+DDLIETNRLLNK+RDELTSDRLQILQKKQDIEEDLKVMTENFNQLKSTNKAINREKDLLEFELDKLKKQWMKEKEEMKHLS QKNQSQPDIQVEKQRFEEVMLQLRSENDQMLEKMRLKCSNLTNSLEQSDQTIFNIKEEIKSLKEIFTNKEKNLKLSHDNEIEQLKISVAEEQSRILASNTQLKSQVKSLSEENVELRSSLQEISNKNMKFHFRLKTILDKEIVKTSENSELLTELDREVELLKTLCVDNDGDQKAQGERQDNNGNESWRLRKCVKADKIEISNLNLTLQSERRARADLEKKLTQQKSEICDISKQLEKYKQDVNEKDNLIANLKSASQNLEP     IPSNPVTLSEFNSILSGSLDKTVVNCNQHVFSHSTFNRPIKCDYCTSHMLGQYYQGVKCKECSFSCHHYCLS+VLNDKCYTRKSAGKGANLKNGIGTMYENFIKVPKPGGIRRGWKRQFMALCDLKLFFFDVKEGSTGTQMPDISRNPCRVIDLKYTEFKVVKVSRDEVMHAPKKDVEFIIKISIENSSTMLPIYVLFESVDNKEDCIKVIEEARSYIKKDPHYRMIFTEKSCLNNLDISMNYRQILSAAIIDQSTLLFGTEEGLLKVTDSGYNKIGEKKPVYIIESLDQQELQLVAVIQSKQRVLKLLLSGILDGAHDWEPIIVENGKSCTTFVVGKSYVSPGNQFAPYADTMLANSTFHIKSPSNDRIWIMCAAFKNSVEVYHLNLKLTRHEKLRQILCNTSVTSLQIAGHGEQLLIGMHDSVAIYSLWETGSPLLLIHKDLKDIDINFQYIFQTNFESMLIVEISFNEYLILFECAGIFINRNHRQTRPDLQWPDKPTRFTYRAPYLLCFTEMAGLFAYEITEHSCNLVQALPLRSSKPLDRSGHILTTANEFIQAIDLIYVHLVSANEEKISIGKTIDKTSSSNTLSIFKFLNKRKPSYNKQEDSFDTNDAISPNPAGNSTKSTGLKYRDKPTLKSNRQISVPQNFRHLSHMGPDVPCQLIDLKPKESMKMSDKEKSIYLKDVRAQVNQLELDSNSIMTKSNISQTSQSSMSQALSHSGRSSPSQSVTIPASSSASSDLFLSTSPSFSEQIMADFQLIQSSTINCTPGRSTNANN
Sbjct:    1 MSIKLTLKQRHENLIKEFLLNYKSSVPDSVTLEFLIDSLFCTYYECRLPFHKDEKNVAQFIKSIKGTVDKIESLRIRRSDFDTIRVIGRGAFGKVSVVRFKEKGEIYAMKSLHKYDILKKIDAACFQEERDVLFQAMKIKSPWITRLHYAFQDEFYLYFVMDFYNGGDMLTLLSKFNDRLPEEITKFYIAEVVMSIDVVHKLGYLHRDIKPDNLLLDSLGHIVLADFGSCVKLRPNGTTITERAVGTPDYISPEILRSAEGHGPYGVECDWWSLGIVIHEMLYGELPFYNEDFSETYWQIMNFETCFQIPTEYDDVSDEAEDLIKQLICKKECRLGNKGIDDFKNHPFFREIDWDNLRSYNAPFIPEVSSAEDTSNFEFDDFNANHEGPPLSSNFKGCHLPCIGFTFTKDFIFNEMGSEESSVRLKSLMENIGAPALLNGNHNESNSDALLEEVNQLKITCSQLEKQLNECRTNSVQRIFSHPVYQQLVTDKEKLLTQCQNYDYSLREKEQKIDDLIETNRLLNKDRDELTSDRLQILQKKQDIEEDLKVMTENFNQLKSTNKAINREKDLLEFELDKLKKQWMKEKEEMKHLSTQKNQSQPDIQVEKQRFEEVMLQLRSENDQMLEKMRLKCSNLTNSLEQSDQTIFNIKEEIKSLKEIFTNKEKNLKLSHDNEIEQLKISVAEEQSRILASNTQLKSQVKSLSEENVELRSSLQEISNKNMKFHFRLKTILDKEIVKTSENSELLTELDREVELLKTLCVDNDGDQKAQGERQDNNGNESWRLRKCVKADKIEISNLNLTLQSERRARADLEKKLTQQKSEICDISKQLEKYKQDVNEKDNLIANLKSASQNLEP-----IPSNPVTLSEFNSILSGSLDKTVVNCNQHVFSHSTFNRPIKCDYCTSHMLGQYYQGVKCKECSFSCHHYCLSHVLNDKCYTRKSAGKGANLKNGIGTMYENFIKVPKPGGIRRGWKRQFMALCDLKLFFFDVKEGSTGTQMPDISRNPCRVIDLKYTEFKVVKVSRDEVMHAPKKDVEFIIKISIENSSTMLPIYVLFESVDNKEDCIKVIEEARSYIKKDPHYRMIFTEKSCLNNLDISMNYRQILSAAIIDQSTLLFGTEEGLLKVTDSGYNKIGEKKPVYIIESLDQQELQLVAVIQSKQRVLKLLLSGILDGAHDWEPIIVENGKSCTTFVVGKSYVSPGNQFAPYADTMLANSTFHIKSPSNDRIWIMCAAFKNSVEVYHLNLKLTRHEKLRQILCNTSVTSLQIAGHGEQLLIGMHDSVAIYSLWETGSPLLLIHKDLKDIDINFQYIFQTNFESMLIVEISFNEYLILFECAGIFINRNHRQTRPDLQWPDKPTRFTYRAPYLLCFTEMAGLFAYEITEHSCNLVQALPLRSSKPLDRSGHILTTANEFIQAIDLIYVHLVSANEEKISIGKTIDKTSSSNTLSIFKFLNKRKPSYNKQEDSFDTNDAISPNPAGNSTKSTGLKYRDKPTLKSNRQISVPQNFRHLSHMGPDVPCQLIDLKPKESMKMSDKEKSIYLKDVRAQVNQLELDSNSIMTKSNISQTSQSSMSQALSHSGRSSPSQSVTIPASSSASSDLFLSTSPSFSEQIMADFQLIQSSTINCTPGRSTNANN 1636          
BLAST of Serine/threonine kinase vs. Planmine SMEST
Match: SMESG000041847.1 (SMESG000041847.1)

HSP 1 Score: 315.849 bits (808), Expect = 6.562e-88
Identity = 168/409 (41.08%), Postives = 255/409 (62.35%), Query Frame = 2
Query:   92 NYKSSVPD---SVTLEFLIDSLFCTYYECR----LPFHKDEKNVAQFIKSIKGTVDKIESLRIRRSDFDTIRVIGRGAFGKVSVVRFKEKGEIYAMKSLHKYDILKKIDAACFQEERDVLFQAMKIKSPWITRLHYAFQDEFYLYFVMDFYNGGDMLTLLSKFNDRLPEEITKFYIAEVVMSIDVVHKLGYLHRDIKPDNLLLDSLGHIVLADFGSCVKLRPNGTTIT-ERAVGTPDYISPEILRSAEGHGPYGVECDWWSLGIVIHEMLYGELPFYNEDFSETYWQIMNFETCFQIPTEYDDVSDEAEDLIKQLICKKECRLG-NKGIDDFKNHPFF----REIDWDNLRSYNAPFIPEVSSAEDTSNFEF--DDFNAN-----HEGPPLSSNFKGCHLPCIGFTFTK 1258
            N+++ V D   +++L+ L DS    + +C+    LP +K   N   F K  K   +K+   R++ SDF+ +++IG+GAFG+V +VR K+ G+++A+K L+K  ++       +QEERD++   MKI S WI +LHYAFQD   LY VMD+  GG+++  +SK    L +++  FY AE+V++I+ +H  G++HRDIKPDN+L+D  GHI LADFGSCVK+ P    +   RA+GTPDYISPE+L S   +  YG E DWW+LG++++E+ YGE PFY+++   TY +IM  E     P + D+VS  A D +K+LIC +  RLG  K   D K+H FF    RE  WD ++   +PFIP + +  DTS F+F  DD + N     ++G   S+ F G ++   GF++ +
Sbjct:   13 NFQNVVSDDKENISLDLLFDSFQNLFLDCKSVSNLPTNKYFTN---FYKQHKKVYEKLVDFRMKYSDFNLLKIIGQGAFGQVQLVRHKQTGDLFALKILNKSQVVTCEGTLFWQEERDIM---MKIDSRWIVKLHYAFQDPKRLYMVMDYLPGGNLVNWMSKVEVLLEKDVC-FYAAEIVLAINGLHNFGFVHRDIKPDNILIDIKGHIKLADFGSCVKMDPVTKYVNCNRAIGTPDYISPEVLLSQSDNTKYGKEVDWWALGVMLYEIFYGEPPFYSDNLINTYGKIMTHEQSLSFPPD-DEVSGMALDFMKKLICDRSVRLGQTKDASDIKSHIFFNNSSREWTWDTIQDSTSPFIPVLENDLDTSYFDFGEDDVDTNFLNQSNQGLK-STTFIGENIQFSGFSYIR 412          
BLAST of Serine/threonine kinase vs. Planmine SMEST
Match: SMESG000015619.1 (SMESG000015619.1)

HSP 1 Score: 267.7 bits (683), Expect = 3.402e-78
Identity = 145/355 (40.85%), Postives = 212/355 (59.72%), Query Frame = 2
Query:  230 TVDKIESLRIRRS-----DFDTIRVIGRGAFGKVSVVRFKEKGEIYAMKSLHKYDILKKIDAACFQEERDVLFQAMKIKSPWITRLHYAFQDEFYLYFVMDFYNGGDMLTLLSKFNDRLPEEITKFYIAEVVMSIDVVHKLGYLHRDIKPDNLLLDSLGHIVLADFGSCVKLRPNGTT---------------------------------ITERAVGTPDYISPEILRSAEGHGPYGVECDWWSLGIVIHEMLYGELPFYNEDFSETYWQIMNFETCFQIPTEYDDVSDEAEDLIKQLICKKECRLGNK-GIDDFKNHPFFREIDWDNLRSYNAPFIPEVSSAEDTSNFEFDDF 1177
            T+ + E LR++R+     DF  ++VIGRGAFG+V++V+ K+ G IYAMK L K ++++K   A  + ERD+L    K+ +PW+ ++ Y+FQD  +LY VM+F  GGD++ LL K  D   EE T+FYI+E +++ID +HKLG++HRDIKPDNLLLDS GHI L+DFG C  L+ +  T                                 +    VGTPDYI+PE+ +       Y   CDWWSLG+++ EML G  PF +E   ETY +++++      P E   +S +A  +I  L C+ E RLG+K G+DDF++  FF+ IDW+++R   A    ++ S +D SN  FDDF
Sbjct:  102 TLKESEYLRLKRAKLNFNDFQIVKVIGRGAFGEVALVQKKDNGYIYAMKILRKCNMIEKDQIAHVRAERDIL---TKVNNPWVVKMFYSFQDSHFLYLVMEFLPGGDLMNLLIKM-DTFTEEQTQFYISETILAIDSIHKLGFIHRDIKPDNLLLDSKGHIKLSDFGLCTGLKKSHRTEFYKDLSKAKPCDFTNSIQSKKKVESWKKTRRKLAYSTVGTPDYIAPEVFQRI----GYTNACDWWSLGVIMFEMLIGYPPFCSESPGETYLKVISWRESLIFPAEM-PISSQACSVINLLCCEHENRLGSKHGVDDFRSLEFFKNIDWEHIRERPAAIHVKIRSIDDVSN--FDDF 445          
BLAST of Serine/threonine kinase vs. Planmine SMEST
Match: SMESG000015619.1 (SMESG000015619.1)

HSP 1 Score: 267.314 bits (682), Expect = 6.023e-78
Identity = 145/355 (40.85%), Postives = 212/355 (59.72%), Query Frame = 2
Query:  230 TVDKIESLRIRRS-----DFDTIRVIGRGAFGKVSVVRFKEKGEIYAMKSLHKYDILKKIDAACFQEERDVLFQAMKIKSPWITRLHYAFQDEFYLYFVMDFYNGGDMLTLLSKFNDRLPEEITKFYIAEVVMSIDVVHKLGYLHRDIKPDNLLLDSLGHIVLADFGSCVKLRPNGTT---------------------------------ITERAVGTPDYISPEILRSAEGHGPYGVECDWWSLGIVIHEMLYGELPFYNEDFSETYWQIMNFETCFQIPTEYDDVSDEAEDLIKQLICKKECRLGNK-GIDDFKNHPFFREIDWDNLRSYNAPFIPEVSSAEDTSNFEFDDF 1177
            T+ + E LR++R+     DF  ++VIGRGAFG+V++V+ K+ G IYAMK L K ++++K   A  + ERD+L    K+ +PW+ ++ Y+FQD  +LY VM+F  GGD++ LL K  D   EE T+FYI+E +++ID +HKLG++HRDIKPDNLLLDS GHI L+DFG C  L+ +  T                                 +    VGTPDYI+PE+ +       Y   CDWWSLG+++ EML G  PF +E   ETY +++++      P E   +S +A  +I  L C+ E RLG+K G+DDF++  FF+ IDW+++R   A    ++ S +D SN  FDDF
Sbjct:  106 TLKESEYLRLKRAKLNFNDFQIVKVIGRGAFGEVALVQKKDNGYIYAMKILRKCNMIEKDQIAHVRAERDIL---TKVNNPWVVKMFYSFQDSHFLYLVMEFLPGGDLMNLLIKM-DTFTEEQTQFYISETILAIDSIHKLGFIHRDIKPDNLLLDSKGHIKLSDFGLCTGLKKSHRTEFYKDLSKAKPCDFTNSIQSKKKVESWKKTRRKLAYSTVGTPDYIAPEVFQRI----GYTNACDWWSLGVIMFEMLIGYPPFCSESPGETYLKVISWRESLIFPAEM-PISSQACSVINLLCCEHENRLGSKHGVDDFRSLEFFKNIDWEHIRERPAAIHVKIRSIDDVSN--FDDF 449          
The following BLAST results are available for this feature:
BLAST of Serine/threonine kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CDC42BPA0.000e+031.20CDC42 binding protein kinase alpha [Source:HGNC Sy... [more]
CDC42BPB0.000e+029.48CDC42 binding protein kinase beta [Source:HGNC Sym... [more]
CDC42BPA6.784e-13542.73CDC42 binding protein kinase alpha [Source:HGNC Sy... [more]
CDC42BPA1.047e-13442.73CDC42 binding protein kinase alpha [Source:HGNC Sy... [more]
CDC42BPA1.453e-13442.73CDC42 binding protein kinase alpha [Source:HGNC Sy... [more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mrck-10.000e+029.96Serine/threonine-protein kinase mrck-1 [Source:Un... [more]
mrck-10.000e+029.96Serine/threonine-protein kinase mrck-1 [Source:Un... [more]
mrck-10.000e+029.86Serine/threonine-protein kinase mrck-1 [Source:Un... [more]
mrck-10.000e+029.86Serine/threonine-protein kinase mrck-1 [Source:Un... [more]
let-5027.598e-9840.72Rho-associated protein kinase let-502 [Source:Uni... [more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gek0.000e+030.57gene:FBgn0023081 transcript:FBtr0072287[more]
Rok2.172e-10437.39gene:FBgn0026181 transcript:FBtr0074286[more]
Rok2.297e-10437.39gene:FBgn0026181 transcript:FBtr0340152[more]
Rok2.630e-10437.39gene:FBgn0026181 transcript:FBtr0340153[more]
Rok5.729e-10437.39gene:FBgn0026181 transcript:FBtr0340151[more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cdc42bpaa6.122e-14035.08CDC42 binding protein kinase alpha (DMPK-like) a [... [more]
cdc42bpb2.218e-13736.29CDC42 binding protein kinase beta (DMPK-like) [Sou... [more]
cdc42bpab1.222e-13649.57CDC42 binding protein kinase alpha (DMPK-like) b [... [more]
CU929346.11.568e-11347.16pep chromosome:GRCz11:10:360237:373575:-1 gene:ENS... [more]
rock19.345e-10842.02Rho-associated, coiled-coil containing protein kin... [more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CDC42BPA0.000e+031.98CDC42 binding protein kinase alpha [Source:NCBI ge... [more]
CDC42BPA0.000e+032.14CDC42 binding protein kinase alpha [Source:NCBI ge... [more]
CDC42BPA0.000e+032.10CDC42 binding protein kinase alpha [Source:NCBI ge... [more]
CDC42BPA0.000e+031.74CDC42 binding protein kinase alpha [Source:NCBI ge... [more]
CDC42BPA0.000e+032.27CDC42 binding protein kinase alpha [Source:NCBI ge... [more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cdc42bpa0.000e+031.45CDC42 binding protein kinase alpha [Source:MGI Sym... [more]
Cdc42bpa0.000e+031.60CDC42 binding protein kinase alpha [Source:MGI Sym... [more]
Cdc42bpa0.000e+030.90CDC42 binding protein kinase alpha [Source:MGI Sym... [more]
Cdc42bpa0.000e+030.14CDC42 binding protein kinase alpha [Source:MGI Sym... [more]
Cdc42bpb0.000e+029.37CDC42 binding protein kinase beta [Source:MGI Symb... [more]
back to top
BLAST of Serine/threonine kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q3UU96|MRCKA_MOUSE0.000e+030.90Serine/threonine-protein kinase MRCK alpha OS=Mus ... [more]
sp|Q9Y5S2|MRCKB_HUMAN0.000e+029.48Serine/threonine-protein kinase MRCK beta OS=Homo ... [more]
sp|O01583|MRCK_CAEEL0.000e+029.86Serine/threonine-protein kinase mrck-1 OS=Caenorha... [more]
sp|Q9W1B0|GEK_DROME0.000e+030.57Serine/threonine-protein kinase Genghis Khan OS=Dr... [more]
sp|Q7TT49|MRCKB_RAT0.000e+029.54Serine/threonine-protein kinase MRCK beta OS=Rattu... [more]
back to top
BLAST of Serine/threonine kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2MD180.000e+034.32Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4S2MD130.000e+034.32Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A504YH180.000e+034.15CDC42BPB protein OS=Fasciola gigantica OX=46835 GN... [more]
A0A3Q0KR060.000e+031.70Serine/threonine kinase OS=Schistosoma mansoni OX=... [more]
A0A074ZJE80.000e+033.12Kinase domain protein OS=Opisthorchis viverrini OX... [more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cdc42bpaa0.000e+031.23CDC42 binding protein kinase alpha (DMPK-like) a [... [more]
cdc42bpb0.000e+029.98CDC42 binding protein kinase beta (DMPK-like) [Sou... [more]
cdc42bpb0.000e+030.06CDC42 binding protein kinase beta (DMPK-like) [Sou... [more]
cdc42bpb5.003e-12936.63CDC42 binding protein kinase beta (DMPK-like) [Sou... [more]
cdc42bpb6.313e-12936.59CDC42 binding protein kinase beta (DMPK-like) [Sou... [more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000004595.12.553e-10637.94pep scaffold:Pmarinus_7.0:GL477044:11103:63873:-1 ... [more]
ENSPMAT00000003561.14.196e-10542.75pep scaffold:Pmarinus_7.0:GL478057:5187:43749:1 ge... [more]
ENSPMAT00000006413.16.492e-8844.38pep scaffold:Pmarinus_7.0:GL485553:3974:11158:-1 g... [more]
stk38l3.530e-7040.00serine/threonine kinase 38 like [Source:ZFIN;Acc:Z... [more]
ENSPMAT00000000997.12.143e-6228.77pep scaffold:Pmarinus_7.0:GL485486:573:10798:1 gen... [more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
TPK33.459e-6038.56cAMP-dependent protein kinase catalytic subunit; p... [more]
TPK19.441e-5937.05cAMP-dependent protein kinase catalytic subunit; p... [more]
YPK11.924e-5840.07S/T protein kinase; phosphorylates, downregulates ... [more]
YPK25.355e-5840.40Protein kinase similar to S/T protein kinase Ypk1p... [more]
TPK28.203e-5536.18cAMP-dependent protein kinase catalytic subunit; p... [more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO376772.232e-9741.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO320082.338e-8246.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO427003.728e-7740.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO360341.721e-7036.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO378002.955e-5839.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cdc42bpab0.000e+029.99CDC42 binding protein kinase alpha [Source:NCBI ge... [more]
cdc42bpb0.000e+029.78CDC42 binding protein kinase beta [Source:NCBI gen... [more]
cdc42bpb0.000e+029.63CDC42 binding protein kinase beta [Source:NCBI gen... [more]
cdc42bpab9.632e-13837.03CDC42 binding protein kinase alpha [Source:NCBI ge... [more]
cdc42bpab1.069e-13737.03CDC42 binding protein kinase alpha [Source:NCBI ge... [more]
back to top
BLAST of Serine/threonine kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000049701.10.000e+099.76SMESG000049701.1[more]
SMESG000049701.10.000e+099.45SMESG000049701.1[more]
SMESG000041847.16.562e-8841.08SMESG000041847.1[more]
SMESG000015619.13.402e-7840.85SMESG000015619.1[more]
SMESG000015619.16.023e-7840.85SMESG000015619.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024442 ID=SMED30024442|Name=Serine/threonine kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=5530bp
ATTTTTCTCAAATTTAAAAATTTTGATTTAGATGTCTATAAAATTAACAT
TAAAGCAACGGCATGAAAATCTAATTAAAGAATTTCTACTAAATTATAAA
TCATCTGTTCCAGATTCAGTTACATTAGAATTCCTCATTGATTCTTTGTT
TTGTACATATTATGAATGCAGACTACCTTTTCACAAAGATGAAAAAAATG
TCGCCCAATTTATAAAATCAATTAAAGGAACTGTCGATAAAATAGAGTCT
CTTCGAATTCGGAGAAGTGATTTTGATACAATTCGTGTTATCGGCCGAGG
TGCATTTGGAAAAGTTTCTGTAGTGAGATTTAAAGAAAAAGGCGAAATAT
ATGCCATGAAATCGCTGCATAAATATGATATATTAAAGAAAATAGATGCA
GCATGTTTTCAAGAAGAAAGAGATGTTCTATTTCAAGCAATGAAAATCAA
GTCGCCATGGATTACTCGATTACATTATGCTTTTCAGGATGAATTCTATT
TGTATTTTGTCATGGATTTCTATAACGGAGGTGACATGCTGACGTTGTTG
TCAAAATTCAACGATCGTCTGCCAGAAGAAATAACCAAATTCTATATCGC
AGAGGTCGTCATGTCTATTGATGTGGTGCACAAATTGGGATATTTGCACC
GAGACATTAAGCCCGACAATTTGCTATTAGACAGTCTCGGTCACATTGTG
TTGGCTGATTTTGGTTCTTGTGTAAAACTACGACCGAACGGTACGACAAT
AACTGAACGTGCAGTCGGGACTCCGGATTATATTTCACCGGAAATACTCA
GATCTGCCGAGGGTCATGGCCCTTACGGTGTTGAATGTGATTGGTGGTCT
TTAGGTATTGTCATCCATGAGATGCTATACGGCGAATTGCCATTCTACAA
TGAAGATTTCTCTGAAACCTATTGGCAGATTATGAATTTTGAGACTTGCT
TCCAAATTCCAACTGAGTATGACGATGTCTCTGACGAGGCGGAAGATTTG
ATCAAACAATTGATATGTAAAAAAGAATGCAGGCTCGGAAATAAAGGCAT
TGACGATTTTAAGAACCATCCATTTTTCCGGGAAATAGACTGGGATAATC
TTCGATCTTACAATGCGCCGTTTATTCCTGAAGTTTCAAGTGCAGAAGAT
ACCTCGAATTTCGAATTCGATGACTTCAATGCAAATCATGAAGGCCCTCC
GCTATCTTCAAATTTTAAAGGGTGTCATTTACCTTGCATTGGGTTCACAT
TTACGAAAGATTTCATTTTTAATGAAATGGGATCAGAGGAGTCATCAGTT
CGTCTAAAGAGTCTGATGGAAAATATTGGGGCTCCTGCGTTATTGAACGG
AAATCACAATGAATCTAATTCAGACGCGCTTCTCGAGGAAGTTAATCAAC
TGAAAATAACATGTTCTCAATTAGAGAAGCAGTTGAATGAATGCCGTACC
AACAGCGTGCAGAGGATATTTTCCCATCCAGTATACCAACAATTGGTTAC
CGACAAAGAAAAGCTTTTAACTCAATGTCAGAATTATGATTATTCGTTGA
GAGAAAAGGAACAAAAGATGGATGACCTCATCGAAACCAATAGACTTCTA
AATAAGGAACGTGATGAGCTGACAAGCGATCGGTTACAGATCCTTCAAAA
GAAACAAGATATTGAAGAAGATTTGAAAGTAATGACAGAAAATTTCAACC
AACTGAAATCTACCAACAAAGCTATCAATAGAGAAAAAGATCTCTTGGAA
TTCGAACTCGACAAATTGAAGAAGCAATGGATGAAAGAGAAGGAAGAAAT
GAAACATTTGAGCATTCAGAAAAATCAAAGTCAACCCGATATACAGGTGG
AAAAACAAAGATTTGAAGAAGTGATGCTTCAGTTACGTTCGGAAAATGAT
CAAATGCTGGAGAAGATGCGACTGAAATGTTCAAATTTAACAAATTCTTT
GGAACAGAGTGATCAGACGATTTTCAATATCAAGGAAGAAATTAAAAGTC
TGAAAGAGATTTTCACAAACAAAGAAAAGAATCTTAAGCTCAGTCATGAC
AATGAAATAGAACAGCTCAAAATCTCTGTCGCCGAAGAACAGTCGCGAAT
TCTAGCCAGCAATACTCAGCTCAAGAGCCAGGTAAAGTCTCTCAGTGAAG
AAAATGTTGAATTAAGAAGCAGCTTACAAGAAATATCCAACAAGAACATG
AAATTCCATTTCAGATTGAAAACGATACTCGATAAAGAGATTGTCAAGAC
GAGTGAAAATTCTGAACTACTGACAGAGCTCGATAGAGAGGTGGAACTAT
TGAAAACACTATGTGTTGACAACGACGGGGATCAGAAAGCCCAGGGCGAG
AGACAGGATAACAATGGCAATGAATCATGGCGACTCAGGAAATGTGTCAA
AGCAGATAAAATCGAAATTTCCAATCTGAATTTAACCCTTCAATCAGAGC
GACGAGCTCGAGCGGATTTAGAGAAGAAATTAACTCAACAGAAATCCGAA
ATCTGTGATATCAGCAAGCAACTCGAGAAGTACAAACAAGACGTAAATGA
AAAAGACAATTTGATAGCCAATTTAAAAAGCGCTTCACAGAATCTCGAAC
CGCATGTCCCAAAGGAGATACCTTCGAATCCTGTCACCCTTTCCGAATTC
AACAGCATTTTGTCAGGATCTCTTGATAAGACGGTCGTTAATTGTAATCA
ACACGTGTTCAGTCATTCAACTTTCAATCGGCCAATCAAATGTGATTATT
GCACGAGTCATATGCTGGGACAATACTATCAAGGAGTAAAGTGCAAAGAG
TGCTCATTTTCGTGCCACCATTACTGTTTGTCAAATGTATTGAATGACAA
ATGCTACACCAGAAAATCAGCTGGGAAAGGTGCAAATTTGAAAAATGGAA
TCGGAACAATGTATGAGAACTTTATTAAGGTTCCGAAACCCGGTGGAATT
AGACGAGGATGGAAACGGCAATTTATGGCTTTGTGTGATTTAAAATTGTT
TTTCTTCGATGTTAAAGAAGGCTCTACCGGAACTCAAATGCCGGATATCA
GTAGGAATCCGTGCCGAGTGATAGATTTAAAGTATACTGAATTTAAAGTT
GTCAAGGTATCACGAGATGAAGTTATGCACGCACCAAAAAAAGATGTTGA
GTTCATTATTAAAATTTCTATTGAAAATTCATCTACAATGTTACCAATTT
ACGTTCTGTTTGAGAGCGTCGACAACAAAGAAGATTGCATTAAAGTCATC
GAGGAGGCAAGAAGCTATATAAAGAAAGATCCTCACTATCGAATGATTTT
CACGGAGAAGAGTTGCCTAAATAATCTTGATATATCTATGAACTATCGAC
AAATACTCAGTGCTGCCATTATTGATCAGTCTACTTTGTTGTTTGGCACA
GAAGAAGGGTTGCTCAAGGTCACTGATTCAGGATACAACAAGATCGGGGA
AAAGAAGCCTGTTTATATCATTGAAAGCCTAGATCAGCAAGAATTACAAT
TGGTTGCTGTTATTCAATCCAAGCAAAGAGTTCTGAAGTTATTACTTTCT
GGAATTTTGGATGGTGCGCATGATTGGGAACCAATTATCGTAGAGAACGG
TAAATCTTGTACTACATTTGTCGTGGGAAAGAGCTATGTCTCTCCCGGTA
ATCAGTTTGCTCCGTATGCCGATACAATGCTCGCCAATAGTACATTCCAT
ATCAAATCTCCATCAAACGACCGTATTTGGATTATGTGCGCAGCATTCAA
GAACTCTGTGGAGGTTTATCACTTGAATTTGAAATTGACACGTCACGAAA
AGTTGCGGCAAATCCTGTGTAATACTTCGGTAACCTCATTACAAATCGCT
GGACATGGAGAGCAACTGTTGATAGGAATGCATGATTCAGTTGCTATATA
CAGTTTATGGGAAACCGGTTCTCCACTTTTATTAATACACAAAGACCTTA
AGGATATCGATATTAATTTTCAATATATCTTCCAAACGAACTTCGAATCA
ATGCTCATTGTGGAGATCTCATTTAATGAATATTTGATACTTTTTGAATG
TGCTGGAATATTTATCAACAGAAACCATCGACAAACTCGGCCAGATCTTC
AATGGCCAGATAAGCCGACACGATTTACGTATCGTGCTCCATACTTACTC
TGCTTTACAGAAATGGCCGGGTTATTTGCATACGAAATAACGGAACATTC
TTGCAACCTTGTCCAAGCGTTGCCATTGCGTTCCTCTAAACCATTAGACA
GATCGGGTCACATCCTTACAACAGCCAATGAATTCATTCAAGCTATTGAC
CTTATCTATGTTCACTTGGTGTCAGCCAATGAAGAGAAAATATCAATCGG
CAAAACCATTGACAAAACCAGTTCAAGCAACACTTTGTCAATATTCAAAT
TTCTGAACAAAAGGAAACCATCATATAACAAACAAGAAGATTCATTTGAC
ACCAATGATGCTATATCTCCCAATCCAGCAGGCAATTCAACCAAATCCAC
GGGCTTAAAATATAGAGATAAACCTACTCTGAAATCAAATCGTCAAATTT
CAGTTCCTCAGAATTTCCGTCATTTGAGCCACATGGGCCCAGATGTTCCA
TGTCAGCTTATAGATTTGAAACCCAAAGAGTCAATGAAGATGTCGGATAA
AGAAAAATCGATATATCTAAAAGATGTTCGTGCTCAAGTTAATCAGTTGG
AACTTGATTCAAATAGCATAATGACAAAGTCAAATATTTCACAAACATCA
CAGTCAAGCATGAGTCAAGCTTTGAGCCACAGTGGCAGATCTTCTCCTAG
CCAATCAGTTACTATTCCAGCCAGTAGTTCTGCATCCTCAGATTTATTTT
TATCTACTTCCCCTTCGTTCTCAGAACAAATTATGGCTGACTTTCAACTG
ATTCAGAGCTCAACTATCAACTGTACTCCGGGAAGATCAACAAATGCCAA
TAACTGATATTATCGATTGCGCTCTATCTGTGTGTGTGTGTGAGTAAATG
AGTATAATCATTGTCCTGGAATAGCAAGCAGAATGATCCTGTTGTGATTG
GATGCTGCGATTGATCGAATAAAAATGAACATTGATGTTGATTGGTGCTC
GATTGTTCACCAGTGCTCTTGTGTATCCAATAGGATTGCTCGGTCATTGC
TGACGCCGTGATACAATACAATACCACTTATACATACATATAATATATCG
ATATAGTGATAGATTTGTTTGCTTGATTATTATTGATATATTGATCTGTA
CAGTTTGTTCATTTAGATGATAAATTTGCTTTTTGTGCATGTATTTCTAT
CTGACAATGTCTGTATGCGCGTGTGTGTGTCTGTGTGTGTGTCGGTGTAC
AGATTGGCCGTGACCGTAATGATTTATTGTATCATTATGTTTTTGATGAT
TTCCTTGATTCATTTGTTTATGGACTGTGTTGTATTTTACCTAATATTAC
TTTCATTTCGATTTGCTAAGCACTTCAATTGATTTATTATTATTGATTAA
TTATTATTGACTTAATATTTACTATTTTTG
back to top

protein sequence of SMED30024442-orf-1

>SMED30024442-orf-1 ID=SMED30024442-orf-1|Name=SMED30024442-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1642bp
MSIKLTLKQRHENLIKEFLLNYKSSVPDSVTLEFLIDSLFCTYYECRLPF
HKDEKNVAQFIKSIKGTVDKIESLRIRRSDFDTIRVIGRGAFGKVSVVRF
KEKGEIYAMKSLHKYDILKKIDAACFQEERDVLFQAMKIKSPWITRLHYA
FQDEFYLYFVMDFYNGGDMLTLLSKFNDRLPEEITKFYIAEVVMSIDVVH
KLGYLHRDIKPDNLLLDSLGHIVLADFGSCVKLRPNGTTITERAVGTPDY
ISPEILRSAEGHGPYGVECDWWSLGIVIHEMLYGELPFYNEDFSETYWQI
MNFETCFQIPTEYDDVSDEAEDLIKQLICKKECRLGNKGIDDFKNHPFFR
EIDWDNLRSYNAPFIPEVSSAEDTSNFEFDDFNANHEGPPLSSNFKGCHL
PCIGFTFTKDFIFNEMGSEESSVRLKSLMENIGAPALLNGNHNESNSDAL
LEEVNQLKITCSQLEKQLNECRTNSVQRIFSHPVYQQLVTDKEKLLTQCQ
NYDYSLREKEQKMDDLIETNRLLNKERDELTSDRLQILQKKQDIEEDLKV
MTENFNQLKSTNKAINREKDLLEFELDKLKKQWMKEKEEMKHLSIQKNQS
QPDIQVEKQRFEEVMLQLRSENDQMLEKMRLKCSNLTNSLEQSDQTIFNI
KEEIKSLKEIFTNKEKNLKLSHDNEIEQLKISVAEEQSRILASNTQLKSQ
VKSLSEENVELRSSLQEISNKNMKFHFRLKTILDKEIVKTSENSELLTEL
DREVELLKTLCVDNDGDQKAQGERQDNNGNESWRLRKCVKADKIEISNLN
LTLQSERRARADLEKKLTQQKSEICDISKQLEKYKQDVNEKDNLIANLKS
ASQNLEPHVPKEIPSNPVTLSEFNSILSGSLDKTVVNCNQHVFSHSTFNR
PIKCDYCTSHMLGQYYQGVKCKECSFSCHHYCLSNVLNDKCYTRKSAGKG
ANLKNGIGTMYENFIKVPKPGGIRRGWKRQFMALCDLKLFFFDVKEGSTG
TQMPDISRNPCRVIDLKYTEFKVVKVSRDEVMHAPKKDVEFIIKISIENS
STMLPIYVLFESVDNKEDCIKVIEEARSYIKKDPHYRMIFTEKSCLNNLD
ISMNYRQILSAAIIDQSTLLFGTEEGLLKVTDSGYNKIGEKKPVYIIESL
DQQELQLVAVIQSKQRVLKLLLSGILDGAHDWEPIIVENGKSCTTFVVGK
SYVSPGNQFAPYADTMLANSTFHIKSPSNDRIWIMCAAFKNSVEVYHLNL
KLTRHEKLRQILCNTSVTSLQIAGHGEQLLIGMHDSVAIYSLWETGSPLL
LIHKDLKDIDINFQYIFQTNFESMLIVEISFNEYLILFECAGIFINRNHR
QTRPDLQWPDKPTRFTYRAPYLLCFTEMAGLFAYEITEHSCNLVQALPLR
SSKPLDRSGHILTTANEFIQAIDLIYVHLVSANEEKISIGKTIDKTSSSN
TLSIFKFLNKRKPSYNKQEDSFDTNDAISPNPAGNSTKSTGLKYRDKPTL
KSNRQISVPQNFRHLSHMGPDVPCQLIDLKPKESMKMSDKEKSIYLKDVR
AQVNQLELDSNSIMTKSNISQTSQSSMSQALSHSGRSSPSQSVTIPASSS
ASSDLFLSTSPSFSEQIMADFQLIQSSTINCTPGRSTNANN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000961AGC-kinase_C
IPR000719Prot_kinase_dom
IPR002219PE/DAG-bd
IPR000095CRIB_dom
IPR001180CNH_dom
IPR017441Protein_kinase_ATP_BS
IPR008271Ser/Thr_kinase_AS
IPR011993PH-like_dom_sf
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0004674protein serine/threonine kinase activity
GO:0005524ATP binding
GO:0004672protein kinase activity
GO:0000166nucleotide binding
GO:0004697protein kinase C activity
GO:0016301kinase activity
GO:0016740transferase activity
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0035556intracellular signal transduction
GO:0016310phosphorylation
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 796..823
NoneNo IPR availableCOILSCoilCoilcoord: 541..596
NoneNo IPR availableCOILSCoilCoilcoord: 506..533
NoneNo IPR availableCOILSCoilCoilcoord: 447..474
NoneNo IPR availableCOILSCoilCoilcoord: 608..660
NoneNo IPR availableCOILSCoilCoilcoord: 831..854
NoneNo IPR availableCOILSCoilCoilcoord: 694..721
NoneNo IPR availableGENE3DG3DSA:3.30.60.20coord: 878..952
e-value: 5.1E-11
score: 44.1
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 168..369
e-value: 2.9E-159
score: 531.8
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 29..408
e-value: 2.9E-159
score: 531.8
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1470..1492
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1564..1596
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1466..1492
NoneNo IPR availablePANTHERPTHR22988:SF66SERINE/THREONINE-PROTEIN KINASE GENGHIS KHANcoord: 20..850
NoneNo IPR availablePANTHERPTHR22988MYOTONIC DYSTROPHY S/T KINASE-RELATEDcoord: 858..1532
NoneNo IPR availablePANTHERPTHR22988:SF66SERINE/THREONINE-PROTEIN KINASE GENGHIS KHANcoord: 858..1532
NoneNo IPR availablePANTHERPTHR22988MYOTONIC DYSTROPHY S/T KINASE-RELATEDcoord: 20..850
NoneNo IPR availablePRODOMPD936484coord: 452..859
e-value: 0.006
score: 102.0
NoneNo IPR availableCDDcd00132CRIBcoord: 1505..1521
e-value: 1.41773E-4
score: 38.9589
NoneNo IPR availableSUPERFAMILYSSF57889Cysteine-rich domaincoord: 879..938
NoneNo IPR availableSUPERFAMILYSSF50729PH domain-likecoord: 969..1085
IPR000961AGC-kinase, C-terminalSMARTSM00133pkinase_C_6coord: 350..409
e-value: 5.4E-10
score: 49.2
IPR000961AGC-kinase, C-terminalPROSITEPS51285AGC_KINASE_CTERcoord: 350..417
score: 12.749
IPR002219Protein kinase C-like, phorbol ester/diacylglycerol-binding domainSMARTSM00109c1_12coord: 891..941
e-value: 1.6E-7
score: 41.0
IPR002219Protein kinase C-like, phorbol ester/diacylglycerol-binding domainPFAMPF00130C1_1coord: 891..938
e-value: 2.0E-7
score: 30.8
IPR002219Protein kinase C-like, phorbol ester/diacylglycerol-binding domainPROSITEPS00479ZF_DAG_PE_1coord: 891..941
IPR002219Protein kinase C-like, phorbol ester/diacylglycerol-binding domainPROSITEPS50081ZF_DAG_PE_2coord: 890..941
score: 12.385
IPR002219Protein kinase C-like, phorbol ester/diacylglycerol-binding domainCDDcd00029C1coord: 891..938
e-value: 1.78217E-12
score: 61.354
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 81..349
e-value: 5.4E-81
score: 285.0
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 82..349
e-value: 4.1E-52
score: 177.2
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 81..349
score: 43.184
IPR001180Citron homology (CNH) domainPFAMPF00780CNHcoord: 1111..1378
e-value: 1.1E-17
score: 64.6
IPR001180Citron homology (CNH) domainPROSITEPS50219CNHcoord: 1105..1412
score: 14.515
IPR011993PH-like domain superfamilyGENE3DG3DSA:2.30.29.30coord: 960..1077
e-value: 1.0E-20
score: 76.2
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 204..216
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 87..110
IPR000095CRIB domainPROSITEPS50108CRIBcoord: 1506..1519
score: 8.537
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 78..394