Family with sequence similarity 135 member A

Overview
NameFamily with sequence similarity 135 member A
Smed IDSMED30024423
Length (bp)3682
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Family with sequence similarity 135 member A (SMED30024423) t-SNE clustered cells

Violin plots show distribution of expression levels for Family with sequence similarity 135 member A (SMED30024423) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Family with sequence similarity 135 member A (SMED30024423) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Family with sequence similarity 135 member A (SMED30024423) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024423

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30024423SMESG000040644.1 dd_Smed_v4_4890_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30024423SMESG000040644.1 dd_Smed_v4_4890_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30024423SMESG000040644.1 dd_Smed_v4_4890_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30024423SMESG000040644.1 dd_Smed_v4_4890_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30024423SMESG000040644.1 dd_Smed_v4_4890_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
whole organismSMED30024423SMESG000040644.1 dd_Smed_v4_4890_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Family with sequence similarity 135 member A vs. Ensembl Human
Match: FAM135A (family with sequence similarity 135 member A [Source:HGNC Symbol;Acc:HGNC:21084])

HSP 1 Score: 311.612 bits (797), Expect = 2.752e-88
Identity = 158/304 (51.97%), Postives = 209/304 (68.75%), Query Frame = 2
Query: 2552 QFQGNVYSEMSNIPASKKPYFSHRDSDELSASSSLHYIICVHGLDGEHRDLRLVKAYLSLALPEQRFEFLMSEANEPNTFADIDEMKELLVDEILEKIQDLRENPDKISFIGHSLGCLLIRAAIASPRLSKLVPKFHTFLSLGGPHLGTLYGSSVLVNVGLWVMQKVRKSICLQQLALKDSPTDLRRSYLYRLSGQSGLEHFKYILLASSSQDRYVPYHSTRIELCKAAVKDNSELGIVYMEMVTKILQRLLRSGKTTVIRYDAHYTLPRSANNYIGRAAHIALIDSELFLEKFISVSAAKYFR 3463
            +  G +YSE+  + AS  PYFS  + D   +   +H I+CVHGLDG   DLRLVK Y+ L LP  R +FLMSE N+ +TFAD D M + L+DEI++ IQ       KISFIGHSLG L+IR+ +  PR    + K HTFLSL GPHLGTLY SS LVN GLW MQK +KS  L QL  +D  +D R+++LY+LS ++GL +FK ++L  S QDRYVPYHS RIE+CK A+KD    G +Y EM+  +L+ +L+S    ++RY+    LP +A++ IGRAAHIA++DSE+FLEKF  V+A KYF+
Sbjct:  797 KLPGFMYSEVP-LLASSVPYFSVEEED--GSEDGVHLIVCVHGLDGNSADLRLVKTYIELGLPGGRIDFLMSERNQNDTFADFDSMTDRLLDEIIQYIQIYSLTVSKISFIGHSLGNLIIRSVLTRPRFKYYLNKLHTFLSLSGPHLGTLYNSSALVNTGLWFMQKWKKSGSLLQLTCRDH-SDPRQTFLYKLSNKAGLHYFKNVVLVGSLQDRYVPYHSARIEMCKTALKDKQS-GQIYSEMIHNLLRPVLQSKDCNLVRYNVINALPNTADSLIGRAAHIAVLDSEIFLEKFFLVAALKYFQ 1095          

HSP 2 Score: 128.642 bits (322), Expect = 2.763e-29
Identity = 99/386 (25.65%), Postives = 181/386 (46.89%), Query Frame = 2
Query:  125 MSIVQVALSFAVEIWKFHNIDLFHQGAFQIRSYFKTTSSSPALIENPKIWDRSKSINFPECTKPSFVSSSDPKLNLPAKAVSKSVLIIYKEESLRMYDIFEQTMHLQMDALSIEEQIYKSEIILVVELWF--GEKRNEIIEEMRCVCERQLKVHLIASQGLHHHITVIFDYYYLAAVELVVHASLVSISPCYLRLP---QTSANEADSNFERNVSLYQSWHSILFT-------STKNC------GRRHAACLVHNHLCQLLLAVIDSLMSTFQDALSFFSPDQRSQIDDKLHAQLCPAQSKSINVLADWMKFAPNELERLAFILQSQTSEDDIADQASIDITKLSSRIVVIFNEFLKTSSFHQNYVESLSLRTHKLRIKRFSEAFF 1228
            M+ VQ  + F+VE+ KF+N+DLF +G +QIR+  K  S  P  +E   +     ++ FP     S +              SK+  I+YK E + + D+    + + +D   IEE + +   +L ++L F  G+   + +  ++ +  R LK+H    +GLHHH+ V+FDY++L+ V + VHASLV++    +  P   +T+    ++  +   S+  +  S++F        S   C         H A   H  LC  LL     L S F          Q+ ++++             ++V A         L  L   ++   + D++A+  ++++ +L S ++ ++ +FL+  + H+     L+   H LR++RFSEAFF
Sbjct:    1 MTEVQAMVEFSVELNKFYNVDLFQRGFYQIRASMKIPSRIPHRVEASLLHATGMTLAFPASVHDSLI-------------CSKTFQILYKNEEVVLNDVMIFKVKMLLDERKIEETLEEMNFLLSLDLHFTDGDYSADDLNALQLISSRTLKLHFSPHRGLHHHVNVMFDYFHLSVVSVTVHASLVALHQPLISFPRPVKTTWLNRNAPAQNKDSVIPTLESVVFGINYTKQLSPDGCSFIIADSFLHHAYRFHYTLCATLLLAFKGLHSYFITVTEEIPSCQKLELEE-------------MDVEA--------RLTELCEEVKKIENPDELAELINMNLAQLCSLLMALWGQFLEVITLHEELRILLAQEHHTLRVRRFSEAFF 352          
BLAST of Family with sequence similarity 135 member A vs. Ensembl Human
Match: FAM135A (family with sequence similarity 135 member A [Source:HGNC Symbol;Acc:HGNC:21084])

HSP 1 Score: 312.768 bits (800), Expect = 1.151e-87
Identity = 163/318 (51.26%), Postives = 214/318 (67.30%), Query Frame = 2
Query: 2510 FYQLKAKLMTDLSPQFQGNVYSEMSNIPASKKPYFSHRDSDELSASSSLHYIICVHGLDGEHRDLRLVKAYLSLALPEQRFEFLMSEANEPNTFADIDEMKELLVDEILEKIQDLRENPDKISFIGHSLGCLLIRAAIASPRLSKLVPKFHTFLSLGGPHLGTLYGSSVLVNVGLWVMQKVRKSICLQQLALKDSPTDLRRSYLYRLSGQSGLEHFKYILLASSSQDRYVPYHSTRIELCKAAVKDNSELGIVYMEMVTKILQRLLRSGKTTVIRYDAHYTLPRSANNYIGRAAHIALIDSELFLEKFISVSAAKYFR 3463
            F Q K +L     P F   +YSE+  + AS  PYFS  + D   +   +H I+CVHGLDG   DLRLVK Y+ L LP  R +FLMSE N+ +TFAD D M + L+DEI++ IQ       KISFIGHSLG L+IR+ +  PR    + K HTFLSL GPHLGTLY SS LVN GLW MQK +KS  L QL  +D  +D R+++LY+LS ++GL +FK ++L  S QDRYVPYHS RIE+CK A+KD    G +Y EM+  +L+ +L+S    ++RY+    LP +A++ IGRAAHIA++DSE+FLEKF  V+A KYF+
Sbjct:  993 FLQAKEELKLLKLPGF---MYSEVP-LLASSVPYFSVEEED--GSEDGVHLIVCVHGLDGNSADLRLVKTYIELGLPGGRIDFLMSERNQNDTFADFDSMTDRLLDEIIQYIQIYSLTVSKISFIGHSLGNLIIRSVLTRPRFKYYLNKLHTFLSLSGPHLGTLYNSSALVNTGLWFMQKWKKSGSLLQLTCRDH-SDPRQTFLYKLSNKAGLHYFKNVVLVGSLQDRYVPYHSARIEMCKTALKDKQS-GQIYSEMIHNLLRPVLQSKDCNLVRYNVINALPNTADSLIGRAAHIAVLDSEIFLEKFFLVAALKYFQ 1302          

HSP 2 Score: 92.0485 bits (227), Expect = 5.756e-18
Identity = 79/313 (25.24%), Postives = 148/313 (47.28%), Query Frame = 2
Query:  368 SKSVLIIYKEESLRMYDIFEQTMHLQMDALSIEEQIYKSEIILVVELWF--GEKRNEIIEEMRCVCERQLKVHLIASQGLHHHITVIFDYYYLAAVELVVHASLVSISPCYLRLP---QTSANEADSNFERNVSLYQSWHSILFT-------STKNC------GRRHAACLVHNHLCQLLLAVIDSLMSTFQDALSFFSPDQRSQIDDKLHAQLC--------PAQSKSINVLADWMKFAPNELERLAFILQSQTSEDDIADQASIDITKLSSRIVVIFNEFLKTSSFHQNYVESLSLRTHKLRIKRFSEAFF 1228
             K+  I+YK E + + D+    + + +D   IEE + +   +L ++L F  G+   + +  ++ +  R LK+H    +GLHHH+ V+FDY++L+ V + VHASLV++    +  P   +T+    ++  +   S+  +  S++F        S   C         H A   H  LC  LL     L S F          Q+ ++  K + QL           +++  N L +    A   L  L   ++   + D++A+  ++++ +L S ++ ++ +FL+  + H+     L+   H LR++RFSEAFF
Sbjct:   26 GKTFQILYKNEEVVLNDVMIFKVKMLLDERKIEETLEEMNFLLSLDLHFTDGDYSADDLNALQLISSRTLKLHFSPHRGLHHHVNVMFDYFHLSVVSVTVHASLVALHQPLISFPRPVKTTWLNRNAPAQNKDSVIPTLESVVFGINYTKQLSPDGCSFIIADSFLHHAYRFHYTLCATLLLAFKGLHSYFITVTEEIPSCQKLEL-AKANMQLLYERLLRRKQLRTQKDNHLEEMDVEA--RLTELCEEVKKIENPDELAELINMNLAQLCSLLMALWGQFLEVITLHEELRILLAQEHHTLRVRRFSEAFF 335          
BLAST of Family with sequence similarity 135 member A vs. Ensembl Human
Match: FAM135A (family with sequence similarity 135 member A [Source:HGNC Symbol;Acc:HGNC:21084])

HSP 1 Score: 312.383 bits (799), Expect = 1.918e-87
Identity = 158/304 (51.97%), Postives = 209/304 (68.75%), Query Frame = 2
Query: 2552 QFQGNVYSEMSNIPASKKPYFSHRDSDELSASSSLHYIICVHGLDGEHRDLRLVKAYLSLALPEQRFEFLMSEANEPNTFADIDEMKELLVDEILEKIQDLRENPDKISFIGHSLGCLLIRAAIASPRLSKLVPKFHTFLSLGGPHLGTLYGSSVLVNVGLWVMQKVRKSICLQQLALKDSPTDLRRSYLYRLSGQSGLEHFKYILLASSSQDRYVPYHSTRIELCKAAVKDNSELGIVYMEMVTKILQRLLRSGKTTVIRYDAHYTLPRSANNYIGRAAHIALIDSELFLEKFISVSAAKYFR 3463
            +  G +YSE+  + AS  PYFS  + D   +   +H I+CVHGLDG   DLRLVK Y+ L LP  R +FLMSE N+ +TFAD D M + L+DEI++ IQ       KISFIGHSLG L+IR+ +  PR    + K HTFLSL GPHLGTLY SS LVN GLW MQK +KS  L QL  +D  +D R+++LY+LS ++GL +FK ++L  S QDRYVPYHS RIE+CK A+KD    G +Y EM+  +L+ +L+S    ++RY+    LP +A++ IGRAAHIA++DSE+FLEKF  V+A KYF+
Sbjct: 1021 KLPGFMYSEVP-LLASSVPYFSVEEED--GSEDGVHLIVCVHGLDGNSADLRLVKTYIELGLPGGRIDFLMSERNQNDTFADFDSMTDRLLDEIIQYIQIYSLTVSKISFIGHSLGNLIIRSVLTRPRFKYYLNKLHTFLSLSGPHLGTLYNSSALVNTGLWFMQKWKKSGSLLQLTCRDH-SDPRQTFLYKLSNKAGLHYFKNVVLVGSLQDRYVPYHSARIEMCKTALKDKQS-GQIYSEMIHNLLRPVLQSKDCNLVRYNVINALPNTADSLIGRAAHIAVLDSEIFLEKFFLVAALKYFQ 1319          

HSP 2 Score: 128.642 bits (322), Expect = 3.048e-29
Identity = 99/386 (25.65%), Postives = 181/386 (46.89%), Query Frame = 2
Query:  125 MSIVQVALSFAVEIWKFHNIDLFHQGAFQIRSYFKTTSSSPALIENPKIWDRSKSINFPECTKPSFVSSSDPKLNLPAKAVSKSVLIIYKEESLRMYDIFEQTMHLQMDALSIEEQIYKSEIILVVELWF--GEKRNEIIEEMRCVCERQLKVHLIASQGLHHHITVIFDYYYLAAVELVVHASLVSISPCYLRLP---QTSANEADSNFERNVSLYQSWHSILFT-------STKNC------GRRHAACLVHNHLCQLLLAVIDSLMSTFQDALSFFSPDQRSQIDDKLHAQLCPAQSKSINVLADWMKFAPNELERLAFILQSQTSEDDIADQASIDITKLSSRIVVIFNEFLKTSSFHQNYVESLSLRTHKLRIKRFSEAFF 1228
            M+ VQ  + F+VE+ KF+N+DLF +G +QIR+  K  S  P  +E   +     ++ FP     S +              SK+  I+YK E + + D+    + + +D   IEE + +   +L ++L F  G+   + +  ++ +  R LK+H    +GLHHH+ V+FDY++L+ V + VHASLV++    +  P   +T+    ++  +   S+  +  S++F        S   C         H A   H  LC  LL     L S F          Q+ ++++             ++V A         L  L   ++   + D++A+  ++++ +L S ++ ++ +FL+  + H+     L+   H LR++RFSEAFF
Sbjct:    1 MTEVQAMVEFSVELNKFYNVDLFQRGFYQIRASMKIPSRIPHRVEASLLHATGMTLAFPASVHDSLI-------------CSKTFQILYKNEEVVLNDVMIFKVKMLLDERKIEETLEEMNFLLSLDLHFTDGDYSADDLNALQLISSRTLKLHFSPHRGLHHHVNVMFDYFHLSVVSVTVHASLVALHQPLISFPRPVKTTWLNRNAPAQNKDSVIPTLESVVFGINYTKQLSPDGCSFIIADSFLHHAYRFHYTLCATLLLAFKGLHSYFITVTEEIPSCQKLELEE-------------MDVEA--------RLTELCEEVKKIENPDELAELINMNLAQLCSLLMALWGQFLEVITLHEELRILLAQEHHTLRVRRFSEAFF 352          
BLAST of Family with sequence similarity 135 member A vs. Ensembl Human
Match: FAM135A (family with sequence similarity 135 member A [Source:HGNC Symbol;Acc:HGNC:21084])

HSP 1 Score: 313.153 bits (801), Expect = 3.182e-87
Identity = 163/318 (51.26%), Postives = 215/318 (67.61%), Query Frame = 2
Query: 2510 FYQLKAKLMTDLSPQFQGNVYSEMSNIPASKKPYFSHRDSDELSASSSLHYIICVHGLDGEHRDLRLVKAYLSLALPEQRFEFLMSEANEPNTFADIDEMKELLVDEILEKIQDLRENPDKISFIGHSLGCLLIRAAIASPRLSKLVPKFHTFLSLGGPHLGTLYGSSVLVNVGLWVMQKVRKSICLQQLALKDSPTDLRRSYLYRLSGQSGLEHFKYILLASSSQDRYVPYHSTRIELCKAAVKDNSELGIVYMEMVTKILQRLLRSGKTTVIRYDAHYTLPRSANNYIGRAAHIALIDSELFLEKFISVSAAKYFR 3463
            F Q K +L     P F   +YSE+  + AS  PYFS  + D   +   +H I+CVHGLDG   DLRLVK Y+ L LP  R +FLMSE N+ +TFAD D M + L+DEI++ IQ       KISFIGHSLG L+IR+ +  PR    + K HTFLSL GPHLGTLY SS LVN GLW MQK +KS  L QL  +D  +D R+++LY+LS ++GL +FK ++L  S QDRYVPYHS RIE+CK A+KD  + G +Y EM+  +L+ +L+S    ++RY+    LP +A++ IGRAAHIA++DSE+FLEKF  V+A KYF+
Sbjct: 1206 FLQAKEELKLLKLPGF---MYSEVP-LLASSVPYFSVEEED--GSEDGVHLIVCVHGLDGNSADLRLVKTYIELGLPGGRIDFLMSERNQNDTFADFDSMTDRLLDEIIQYIQIYSLTVSKISFIGHSLGNLIIRSVLTRPRFKYYLNKLHTFLSLSGPHLGTLYNSSALVNTGLWFMQKWKKSGSLLQLTCRDH-SDPRQTFLYKLSNKAGLHYFKNVVLVGSLQDRYVPYHSARIEMCKTALKDK-QSGQIYSEMIHNLLRPVLQSKDCNLVRYNVINALPNTADSLIGRAAHIAVLDSEIFLEKFFLVAALKYFQ 1515          

HSP 2 Score: 128.257 bits (321), Expect = 4.350e-29
Identity = 99/386 (25.65%), Postives = 181/386 (46.89%), Query Frame = 2
Query:  125 MSIVQVALSFAVEIWKFHNIDLFHQGAFQIRSYFKTTSSSPALIENPKIWDRSKSINFPECTKPSFVSSSDPKLNLPAKAVSKSVLIIYKEESLRMYDIFEQTMHLQMDALSIEEQIYKSEIILVVELWF--GEKRNEIIEEMRCVCERQLKVHLIASQGLHHHITVIFDYYYLAAVELVVHASLVSISPCYLRLP---QTSANEADSNFERNVSLYQSWHSILFT-------STKNC------GRRHAACLVHNHLCQLLLAVIDSLMSTFQDALSFFSPDQRSQIDDKLHAQLCPAQSKSINVLADWMKFAPNELERLAFILQSQTSEDDIADQASIDITKLSSRIVVIFNEFLKTSSFHQNYVESLSLRTHKLRIKRFSEAFF 1228
            M+ VQ  + F+VE+ KF+N+DLF +G +QIR+  K  S  P  +E   +     ++ FP     S +              SK+  I+YK E + + D+    + + +D   IEE + +   +L ++L F  G+   + +  ++ +  R LK+H    +GLHHH+ V+FDY++L+ V + VHASLV++    +  P   +T+    ++  +   S+  +  S++F        S   C         H A   H  LC  LL     L S F          Q+ ++++             ++V A         L  L   ++   + D++A+  ++++ +L S ++ ++ +FL+  + H+     L+   H LR++RFSEAFF
Sbjct:    1 MTEVQAMVEFSVELNKFYNVDLFQRGFYQIRASMKIPSRIPHRVEASLLHATGMTLAFPASVHDSLI-------------CSKTFQILYKNEEVVLNDVMIFKVKMLLDERKIEETLEEMNFLLSLDLHFTDGDYSADDLNALQLISSRTLKLHFSPHRGLHHHVNVMFDYFHLSVVSVTVHASLVALHQPLISFPRPVKTTWLNRNAPAQNKDSVIPTLESVVFGINYTKQLSPDGCSFIIADSFLHHAYRFHYTLCATLLLAFKGLHSYFITVTEEIPSCQKLELEE-------------MDVEA--------RLTELCEEVKKIENPDELAELINMNLAQLCSLLMALWGQFLEVITLHEELRILLAQEHHTLRVRRFSEAFF 352          
BLAST of Family with sequence similarity 135 member A vs. Ensembl Human
Match: FAM135A (family with sequence similarity 135 member A [Source:HGNC Symbol;Acc:HGNC:21084])

HSP 1 Score: 313.153 bits (801), Expect = 3.182e-87
Identity = 163/318 (51.26%), Postives = 215/318 (67.61%), Query Frame = 2
Query: 2510 FYQLKAKLMTDLSPQFQGNVYSEMSNIPASKKPYFSHRDSDELSASSSLHYIICVHGLDGEHRDLRLVKAYLSLALPEQRFEFLMSEANEPNTFADIDEMKELLVDEILEKIQDLRENPDKISFIGHSLGCLLIRAAIASPRLSKLVPKFHTFLSLGGPHLGTLYGSSVLVNVGLWVMQKVRKSICLQQLALKDSPTDLRRSYLYRLSGQSGLEHFKYILLASSSQDRYVPYHSTRIELCKAAVKDNSELGIVYMEMVTKILQRLLRSGKTTVIRYDAHYTLPRSANNYIGRAAHIALIDSELFLEKFISVSAAKYFR 3463
            F Q K +L     P F   +YSE+  + AS  PYFS  + D   +   +H I+CVHGLDG   DLRLVK Y+ L LP  R +FLMSE N+ +TFAD D M + L+DEI++ IQ       KISFIGHSLG L+IR+ +  PR    + K HTFLSL GPHLGTLY SS LVN GLW MQK +KS  L QL  +D  +D R+++LY+LS ++GL +FK ++L  S QDRYVPYHS RIE+CK A+KD  + G +Y EM+  +L+ +L+S    ++RY+    LP +A++ IGRAAHIA++DSE+FLEKF  V+A KYF+
Sbjct: 1206 FLQAKEELKLLKLPGF---MYSEVP-LLASSVPYFSVEEED--GSEDGVHLIVCVHGLDGNSADLRLVKTYIELGLPGGRIDFLMSERNQNDTFADFDSMTDRLLDEIIQYIQIYSLTVSKISFIGHSLGNLIIRSVLTRPRFKYYLNKLHTFLSLSGPHLGTLYNSSALVNTGLWFMQKWKKSGSLLQLTCRDH-SDPRQTFLYKLSNKAGLHYFKNVVLVGSLQDRYVPYHSARIEMCKTALKDK-QSGQIYSEMIHNLLRPVLQSKDCNLVRYNVINALPNTADSLIGRAAHIAVLDSEIFLEKFFLVAALKYFQ 1515          

HSP 2 Score: 128.257 bits (321), Expect = 4.350e-29
Identity = 99/386 (25.65%), Postives = 181/386 (46.89%), Query Frame = 2
Query:  125 MSIVQVALSFAVEIWKFHNIDLFHQGAFQIRSYFKTTSSSPALIENPKIWDRSKSINFPECTKPSFVSSSDPKLNLPAKAVSKSVLIIYKEESLRMYDIFEQTMHLQMDALSIEEQIYKSEIILVVELWF--GEKRNEIIEEMRCVCERQLKVHLIASQGLHHHITVIFDYYYLAAVELVVHASLVSISPCYLRLP---QTSANEADSNFERNVSLYQSWHSILFT-------STKNC------GRRHAACLVHNHLCQLLLAVIDSLMSTFQDALSFFSPDQRSQIDDKLHAQLCPAQSKSINVLADWMKFAPNELERLAFILQSQTSEDDIADQASIDITKLSSRIVVIFNEFLKTSSFHQNYVESLSLRTHKLRIKRFSEAFF 1228
            M+ VQ  + F+VE+ KF+N+DLF +G +QIR+  K  S  P  +E   +     ++ FP     S +              SK+  I+YK E + + D+    + + +D   IEE + +   +L ++L F  G+   + +  ++ +  R LK+H    +GLHHH+ V+FDY++L+ V + VHASLV++    +  P   +T+    ++  +   S+  +  S++F        S   C         H A   H  LC  LL     L S F          Q+ ++++             ++V A         L  L   ++   + D++A+  ++++ +L S ++ ++ +FL+  + H+     L+   H LR++RFSEAFF
Sbjct:    1 MTEVQAMVEFSVELNKFYNVDLFQRGFYQIRASMKIPSRIPHRVEASLLHATGMTLAFPASVHDSLI-------------CSKTFQILYKNEEVVLNDVMIFKVKMLLDERKIEETLEEMNFLLSLDLHFTDGDYSADDLNALQLISSRTLKLHFSPHRGLHHHVNVMFDYFHLSVVSVTVHASLVALHQPLISFPRPVKTTWLNRNAPAQNKDSVIPTLESVVFGINYTKQLSPDGCSFIIADSFLHHAYRFHYTLCATLLLAFKGLHSYFITVTEEIPSCQKLELEE-------------MDVEA--------RLTELCEEVKKIENPDELAELINMNLAQLCSLLMALWGQFLEVITLHEELRILLAQEHHTLRVRRFSEAFF 352          
BLAST of Family with sequence similarity 135 member A vs. Ensembl Celegans
Match: C09D4.4 (pep chromosome:WBcel235:I:5479550:5484643:-1 gene:WBGene00015635.1 transcript:C09D4.4b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C09D4.4)

HSP 1 Score: 152.91 bits (385), Expect = 2.028e-37
Identity = 103/339 (30.38%), Postives = 177/339 (52.21%), Query Frame = 2
Query: 2525 AKLMTDLSPQFQGNVYSEMSNIPASKKPYFSHRDSD------ELSASSSLHYIICVHGLDGEHRDLRLVKAYLSLALP--------EQR--------FEFLMSEANEPNTFADIDEMKELLVDEILEKIQDLRENPDKISFIGHSLGCLLIRAAIA-SP--RLSKLVPKFHTFLSLGGPHLGTLYGSSVLVNVGLWVMQKVRKSICLQQLALKDSPTDLRRSYLYRLSGQSGLEHFKYILLASSSQDRYVPYHSTRIELCKAAVKDNSELGIVYMEMVTKILQRLLRSGKT-TVIRYDAHYTLPRSANNYI-GRAAHIALIDSELFLEKFISVSAAKYF 3460
            AK M      ++G++YSE S   ++  P  +   S        + + +  H ++ VHGL+G   DL   +  L  A+         E R        FE+LMS AN   T+ADI  M   L+ E+ E +++ R +  +ISF+ HSLG +++R+A+  +P   +  ++ + +T +++  PHLG  Y     ++ G+  ++  +KS  ++QL+ +DS  D   S++Y+ S  +    FK ILL  +  D+ VPY S+ +   K + +D S+ G  Y EM+T  L  +  S K+  ++RY   + L  S    I GRAAH+  ++  +F+EK  ++SA +YF
Sbjct:  579 AKKMLRQQTNYEGHLYSEQSG-RSTAGPVCTPIKSSLVIGDPVVRSKNKTHLVVFVHGLEGSQEDLVPFRCGLDQAIAAHYHCIQMEGRDFDEEPWAFEYLMSSANRSQTWADITTMAHNLLSEVREYVEEARNDIQRISFLAHSLGGVIVRSAVGLAPEVEMQWMIDRCYTLMTINSPHLGLAYVQK-HIHWGVQFVKWWKKSRSMEQLSFRDS-VDFASSFVYKTSLNNACGKFKNILLVGTPHDQLVPYMSSLLVPSKISSEDQSQFGEAYREMMTACLSSIQNSEKSENLVRYTTFHQLGSSNTQKITGRAAHVIALEDSVFIEKLFNISAVRYF 914          
BLAST of Family with sequence similarity 135 member A vs. Ensembl Celegans
Match: C09D4.4 (pep chromosome:WBcel235:I:5479550:5484643:-1 gene:WBGene00015635.1 transcript:C09D4.4c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C09D4.4)

HSP 1 Score: 152.91 bits (385), Expect = 2.124e-37
Identity = 103/339 (30.38%), Postives = 177/339 (52.21%), Query Frame = 2
Query: 2525 AKLMTDLSPQFQGNVYSEMSNIPASKKPYFSHRDSD------ELSASSSLHYIICVHGLDGEHRDLRLVKAYLSLALP--------EQR--------FEFLMSEANEPNTFADIDEMKELLVDEILEKIQDLRENPDKISFIGHSLGCLLIRAAIA-SP--RLSKLVPKFHTFLSLGGPHLGTLYGSSVLVNVGLWVMQKVRKSICLQQLALKDSPTDLRRSYLYRLSGQSGLEHFKYILLASSSQDRYVPYHSTRIELCKAAVKDNSELGIVYMEMVTKILQRLLRSGKT-TVIRYDAHYTLPRSANNYI-GRAAHIALIDSELFLEKFISVSAAKYF 3460
            AK M      ++G++YSE S   ++  P  +   S        + + +  H ++ VHGL+G   DL   +  L  A+         E R        FE+LMS AN   T+ADI  M   L+ E+ E +++ R +  +ISF+ HSLG +++R+A+  +P   +  ++ + +T +++  PHLG  Y     ++ G+  ++  +KS  ++QL+ +DS  D   S++Y+ S  +    FK ILL  +  D+ VPY S+ +   K + +D S+ G  Y EM+T  L  +  S K+  ++RY   + L  S    I GRAAH+  ++  +F+EK  ++SA +YF
Sbjct:  580 AKKMLRQQTNYEGHLYSEQSG-RSTAGPVCTPIKSSLVIGDPVVRSKNKTHLVVFVHGLEGSQEDLVPFRCGLDQAIAAHYHCIQMEGRDFDEEPWAFEYLMSSANRSQTWADITTMAHNLLSEVREYVEEARNDIQRISFLAHSLGGVIVRSAVGLAPEVEMQWMIDRCYTLMTINSPHLGLAYVQK-HIHWGVQFVKWWKKSRSMEQLSFRDS-VDFASSFVYKTSLNNACGKFKNILLVGTPHDQLVPYMSSLLVPSKISSEDQSQFGEAYREMMTACLSSIQNSEKSENLVRYTTFHQLGSSNTQKITGRAAHVIALEDSVFIEKLFNISAVRYF 915          
BLAST of Family with sequence similarity 135 member A vs. Ensembl Celegans
Match: C09D4.4 (pep chromosome:WBcel235:I:5479550:5484643:-1 gene:WBGene00015635.1 transcript:C09D4.4a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C09D4.4)

HSP 1 Score: 152.91 bits (385), Expect = 2.357e-37
Identity = 103/339 (30.38%), Postives = 177/339 (52.21%), Query Frame = 2
Query: 2525 AKLMTDLSPQFQGNVYSEMSNIPASKKPYFSHRDSD------ELSASSSLHYIICVHGLDGEHRDLRLVKAYLSLALP--------EQR--------FEFLMSEANEPNTFADIDEMKELLVDEILEKIQDLRENPDKISFIGHSLGCLLIRAAIA-SP--RLSKLVPKFHTFLSLGGPHLGTLYGSSVLVNVGLWVMQKVRKSICLQQLALKDSPTDLRRSYLYRLSGQSGLEHFKYILLASSSQDRYVPYHSTRIELCKAAVKDNSELGIVYMEMVTKILQRLLRSGKT-TVIRYDAHYTLPRSANNYI-GRAAHIALIDSELFLEKFISVSAAKYF 3460
            AK M      ++G++YSE S   ++  P  +   S        + + +  H ++ VHGL+G   DL   +  L  A+         E R        FE+LMS AN   T+ADI  M   L+ E+ E +++ R +  +ISF+ HSLG +++R+A+  +P   +  ++ + +T +++  PHLG  Y     ++ G+  ++  +KS  ++QL+ +DS  D   S++Y+ S  +    FK ILL  +  D+ VPY S+ +   K + +D S+ G  Y EM+T  L  +  S K+  ++RY   + L  S    I GRAAH+  ++  +F+EK  ++SA +YF
Sbjct:  577 AKKMLRQQTNYEGHLYSEQSG-RSTAGPVCTPIKSSLVIGDPVVRSKNKTHLVVFVHGLEGSQEDLVPFRCGLDQAIAAHYHCIQMEGRDFDEEPWAFEYLMSSANRSQTWADITTMAHNLLSEVREYVEEARNDIQRISFLAHSLGGVIVRSAVGLAPEVEMQWMIDRCYTLMTINSPHLGLAYVQK-HIHWGVQFVKWWKKSRSMEQLSFRDS-VDFASSFVYKTSLNNACGKFKNILLVGTPHDQLVPYMSSLLVPSKISSEDQSQFGEAYREMMTACLSSIQNSEKSENLVRYTTFHQLGSSNTQKITGRAAHVIALEDSVFIEKLFNISAVRYF 912          
BLAST of Family with sequence similarity 135 member A vs. Ensembl Fly
Match: CG32333 (gene:FBgn0052333 transcript:FBtr0331863)

HSP 1 Score: 337.035 bits (863), Expect = 1.254e-95
Identity = 162/303 (53.47%), Postives = 217/303 (71.62%), Query Frame = 2
Query: 2552 QFQGNVYSEMSNIPASKKPYFSHRDSDELSASSSLHYIICVHGLDGEHRDLRLVKAYLSLALPEQRFEFLMSEANEPNTFADIDEMKELLVDEILEKIQDLRENPDKISFIGHSLGCLLIRAAIASPRLSKLVPKFHTFLSLGGPHLGTLYGSSVLVNVGLWVMQKVRKSICLQQLALKDSPTDLRRSYLYRLSGQSGLEHFKYILLASSSQDRYVPYHSTRIELCKAAVKDNSELGIVYMEMVTKILQRLLRSGKTTVIRYDAHYTLPRSANNYIGRAAHIALIDSELFLEKFISVSAAKYF 3460
            ++QG++YS+   + AS+ PYF   D     + + +H +ICVHGLDG   DLRLV+ YL L LP    EFLMSE N+ +TF+D D M + LV EIL  I     NP +ISF+ HSLG +++R+A+A P++  L+P+ HTFLSL GPHLGTLY +S LVN+G+W MQK +KS  L QL ++D+ TD+R S+LYRLS +S L HFK ILL  SSQDRYVP HS R+ELCKAA++D+S LG +Y EMV  I+  +L   + T+ R+D H+ LP +AN  IGRAAHIA++DSELF+EKF+ ++  KYF
Sbjct: 1198 KYQGSIYSDYVQL-ASELPYFYISDEYRAFSPNGMHLVICVHGLDGNSADLRLVRTYLELGLPGVNLEFLMSERNQGDTFSDFDTMTDRLVTEILYHIDSCALNPARISFVAHSLGTIIVRSALARPQMRPLLPRLHTFLSLSGPHLGTLYNTSGLVNMGMWFMQKWKKSGSLLQLCMRDT-TDMRNSFLYRLSQRSTLHHFKNILLCGSSQDRYVPAHSARLELCKAAMRDSSSLGTIYREMVHNIIAPILARPELTLARFDVHHALPHTANTLIGRAAHIAVLDSELFIEKFMLIAGLKYF 1498          

HSP 2 Score: 115.161 bits (287), Expect = 2.540e-25
Identity = 104/438 (23.74%), Postives = 177/438 (40.41%), Query Frame = 2
Query:  125 MSIVQVALSFAVEIWKFHNIDLFHQGAFQIRSYFKTTSSSPALIEN--PKIWDRSKSINFPECTKPSFVSSSD-----------PKLN-------------LPAKAVSKSVLIIYKEESLRMYDIFEQTMHLQMDALSIEEQIYKSEIILVVELWFGEKRNEII------------------EEMRCVCERQLKVHLIASQGLHHHITVIFDYYYLAAVELVVHASLVSISPCYLR----------LPQTSANEADSNFE-RNVSLYQSWHSILF----TSTKNC-----GRRHAACLVHNHLCQLLLAVIDSLMSTFQDALSFFSPDQRSQIDDKLHAQLCPAQSKSINVLADWMKFAPNELERLAFILQSQT---SEDDIADQASIDITKLSSRIVVIFNEFLKTSSFHQNYVESLSLRTHKLRIKRFSEAFFFQE 1237
            M  +Q  + F VE+ KF N+DLF +G +Q+R   + +      +E   P+     K          +   SSD           P+L+             +     S+   I+Y+ E + + DI     HL +D+  ++E I ++E  L +ELWFGE+                         +     R L+++    +GLH+H+ V+FDY++LAA+ + +HASLV++   Y++           P++S   +      R  +      ++ F      T  C     GR   +  +H  +C LLL  I+ L +T  +  +   P   SQI         P +                  ERL  +L       +E+D A +A+ DI +L +  +  +   L  S         L+ + H LR++RF+E FF  E
Sbjct:    1 MGDLQATIEFVVELHKFFNVDLFQRGLYQVRCGLRVSPRLLVQVETSIPEASGPGKQNGHANGANATDHGSSDSERGELSPGEVPRLHESPPGGSCSSASVINGSGASRIFQILYRNEEVPLRDIIHFRSHLLVDSRHLKESIERAEFSLQLELWFGEQNGSSSLNGNGGGSGMGSFSGPASSALTLASTRNLQLNFHPGRGLHYHLPVLFDYFHLAAISVGIHASLVALHQPYIKKSVFSYMKFCAPRSSKPWSAGKLSCRGNTSPGPLEAVFFGPQIGGTTKCSGGPAGRLLQSRAIHREICSLLLGAIEQLKATLNEFSTVLPPSINSQIGSP------PLRENDTG-------------ERLQLLLDQAKQLEAEEDFAIRANSDIAQLCAESIFWWRRVLLASRSSTAVHTLLARKHHILRVRRFAEGFFVLE 419          
BLAST of Family with sequence similarity 135 member A vs. Ensembl Fly
Match: CG32333 (gene:FBgn0052333 transcript:FBtr0072662)

HSP 1 Score: 337.035 bits (863), Expect = 1.356e-95
Identity = 162/303 (53.47%), Postives = 217/303 (71.62%), Query Frame = 2
Query: 2552 QFQGNVYSEMSNIPASKKPYFSHRDSDELSASSSLHYIICVHGLDGEHRDLRLVKAYLSLALPEQRFEFLMSEANEPNTFADIDEMKELLVDEILEKIQDLRENPDKISFIGHSLGCLLIRAAIASPRLSKLVPKFHTFLSLGGPHLGTLYGSSVLVNVGLWVMQKVRKSICLQQLALKDSPTDLRRSYLYRLSGQSGLEHFKYILLASSSQDRYVPYHSTRIELCKAAVKDNSELGIVYMEMVTKILQRLLRSGKTTVIRYDAHYTLPRSANNYIGRAAHIALIDSELFLEKFISVSAAKYF 3460
            ++QG++YS+   + AS+ PYF   D     + + +H +ICVHGLDG   DLRLV+ YL L LP    EFLMSE N+ +TF+D D M + LV EIL  I     NP +ISF+ HSLG +++R+A+A P++  L+P+ HTFLSL GPHLGTLY +S LVN+G+W MQK +KS  L QL ++D+ TD+R S+LYRLS +S L HFK ILL  SSQDRYVP HS R+ELCKAA++D+S LG +Y EMV  I+  +L   + T+ R+D H+ LP +AN  IGRAAHIA++DSELF+EKF+ ++  KYF
Sbjct: 1188 KYQGSIYSDYVQL-ASELPYFYISDEYRAFSPNGMHLVICVHGLDGNSADLRLVRTYLELGLPGVNLEFLMSERNQGDTFSDFDTMTDRLVTEILYHIDSCALNPARISFVAHSLGTIIVRSALARPQMRPLLPRLHTFLSLSGPHLGTLYNTSGLVNMGMWFMQKWKKSGSLLQLCMRDT-TDMRNSFLYRLSQRSTLHHFKNILLCGSSQDRYVPAHSARLELCKAAMRDSSSLGTIYREMVHNIIAPILARPELTLARFDVHHALPHTANTLIGRAAHIAVLDSELFIEKFMLIAGLKYF 1488          

HSP 2 Score: 124.79 bits (312), Expect = 2.775e-28
Identity = 104/428 (24.30%), Postives = 176/428 (41.12%), Query Frame = 2
Query:  125 MSIVQVALSFAVEIWKFHNIDLFHQGAFQIRSYFKTTSSSPALIEN--PKIWDRSKSINFPECTKPSFVSSSD-----------PKLN-------------LPAKAVSKSVLIIYKEESLRMYDIFEQTMHLQMDALSIEEQIYKSEIILVVELWFGEKRNEII------------------EEMRCVCERQLKVHLIASQGLHHHITVIFDYYYLAAVELVVHASLVSISPCYLRLPQTSANEADSNFE-RNVSLYQSWHSILF----TSTKNC-----GRRHAACLVHNHLCQLLLAVIDSLMSTFQDALSFFSPDQRSQIDDKLHAQLCPAQSKSINVLADWMKFAPNELERLAFILQSQT---SEDDIADQASIDITKLSSRIVVIFNEFLKTSSFHQNYVESLSLRTHKLRIKRFSEAFFFQE 1237
            M  +Q  + F VE+ KF N+DLF +G +Q+R   + +      +E   P+     K          +   SSD           P+L+             +     S+   I+Y+ E + + DI     HL +D+  ++E I ++E  L +ELWFGE+                         +     R L+++    +GLH+H+ V+FDY++LAA+ + +HASLV++   Y+  P++S   +      R  +      ++ F      T  C     GR   +  +H  +C LLL  I+ L +T  +  +   P   SQI         P +                  ERL  +L       +E+D A +A+ DI +L +  +  +   L  S         L+ + H LR++RF+E FF  E
Sbjct:    1 MGDLQATIEFVVELHKFFNVDLFQRGLYQVRCGLRVSPRLLVQVETSIPEASGPGKQNGHANGANATDHGSSDSERGELSPGEVPRLHESPPGGSCSSASVINGSGASRIFQILYRNEEVPLRDIIHFRSHLLVDSRHLKESIERAEFSLQLELWFGEQNGSSSLNGNGGGSGMGSFSGPASSALTLASTRNLQLNFHPGRGLHYHLPVLFDYFHLAAISVGIHASLVALHQPYINAPRSSKPWSAGKLSCRGNTSPGPLEAVFFGPQIGGTTKCSGGPAGRLLQSRAIHREICSLLLGAIEQLKATLNEFSTVLPPSINSQIGSP------PLRENDTG-------------ERLQLLLDQAKQLEAEEDFAIRANSDIAQLCAESIFWWRRVLLASRSSTAVHTLLARKHHILRVRRFAEGFFVLE 409          
BLAST of Family with sequence similarity 135 member A vs. Ensembl Fly
Match: CG32333 (gene:FBgn0052333 transcript:FBtr0100256)

HSP 1 Score: 90.8929 bits (224), Expect = 7.560e-20
Identity = 60/236 (25.42%), Postives = 105/236 (44.49%), Query Frame = 2
Query:  125 MSIVQVALSFAVEIWKFHNIDLFHQGAFQIRSYFKTTSSSPALIEN--PKIWDRSKSINFPECTKPSFVSSSD-----------PKLN-------------LPAKAVSKSVLIIYKEESLRMYDIFEQTMHLQMDALSIEEQIYKSEIILVVELWFGEKRNEII------------------EEMRCVCERQLKVHLIASQGLHHHITVIFDYYYLAAVELVVHASLVSISPCYLR 700
            M  +Q  + F VE+ KF N+DLF +G +Q+R   + +      +E   P+     K          +   SSD           P+L+             +     S+   I+Y+ E + + DI     HL +D+  ++E I ++E  L +ELWFGE+                         +     R L+++    +GLH+H+ V+FDY++LAA+ + +HASLV++   Y++
Sbjct:    1 MGDLQATIEFVVELHKFFNVDLFQRGLYQVRCGLRVSPRLLVQVETSIPEASGPGKQNGHANGANATDHGSSDSERGELSPGEVPRLHESPPGGSCSSASVINGSGASRIFQILYRNEEVPLRDIIHFRSHLLVDSRHLKESIERAEFSLQLELWFGEQNGSSSLNGNGGGSGMGSFSGPASSALTLASTRNLQLNFHPGRGLHYHLPVLFDYFHLAAISVGIHASLVALHQPYIK 236          
BLAST of Family with sequence similarity 135 member A vs. Ensembl Zebrafish
Match: FAM135B (family with sequence similarity 135 member B [Source:NCBI gene;Acc:100003594])

HSP 1 Score: 313.923 bits (803), Expect = 8.080e-96
Identity = 158/325 (48.62%), Postives = 222/325 (68.31%), Query Frame = 2
Query: 2492 LNEQ-VTFYQLKAKLMTDLSPQFQGNVYSEMSNIPASKKPYFSHRDSDELSASSSLHYIICVHGLDGEHRDLRLVKAYLSLALPEQRFEFLMSEANEPNTFADIDEMKELLVDEILEKIQDLRENPDKISFIGHSLGCLLIRAAIASPRLSKLVPKFHTFLSLGGPHLGTLYGSSVLVNVGLWVMQKVRKSICLQQLALKDSPTDLRRSYLYRLSGQSGLEHFKYILLASSSQDRYVPYHSTRIELCKAAVKDNSELGIVYMEMVTKILQRLLRSGKTTVIRYDAHYTLPRSANNYIGRAAHIALIDSELFLEKFISVSAAKYFR 3463
            +NE+ + F++ K  L+ +L   F+G +YS++  + AS+ PYF   + D+      +H ++CVHGLDG   DLRLVK ++ L LP  R +FLMSE N+ +TFAD D M + L+DEI++ IQ       +ISFIGHSLG ++IR+ +  PR    + K HTFLSL GPHLGTLY +S LV+ GLW+MQK++KS  L QL  +D  TD R+++LY LS + GL+ FK ++L +S QDRYVP+HS RIE+C+ A+KD +  G VY EM+  +LQ LL +    +IR +  + LP +AN  IGRAAHIA++DSELFLEKF+ V+   YF+
Sbjct:   97 INERMINFFKAKEALLRELV--FRGTLYSDLPYL-ASEHPYFP-PEEDDTEFEDGIHLVVCVHGLDGNSADLRLVKTFVELGLPGSRLDFLMSERNQTDTFADFDTMTDRLLDEIIQHIQLYNLTIHRISFIGHSLGNVIIRSVLTRPRFRCYLCKLHTFLSLSGPHLGTLYNNSTLVSTGLWLMQKLKKSGSLLQLTFRDH-TDPRQTFLYTLSKKPGLQFFKNVVLVASPQDRYVPFHSARIEMCRTALKDRTT-GPVYTEMINNLLQPLLSAPNCRLIRQNVFHALPNTANTLIGRAAHIAVLDSELFLEKFLLVAGLNYFK 415          
BLAST of Family with sequence similarity 135 member A vs. Ensembl Zebrafish
Match: FAM135B (family with sequence similarity 135 member B [Source:NCBI gene;Acc:100003594])

HSP 1 Score: 307.375 bits (786), Expect = 6.912e-95
Identity = 152/303 (50.17%), Postives = 209/303 (68.98%), Query Frame = 2
Query: 2555 FQGNVYSEMSNIPASKKPYFSHRDSDELSASSSLHYIICVHGLDGEHRDLRLVKAYLSLALPEQRFEFLMSEANEPNTFADIDEMKELLVDEILEKIQDLRENPDKISFIGHSLGCLLIRAAIASPRLSKLVPKFHTFLSLGGPHLGTLYGSSVLVNVGLWVMQKVRKSICLQQLALKDSPTDLRRSYLYRLSGQSGLEHFKYILLASSSQDRYVPYHSTRIELCKAAVKDNSELGIVYMEMVTKILQRLLRSGKTTVIRYDAHYTLPRSANNYIGRAAHIALIDSELFLEKFISVSAAKYFR 3463
            F+G +YS++  + AS+ PYF   + D+      +H ++CVHGLDG   DLRLVK ++ L LP  R +FLMSE N+ +TFAD D M + L+DEI++ IQ       +ISFIGHSLG ++IR+ +  PR    + K HTFLSL GPHLGTLY +S LV+ GLW+MQK++KS  L QL  +D  TD R+++LY LS + GL+ FK ++L +S QDRYVP+HS RIE+C+ A+KD +  G VY EM+  +LQ LL +    +IR +  + LP +AN  IGRAAHIA++DSELFLEKF+ V+   YF+
Sbjct:   16 FRGTLYSDLPYL-ASEHPYFP-PEEDDTEFEDGIHLVVCVHGLDGNSADLRLVKTFVELGLPGSRLDFLMSERNQTDTFADFDTMTDRLLDEIIQHIQLYNLTIHRISFIGHSLGNVIIRSVLTRPRFRCYLCKLHTFLSLSGPHLGTLYNNSTLVSTGLWLMQKLKKSGSLLQLTFRDH-TDPRQTFLYTLSKKPGLQFFKNVVLVASPQDRYVPFHSARIEMCRTALKDRTT-GPVYTEMINNLLQPLLSAPNCRLIRQNVFHALPNTANTLIGRAAHIAVLDSELFLEKFLLVAGLNYFK 314          
BLAST of Family with sequence similarity 135 member A vs. Ensembl Zebrafish
Match: FAM135B (family with sequence similarity 135 member B [Source:NCBI gene;Acc:100003594])

HSP 1 Score: 313.923 bits (803), Expect = 2.674e-88
Identity = 158/325 (48.62%), Postives = 222/325 (68.31%), Query Frame = 2
Query: 2492 LNEQ-VTFYQLKAKLMTDLSPQFQGNVYSEMSNIPASKKPYFSHRDSDELSASSSLHYIICVHGLDGEHRDLRLVKAYLSLALPEQRFEFLMSEANEPNTFADIDEMKELLVDEILEKIQDLRENPDKISFIGHSLGCLLIRAAIASPRLSKLVPKFHTFLSLGGPHLGTLYGSSVLVNVGLWVMQKVRKSICLQQLALKDSPTDLRRSYLYRLSGQSGLEHFKYILLASSSQDRYVPYHSTRIELCKAAVKDNSELGIVYMEMVTKILQRLLRSGKTTVIRYDAHYTLPRSANNYIGRAAHIALIDSELFLEKFISVSAAKYFR 3463
            +NE+ + F++ K  L+ +L   F+G +YS++  + AS+ PYF   + D+      +H ++CVHGLDG   DLRLVK ++ L LP  R +FLMSE N+ +TFAD D M + L+DEI++ IQ       +ISFIGHSLG ++IR+ +  PR    + K HTFLSL GPHLGTLY +S LV+ GLW+MQK++KS  L QL  +D  TD R+++LY LS + GL+ FK ++L +S QDRYVP+HS RIE+C+ A+KD +  G VY EM+  +LQ LL +    +IR +  + LP +AN  IGRAAHIA++DSELFLEKF+ V+   YF+
Sbjct:  986 INERMINFFKAKEALLRELV--FRGTLYSDLPYL-ASEHPYFP-PEEDDTEFEDGIHLVVCVHGLDGNSADLRLVKTFVELGLPGSRLDFLMSERNQTDTFADFDTMTDRLLDEIIQHIQLYNLTIHRISFIGHSLGNVIIRSVLTRPRFRCYLCKLHTFLSLSGPHLGTLYNNSTLVSTGLWLMQKLKKSGSLLQLTFRDH-TDPRQTFLYTLSKKPGLQFFKNVVLVASPQDRYVPFHSARIEMCRTALKDRT-TGPVYTEMINNLLQPLLSAPNCRLIRQNVFHALPNTANTLIGRAAHIAVLDSELFLEKFLLVAGLNYFK 1304          

HSP 2 Score: 127.487 bits (319), Expect = 5.028e-29
Identity = 100/396 (25.25%), Postives = 187/396 (47.22%), Query Frame = 2
Query:  125 MSIVQVALSFAVEIWKFHNIDLFHQGAFQIRSYFKTTSSSPALIENPKIWDRSKSINFPECTKPSFVSS---SDPKLNLPAKAVSKSVLIIYKEESLRMYDIFEQTMHLQMDALSIEEQIYKSEIILVVELWFGEKRNEI--IEEMRCVCERQLKVHLIASQGLHHHITVIFDYYYLAAVELVVHASLVSISPCYLRL-------------PQTSANEADSNFERNVSLYQSW------HSILFTSTKNCGRRHAACLVHNHLCQLLLAVIDSLMSTFQDALSFFSPDQRSQIDDKLHAQLCPAQSKSINVLADWMKFAPNELERLAFILQSQTSEDDIADQASIDITKLSSRIVVIFNEFLKTSSFHQNYVES-LSLRTHKLRIKRFSEAFFFQE 1237
            MS VQ  + F++E+ KFHN+DLF +G +Q+R+  + +   P  I                 T P +      S+  ++      S+   I+Y+ E + + D     +HL +D   +EE + + ++ L ++L F +   ++  I  +  +  R L +H    QGLHHH+ V+FDY++L+ + + +HASLV++    +               P++ A  +  + E N+     +          +  ++NC +R  A   H  +C+LLLA   +L S +   +      Q  Q +D       P + +++N L                 ++ Q+  + +A+Q S D+T+L +++  ++ +FL+ S+    Y+ S L+   H LR++RFSEA+FF E
Sbjct:    1 MSEVQGTVEFSLELHKFHNVDLFQRGFYQVRAGLRVSPRVPHRIT---------------ATTPGYTGECSFSNAGVH-DGGVFSRIFQILYRNEEVTLEDHINFRLHLLLDGERVEEAVSEVDVQLKLDLHFTDNEQQLADISSVPVISSRTLGLHFHPQQGLHHHLPVMFDYFHLSVISVSIHASLVALHQPLISFARSGKGTWLGKGSPESEAPPSAMSVE-NLMFGAGYCKPVPTEGSFYVPSENCLQR--AYTWHRRICKLLLAAHRALRSYYTTLMKEIPQLQHIQTED------LPLE-ETLNQLT----------------IELQSGHEKVAEQISKDLTQLCAQLSALWTQFLE-STVPNPYIRSYLAQEHHTLRVRRFSEAYFFTE 353          
BLAST of Family with sequence similarity 135 member A vs. Ensembl Zebrafish
Match: FAM135B (family with sequence similarity 135 member B [Source:NCBI gene;Acc:100003594])

HSP 1 Score: 315.464 bits (807), Expect = 2.949e-88
Identity = 158/325 (48.62%), Postives = 222/325 (68.31%), Query Frame = 2
Query: 2492 LNEQ-VTFYQLKAKLMTDLSPQFQGNVYSEMSNIPASKKPYFSHRDSDELSASSSLHYIICVHGLDGEHRDLRLVKAYLSLALPEQRFEFLMSEANEPNTFADIDEMKELLVDEILEKIQDLRENPDKISFIGHSLGCLLIRAAIASPRLSKLVPKFHTFLSLGGPHLGTLYGSSVLVNVGLWVMQKVRKSICLQQLALKDSPTDLRRSYLYRLSGQSGLEHFKYILLASSSQDRYVPYHSTRIELCKAAVKDNSELGIVYMEMVTKILQRLLRSGKTTVIRYDAHYTLPRSANNYIGRAAHIALIDSELFLEKFISVSAAKYFR 3463
            +NE+ + F++ K  L+ +L   F+G +YS++  + AS+ PYF   + D+      +H ++CVHGLDG   DLRLVK ++ L LP  R +FLMSE N+ +TFAD D M + L+DEI++ IQ       +ISFIGHSLG ++IR+ +  PR    + K HTFLSL GPHLGTLY +S LV+ GLW+MQK++KS  L QL  +D  TD R+++LY LS + GL+ FK ++L +S QDRYVP+HS RIE+C+ A+KD +  G VY EM+  +LQ LL +    +IR +  + LP +AN  IGRAAHIA++DSELFLEKF+ V+   YF+
Sbjct: 1157 INERMINFFKAKEALLRELV--FRGTLYSDLPYL-ASEHPYFP-PEEDDTEFEDGIHLVVCVHGLDGNSADLRLVKTFVELGLPGSRLDFLMSERNQTDTFADFDTMTDRLLDEIIQHIQLYNLTIHRISFIGHSLGNVIIRSVLTRPRFRCYLCKLHTFLSLSGPHLGTLYNNSTLVSTGLWLMQKLKKSGSLLQLTFRDH-TDPRQTFLYTLSKKPGLQFFKNVVLVASPQDRYVPFHSARIEMCRTALKDRT-TGPVYTEMINNLLQPLLSAPNCRLIRQNVFHALPNTANTLIGRAAHIAVLDSELFLEKFLLVAGLNYFK 1475          

HSP 2 Score: 131.724 bits (330), Expect = 2.296e-30
Identity = 102/396 (25.76%), Postives = 185/396 (46.72%), Query Frame = 2
Query:  125 MSIVQVALSFAVEIWKFHNIDLFHQGAFQIRSYFKTTSSSPALIENPKIWDRSKSINFPECTKPSFVSS---SDPKLNLPAKAVSKSVLIIYKEESLRMYDIFEQTMHLQMDALSIEEQIYKSEIILVVELWFGEKRNEI--IEEMRCVCERQLKVHLIASQGLHHHITVIFDYYYLAAVELVVHASLVSISPCYLRL-------------PQTSANEADSNFERNVSLYQSW------HSILFTSTKNCGRRHAACLVHNHLCQLLLAVIDSLMSTFQDALSFFSPDQRSQIDDKLHAQLCPAQSKSINVLADWMKFAPNELERLAFILQSQTSEDDIADQASIDITKLSSRIVVIFNEFLKTSSFHQNYVES-LSLRTHKLRIKRFSEAFFFQE 1237
            MS VQ  + F++E+ KFHN+DLF +G +Q+R+  + +   P  I                 T P +      S+  ++      S+   I+Y+ E + + D     +HL +D   +EE + + ++ L ++L F +   ++  I  +  +  R L +H    QGLHHH+ V+FDY++L+ + + +HASLV++    +               P++ A  +  + E N+     +          +  ++NC +R  A   H  +C+LLLA   +L S +   +      Q  Q +D       P +                 L +L   LQ Q+  + +A+Q S D+T+L +++  ++ +FL+ S+    Y+ S L+   H LR++RFSEA+FF E
Sbjct:    2 MSEVQGTVEFSLELHKFHNVDLFQRGFYQVRAGLRVSPRVPHRIT---------------ATTPGYTGECSFSNAGVH-DGGVFSRIFQILYRNEEVTLEDHINFRLHLLLDGERVEEAVSEVDVQLKLDLHFTDNEQQLADISSVPVISSRTLGLHFHPQQGLHHHLPVMFDYFHLSVISVSIHASLVALHQPLISFARSGKGTWLGKGSPESEAPPSAMSVE-NLMFGAGYCKPVPTEGSFYVPSENCLQR--AYTWHRRICKLLLAAHRALRSYYTTLMKEIPQLQHIQTED------LPLEET---------------LNQLTIELQLQSGHEKVAEQISKDLTQLCAQLSALWTQFLE-STVPNPYIRSYLAQEHHTLRVRRFSEAYFFTE 356          
BLAST of Family with sequence similarity 135 member A vs. Ensembl Zebrafish
Match: fam135a (family with sequence similarity 135 member A [Source:ZFIN;Acc:ZDB-GENE-080130-1])

HSP 1 Score: 312.768 bits (800), Expect = 8.503e-88
Identity = 162/322 (50.31%), Postives = 218/322 (67.70%), Query Frame = 2
Query: 2498 EQVTFYQLKAKLMTDLSPQFQGNVYSEMSNIPASKKPYFSHRDSDELSASSSLHYIICVHGLDGEHRDLRLVKAYLSLALPEQRFEFLMSEANEPNTFADIDEMKELLVDEILEKIQDLRENPDKISFIGHSLGCLLIRAAIASPRLSKLVPKFHTFLSLGGPHLGTLYGSSVLVNVGLWVMQKVRKSICLQQLALKDSPTDLRRSYLYRLSGQSGLEHFKYILLASSSQDRYVPYHSTRIELCKAAVKDNSELGIVYMEMVTKILQRLLRSGKTTVIRYDAHYTLPRSANNYIGRAAHIALIDSELFLEKFISVSAAKYFR 3463
            +   F Q K +L     P F   +YSE++++ AS  PYFS  D DE +    +H I+CVHGLDG   DLRLVK YL L LP  R +FLMSE N+ +TFAD + M + L+DEI++ IQ       KISF+GHSLG L++R+ +  PR    + + HTFLSL GPHLGTLY SS LVN GLW MQK +KS  L QL  +D  +D R+++LY+LS ++GL+ FK ++L  S QDRYVPYHS RIE+CK A+KD  + G VY EM+  +L  +L++    ++RYD  + LP +AN+ IGRAAHIA++DSE+FLEKF  V+  K+F+
Sbjct: 1025 QMTAFVQAKEELKQLKLPGF---LYSEVADL-ASTVPYFS-MDEDE-NCDDGIHLIVCVHGLDGNSADLRLVKTYLELGLPGARIDFLMSERNQNDTFADFESMTDRLLDEIVQYIQIYNLTVSKISFVGHSLGNLIVRSVLTRPRFKCYLSRLHTFLSLSGPHLGTLYNSSALVNTGLWFMQKWKKSGSLLQLTCRDH-SDPRQTFLYKLSKKAGLQFFKNVVLVGSLQDRYVPYHSARIEMCKTALKDK-QTGPVYAEMIENLLLPVLQNKDCNLVRYDVIHALPNTANSLIGRAAHIAVLDSEIFLEKFFLVAGLKFFQ 1338          

HSP 2 Score: 128.642 bits (322), Expect = 1.894e-29
Identity = 98/400 (24.50%), Postives = 183/400 (45.75%), Query Frame = 2
Query:  125 MSIVQVALSFAVEIWKFHNIDLFHQGAFQIRSYFKTTSSSPALIENPKIWDRSKSINFPECTKPSFVSSSDPKLNLPAKAVSKSVLIIYKEESLRMYDIFEQTMHLQMDALSIEEQIYKSEIILVVELWF--GEKRNEIIEEMRCVCERQLKVHLIASQGLHHHITVIFDYYYLAAVELVVHASLVSISPCYLRLP---QTSANEADSNFERNVSLYQSWHSILFTST---------------KNCGRRHAACLVHNHLCQLLLAVIDSLMSTFQDALSFFSPDQRSQI---------DDKLHAQLCPAQSKSINVLADWMKFAPNELERLAFILQSQTSEDDIADQASIDITKLSSRIVVIFNEFLKTSSFHQNYVESLSLRTHKLRIKRFSEAFFFQE 1237
            M+ VQ  + F+VE+ KF+N+DLF +G +Q+R+  K     P  +E   +      + FP   +   V              SK+  I+YK E + + D+F   + + +DA  +EE + + +  L ++L+F  G+   E    ++ +  R L++H    +G+HHH+ V+FDY++L+ +   +HASLV++    +  P   +++    ++  +   SL     +++F ST                 C  +HA  L H ++C  LL    SL              QR ++         +  L     P Q    +V  + +       E    + Q   S D++A+  ++++ +L S ++ ++  FL+  S ++     L+   H LR++RF+EAFF  E
Sbjct:    1 MTEVQATVEFSVELHKFYNVDLFQRGFYQVRASMKVPPRIPQRVEASLLHPIGSDLAFPASVQDDVV-------------CSKTFQILYKNEEIVVNDVFVFKVMMLLDAKKVEESLNEVDFQLCLDLFFTDGDYSPEEPSSLQSISSRTLRLHFSLHRGIHHHVNVMFDYFHLSVISATIHASLVALHQPLISFPRPVKSTWLNRNAPAQSKDSLIPPLETVVFGSTYVKQLSPDGKSFLVSDQC-LQHAFSL-HQNMCANLLRAYQSLFCYLTSLTKNLPASQRMELAKPSMQVLYERVLRRPYPPGQR---HVYIEELDVEVRLHELCEQVKQKAESPDELAELVNMNLAQLCSLLMALWGNFLEVVSLNERVFVLLAQEHHTLRVQRFAEAFFCLE 382          
BLAST of Family with sequence similarity 135 member A vs. Ensembl Xenopus
Match: FAM135B (uncharacterized loc733553 [Source:Xenbase;Acc:XB-GENE-5812048])

HSP 1 Score: 320.472 bits (820), Expect = 4.381e-90
Identity = 160/320 (50.00%), Postives = 219/320 (68.44%), Query Frame = 2
Query: 2504 VTFYQLKAKLMTDLSPQFQGNVYSEMSNIPASKKPYFSHRDSDELSASSSLHYIICVHGLDGEHRDLRLVKAYLSLALPEQRFEFLMSEANEPNTFADIDEMKELLVDEILEKIQDLRENPDKISFIGHSLGCLLIRAAIASPRLSKLVPKFHTFLSLGGPHLGTLYGSSVLVNVGLWVMQKVRKSICLQQLALKDSPTDLRRSYLYRLSGQSGLEHFKYILLASSSQDRYVPYHSTRIELCKAAVKDNSELGIVYMEMVTKILQRLLRSGKTTVIRYDAHYTLPRSANNYIGRAAHIALIDSELFLEKFISVSAAKYFR 3463
            ++F+Q K K   +L  +F+G +YS+   + AS  PYF    ++E      +H ++CVHGLDG   DLRLVK +L L LP    +FLMSE N+ +TFAD D M + L+DEI++ IQ    +  +ISFIGHSLG ++IR+ +  PR    + K HTFLSL GPHLGTLY +S LVN GLW+MQK++KS  L QL  +D+ TDLR+ +LY+LS + GL++FK ++L +S QDRYVP+HS RIE+CK A KD    G VY EM+  +LQ ++ S   T+IR++  + LP +AN  IGRAAHIA++DSELFLEKF  V+   YF+
Sbjct: 1058 LSFHQAKHKFRKEL--KFEGFIYSDQP-VLASDVPYFP---AEEEQTEDGIHLVVCVHGLDGNSADLRLVKTFLELGLPGANLDFLMSEKNQTDTFADFDAMTDRLIDEIVQHIQLYNLSISRISFIGHSLGNIIIRSVLTRPRFRYYLNKLHTFLSLSGPHLGTLYSNSTLVNTGLWLMQKLKKSGSLLQLTFRDN-TDLRKCFLYQLSQKPGLQYFKNVVLVASPQDRYVPFHSARIEMCKNATKDK-HTGPVYTEMLNNLLQPVIDSKDCTLIRHNVFHALPNTANTLIGRAAHIAVLDSELFLEKFFLVAGLGYFK 1369          

HSP 2 Score: 112.464 bits (280), Expect = 2.566e-24
Identity = 99/394 (25.13%), Postives = 171/394 (43.40%), Query Frame = 2
Query:  125 MSIVQVALSFAVEIWKFHNIDLFHQGAFQIRSYFKTTSSSPALIENPKIWDRSKSINFPECTKPSFVSSSDPKLNLPAKAVSKSVLIIYKEESLRMYDIFEQTMHLQMDALSIEEQIYKSEIILVVELWFGEKRNEI--IEEMRCVCERQLKVHLIASQGLHHHITVIFDYYYLAAVELVVHASLVSISPCYLRL--PQTSANEADSNFE-----RNVSL----YQSWHSILFTSTKNCGRRHAACLVHNH-----LCQLLLAVIDSLMSTFQDALSFFSPDQRSQIDDKLHA-----QLCPAQSKSINVLADWMKFAPNELERLAFILQSQTSEDDIADQASIDITKLSSRIVVIFNEFLKTSSFHQNYVESLSLRTHKLRIKRFSEAFFFQE 1237
            MS VQ  + F+VE+ KFHN+DLF +G + +R+  KT++ +P  +    +        +P C   + V              S+   I+Y+ E + + D+    +HL +D   +E+ + + +    ++  F +   ++  I  +  +  R L +H   + GLHHH+ V+FDY++L+ + + VH SLV++    L    P   +    S  E      NVS+    + + +    +S  +C      C+ H +     LCQLLL   ++L S + + L    PD      ++L       QLC      + V+A    F   ++    +IL S              I      +      FL+T +   +    L    H LR++RFSEAFF  E
Sbjct:    1 MSEVQGTIEFSVELHKFHNVDLFQRGYYHVRASLKTSARTPHRLVATLVGQTDDPGPYPPCVYDNVV-------------FSRVFQILYRNEDIEINDVMAFKVHLLLDGERVEDALREVDFQGKLDFPFTDSEQQLRDIPAVALISSRTLGLHFHPTSGLHHHVPVMFDYFHLSVISVTVHGSLVALHQPLLSFARPVKGSWLGKSGLEPVTDNSNVSMEDLVFGAAYCKPPSSEGSCYALSEDCIQHAYKWHKDLCQLLLTAYNALGSYYANILKEI-PDLPHTETEELSTERTLCQLC----NQLQVMALLFFFIMGQI----WILNSDER-----------ILSYDQSLRGSVPPFLETVTLQPDVTSYLMQEHHTLRVRRFSEAFFCTE 361          
BLAST of Family with sequence similarity 135 member A vs. Ensembl Xenopus
Match: ENSXETT00000006749.1 (family with sequence similarity 135 member A [Source:NCBI gene;Acc:779489])

HSP 1 Score: 316.235 bits (809), Expect = 4.407e-90
Identity = 163/320 (50.94%), Postives = 218/320 (68.12%), Query Frame = 2
Query: 2504 VTFYQLKAKLMTDLSPQFQGNVYSEMSNIPASKKPYFSHRDSDELSASSSLHYIICVHGLDGEHRDLRLVKAYLSLALPEQRFEFLMSEANEPNTFADIDEMKELLVDEILEKIQDLRENPDKISFIGHSLGCLLIRAAIASPRLSKLVPKFHTFLSLGGPHLGTLYGSSVLVNVGLWVMQKVRKSICLQQLALKDSPTDLRRSYLYRLSGQSGLEHFKYILLASSSQDRYVPYHSTRIELCKAAVKDNSELGIVYMEMVTKILQRLLRSGKTTVIRYDAHYTLPRSANNYIGRAAHIALIDSELFLEKFISVSAAKYFR 3463
            + F Q K +L     P F   +YS++  + AS  PYFS  + D+      +H I+CVHGLDG   DLRLV+ Y+ L LP  R EFLMSE N+ +TFAD D M + L+DEI++ IQ    +  +ISFIGHSLG L+IR+ ++ PR    + K HTFLSL GPHLGTLY SS LVN GLW MQK +KS  L QL  +D+ +D R+++LY+LS + GLE+F+ ++L SS QDRYVPYHS RIE+CK A+KD    G VY EM+  IL  +L++    ++RYD  + LP +AN+ IGRAAHIA++DSE+FLEKF  V+  +YF+
Sbjct:  758 LAFLQAKEELKQLRLPGF---LYSDVPQL-ASSVPYFSMEEDDD--PDEGIHLIVCVHGLDGNSADLRLVRTYIELGLPGGRKEFLMSERNQNDTFADFDSMTDRLLDEIVQYIQIYSLSVSRISFIGHSLGNLIIRSVLSRPRFKCYLSKLHTFLSLSGPHLGTLYNSSALVNTGLWFMQKWKKSGSLLQLTCRDN-SDPRQTFLYKLSKKPGLEYFRNVVLVSSLQDRYVPYHSARIEMCKTALKDKQS-GPVYAEMIQNILSPVLQNKDCNLVRYDVIHALPNTANSLIGRAAHIAVLDSEVFLEKFFLVAGLRYFQ 1069          

HSP 2 Score: 111.694 bits (278), Expect = 3.963e-24
Identity = 94/390 (24.10%), Postives = 179/390 (45.90%), Query Frame = 2
Query:  125 MSIVQVALSFAVEIWKFHNIDLFHQGAFQIRSYFKTTSSSPALIENPKIWDRSKSINFPECTKPSFVSSSDPKLNLPAKAVSKSVLIIYKEESLRMYDIFEQTMHLQMDALSIEEQIYKSEIILVVELWFGEKRNEIIE--EMRCVCERQLKVHLIASQGLHHHITVIFDYYYLAAVELVVHASLVSISP---CYLRLPQTSANEADSNFERNVSLYQSWHSILFTST--------------KNCGRRHAACLVHNHLCQLLLAVIDSLMSTFQDALSFFSPDQRSQIDDKLHAQLCPAQSKSINVLADWMKFAPNELERLAFILQSQTSEDDIADQASIDITKLSSRIVVIFNEFLKTSSFHQNYVESLSLRTHKLRIKRFSEAFFFQE 1237
            MS VQ  + F+VE+ KF+N+DLF +G +QIR+  K     P  IE   +   +  + FP   + + V              SK   I+YK E + + D+    + + +D   IEE + +    + ++L+F +      +   ++ +  R LK+H    +GLH HI V+FDY++L+ + +V+H SLV++      + R+ + +    ++  +   S   +  S++F S+              ++C  +HA    H+ LC  LL     L S F        P  + +++              I+V A         L  L   ++   + D++A+  ++++ +L S ++ ++ +FL+           ++ + H LR++RF+EAFF  E
Sbjct:    1 MSEVQATVEFSVELQKFYNVDLFQRGFYQIRTSMKIPPRIPHKIE-ASLLRITGDLAFPASVQDTVV-------------FSKIFQILYKNEEITVNDVMIFKIKMLLDERKIEETLNELNFQMFIDLYFTDTDYSPNDPNALQLISSRSLKLHFNLHRGLHDHINVMFDYFHLSVISVVIHGSLVALHQPLISFHRVIKNTWLNRNAPAQSKESSIPTLESVVFGSSYTKQLSADGNSFVVQDCFLQHAYSF-HSTLCACLLFAFKGLDSYFITVSKELPPSLKLELE-------------KIDVDA--------RLTELCEEVKKIENPDELAELINMNLAQLCSLLMALWGQFLEVVVLQDEITTFIAQQHHILRVRRFAEAFFCLE 354          
BLAST of Family with sequence similarity 135 member A vs. Ensembl Xenopus
Match: ENSXETT00000006781.1 (family with sequence similarity 135 member A [Source:NCBI gene;Acc:779489])

HSP 1 Score: 315.849 bits (808), Expect = 6.287e-90
Identity = 163/320 (50.94%), Postives = 218/320 (68.12%), Query Frame = 2
Query: 2504 VTFYQLKAKLMTDLSPQFQGNVYSEMSNIPASKKPYFSHRDSDELSASSSLHYIICVHGLDGEHRDLRLVKAYLSLALPEQRFEFLMSEANEPNTFADIDEMKELLVDEILEKIQDLRENPDKISFIGHSLGCLLIRAAIASPRLSKLVPKFHTFLSLGGPHLGTLYGSSVLVNVGLWVMQKVRKSICLQQLALKDSPTDLRRSYLYRLSGQSGLEHFKYILLASSSQDRYVPYHSTRIELCKAAVKDNSELGIVYMEMVTKILQRLLRSGKTTVIRYDAHYTLPRSANNYIGRAAHIALIDSELFLEKFISVSAAKYFR 3463
            + F Q K +L     P F   +YS++  + AS  PYFS  + D+      +H I+CVHGLDG   DLRLV+ Y+ L LP  R EFLMSE N+ +TFAD D M + L+DEI++ IQ    +  +ISFIGHSLG L+IR+ ++ PR    + K HTFLSL GPHLGTLY SS LVN GLW MQK +KS  L QL  +D+ +D R+++LY+LS + GLE+F+ ++L SS QDRYVPYHS RIE+CK A+KD    G VY EM+  IL  +L++    ++RYD  + LP +AN+ IGRAAHIA++DSE+FLEKF  V+  +YF+
Sbjct:  764 LAFLQAKEELKQLRLPGF---LYSDVPQL-ASSVPYFSMEEDDD--PDEGIHLIVCVHGLDGNSADLRLVRTYIELGLPGGRKEFLMSERNQNDTFADFDSMTDRLLDEIVQYIQIYSLSVSRISFIGHSLGNLIIRSVLSRPRFKCYLSKLHTFLSLSGPHLGTLYNSSALVNTGLWFMQKWKKSGSLLQLTCRDN-SDPRQTFLYKLSKKPGLEYFRNVVLVSSLQDRYVPYHSARIEMCKTALKDKQS-GPVYAEMIQNILSPVLQNKDCNLVRYDVIHALPNTANSLIGRAAHIAVLDSEVFLEKFFLVAGLRYFQ 1075          

HSP 2 Score: 112.079 bits (279), Expect = 3.504e-24
Identity = 94/390 (24.10%), Postives = 179/390 (45.90%), Query Frame = 2
Query:  125 MSIVQVALSFAVEIWKFHNIDLFHQGAFQIRSYFKTTSSSPALIENPKIWDRSKSINFPECTKPSFVSSSDPKLNLPAKAVSKSVLIIYKEESLRMYDIFEQTMHLQMDALSIEEQIYKSEIILVVELWFGEKRNEIIE--EMRCVCERQLKVHLIASQGLHHHITVIFDYYYLAAVELVVHASLVSISP---CYLRLPQTSANEADSNFERNVSLYQSWHSILFTST--------------KNCGRRHAACLVHNHLCQLLLAVIDSLMSTFQDALSFFSPDQRSQIDDKLHAQLCPAQSKSINVLADWMKFAPNELERLAFILQSQTSEDDIADQASIDITKLSSRIVVIFNEFLKTSSFHQNYVESLSLRTHKLRIKRFSEAFFFQE 1237
            MS VQ  + F+VE+ KF+N+DLF +G +QIR+  K     P  IE   +   +  + FP   + + V              SK   I+YK E + + D+    + + +D   IEE + +    + ++L+F +      +   ++ +  R LK+H    +GLH HI V+FDY++L+ + +V+H SLV++      + R+ + +    ++  +   S   +  S++F S+              ++C  +HA    H+ LC  LL     L S F        P  + +++              I+V A         L  L   ++   + D++A+  ++++ +L S ++ ++ +FL+           ++ + H LR++RF+EAFF  E
Sbjct:    1 MSEVQATVEFSVELQKFYNVDLFQRGFYQIRTSMKIPPRIPHKIE-ASLLRITGDLAFPASVQDTVV-------------FSKIFQILYKNEEITVNDVMIFKIKMLLDERKIEETLNELNFQMFIDLYFTDTDYSPNDPNALQLISSRSLKLHFNLHRGLHDHINVMFDYFHLSVISVVIHGSLVALHQPLISFHRVIKNTWLNRNAPAQSKESSIPTLESVVFGSSYTKQLSADGNSFVVQDCFLQHAYSF-HSTLCACLLFAFKGLDSYFITVSKELPPSLKLELE-------------KIDVDA--------RLTELCEEVKKIENPDELAELINMNLAQLCSLLMALWGQFLEVVVLQDEITTFIAQQHHILRVRRFAEAFFCLE 354          
BLAST of Family with sequence similarity 135 member A vs. Ensembl Xenopus
Match: ENSXETT00000006704.1 (family with sequence similarity 135 member A [Source:NCBI gene;Acc:779489])

HSP 1 Score: 317.775 bits (813), Expect = 2.019e-89
Identity = 163/320 (50.94%), Postives = 218/320 (68.12%), Query Frame = 2
Query: 2504 VTFYQLKAKLMTDLSPQFQGNVYSEMSNIPASKKPYFSHRDSDELSASSSLHYIICVHGLDGEHRDLRLVKAYLSLALPEQRFEFLMSEANEPNTFADIDEMKELLVDEILEKIQDLRENPDKISFIGHSLGCLLIRAAIASPRLSKLVPKFHTFLSLGGPHLGTLYGSSVLVNVGLWVMQKVRKSICLQQLALKDSPTDLRRSYLYRLSGQSGLEHFKYILLASSSQDRYVPYHSTRIELCKAAVKDNSELGIVYMEMVTKILQRLLRSGKTTVIRYDAHYTLPRSANNYIGRAAHIALIDSELFLEKFISVSAAKYFR 3463
            + F Q K +L     P F   +YS++  + AS  PYFS  + D+      +H I+CVHGLDG   DLRLV+ Y+ L LP  R EFLMSE N+ +TFAD D M + L+DEI++ IQ    +  +ISFIGHSLG L+IR+ ++ PR    + K HTFLSL GPHLGTLY SS LVN GLW MQK +KS  L QL  +D+ +D R+++LY+LS + GLE+F+ ++L SS QDRYVPYHS RIE+CK A+KD    G VY EM+  IL  +L++    ++RYD  + LP +AN+ IGRAAHIA++DSE+FLEKF  V+  +YF+
Sbjct:  982 LAFLQAKEELKQLRLPGF---LYSDVPQL-ASSVPYFSMEEDDD--PDEGIHLIVCVHGLDGNSADLRLVRTYIELGLPGGRKEFLMSERNQNDTFADFDSMTDRLLDEIVQYIQIYSLSVSRISFIGHSLGNLIIRSVLSRPRFKCYLSKLHTFLSLSGPHLGTLYNSSALVNTGLWFMQKWKKSGSLLQLTCRDN-SDPRQTFLYKLSKKPGLEYFRNVVLVSSLQDRYVPYHSARIEMCKTALKDKQS-GPVYAEMIQNILSPVLQNKDCNLVRYDVIHALPNTANSLIGRAAHIAVLDSEVFLEKFFLVAGLRYFQ 1293          

HSP 2 Score: 78.5666 bits (192), Expect = 6.278e-14
Identity = 87/410 (21.22%), Postives = 167/410 (40.73%), Query Frame = 2
Query:  125 MSIVQVALSFAVEIWKFHNIDLFHQGAFQIRSYFKTTSSSPALIENPKIWDRSKSINFPECTKPSFVSSSDPKLNLPAKAVSKSVLIIYKEESLRMYDIFEQTMHLQMDALSIEEQIYKSEIILVVELWFGEKRNEIIE--EMRCVCERQLKVHLIASQGLHHHITVIFDYYYLAAVELVVHASLVSISP---CYLRLPQTSANEADSNFERNVSLYQSWHSILFTST--------------KNCGRRHAACLVHNHLCQLLLAVIDSLMSTFQDALSFFSPDQRSQIDDKLHAQLCPAQS---KSINVLADWMKFAPNE-----------------LERLAFILQSQTSEDDIADQASIDITKLSSRIVVIFNEFLKTSSFHQNYVESLSLRTHKLRIKRFSEAFFFQE 1237
            MS VQ  + F+VE+ KF+N+DL     FQ    F+                                                   I+YK E + + D+    + + +D   IEE + +    + ++L+F +      +   ++ +  R LK+H    +GLH HI V+FDY++L+ + +V+H SLV++      + R+ + +    ++  +   S   +  S++F S+              ++C  +HA    H+ LC  LL     L S F        P  + ++     +  C   +   KS+ VL    +   NE                 L  L   ++   + D++A+  ++++ +L S ++ ++ +FL+           ++ + H LR++RF+EAFF  E
Sbjct:    1 MSEVQATVEFSVELQKFYNVDL-----FQRGKIFQ---------------------------------------------------ILYKNEEITVNDVMIFKIKMLLDERKIEETLNELNFQMFIDLYFTDTDYSPNDPNALQLISSRSLKLHFNLHRGLHDHINVMFDYFHLSVISVVIHGSLVALHQPLISFHRVIKNTWLNRNAPAQSKESSIPTLESVVFGSSYTKQLSADGNSFVVQDCFLQHAYSF-HSTLCACLLFAFKGLDSYFITVSKELPPSLKLELGMWNASVQCHTYNQVFKSLAVLFISHRVTLNENHSIVHCTVEKIDVDARLTELCEEVKKIENPDELAELINMNLAQLCSLLMALWGQFLEVVVLQDEITTFIAQQHHILRVRRFAEAFFCLE 353          
BLAST of Family with sequence similarity 135 member A vs. Ensembl Xenopus
Match: ENSXETT00000006804.1 (family with sequence similarity 135 member A [Source:NCBI gene;Acc:779489])

HSP 1 Score: 317.775 bits (813), Expect = 2.082e-89
Identity = 163/320 (50.94%), Postives = 218/320 (68.12%), Query Frame = 2
Query: 2504 VTFYQLKAKLMTDLSPQFQGNVYSEMSNIPASKKPYFSHRDSDELSASSSLHYIICVHGLDGEHRDLRLVKAYLSLALPEQRFEFLMSEANEPNTFADIDEMKELLVDEILEKIQDLRENPDKISFIGHSLGCLLIRAAIASPRLSKLVPKFHTFLSLGGPHLGTLYGSSVLVNVGLWVMQKVRKSICLQQLALKDSPTDLRRSYLYRLSGQSGLEHFKYILLASSSQDRYVPYHSTRIELCKAAVKDNSELGIVYMEMVTKILQRLLRSGKTTVIRYDAHYTLPRSANNYIGRAAHIALIDSELFLEKFISVSAAKYFR 3463
            + F Q K +L     P F   +YS++  + AS  PYFS  + D+      +H I+CVHGLDG   DLRLV+ Y+ L LP  R EFLMSE N+ +TFAD D M + L+DEI++ IQ    +  +ISFIGHSLG L+IR+ ++ PR    + K HTFLSL GPHLGTLY SS LVN GLW MQK +KS  L QL  +D+ +D R+++LY+LS + GLE+F+ ++L SS QDRYVPYHS RIE+CK A+KD    G VY EM+  IL  +L++    ++RYD  + LP +AN+ IGRAAHIA++DSE+FLEKF  V+  +YF+
Sbjct:  992 LAFLQAKEELKQLRLPGF---LYSDVPQL-ASSVPYFSMEEDDD--PDEGIHLIVCVHGLDGNSADLRLVRTYIELGLPGGRKEFLMSERNQNDTFADFDSMTDRLLDEIVQYIQIYSLSVSRISFIGHSLGNLIIRSVLSRPRFKCYLSKLHTFLSLSGPHLGTLYNSSALVNTGLWFMQKWKKSGSLLQLTCRDN-SDPRQTFLYKLSKKPGLEYFRNVVLVSSLQDRYVPYHSARIEMCKTALKDKQS-GPVYAEMIQNILSPVLQNKDCNLVRYDVIHALPNTANSLIGRAAHIAVLDSEVFLEKFFLVAGLRYFQ 1303          

HSP 2 Score: 111.694 bits (278), Expect = 5.046e-24
Identity = 94/390 (24.10%), Postives = 179/390 (45.90%), Query Frame = 2
Query:  125 MSIVQVALSFAVEIWKFHNIDLFHQGAFQIRSYFKTTSSSPALIENPKIWDRSKSINFPECTKPSFVSSSDPKLNLPAKAVSKSVLIIYKEESLRMYDIFEQTMHLQMDALSIEEQIYKSEIILVVELWFGEKRNEIIE--EMRCVCERQLKVHLIASQGLHHHITVIFDYYYLAAVELVVHASLVSISP---CYLRLPQTSANEADSNFERNVSLYQSWHSILFTST--------------KNCGRRHAACLVHNHLCQLLLAVIDSLMSTFQDALSFFSPDQRSQIDDKLHAQLCPAQSKSINVLADWMKFAPNELERLAFILQSQTSEDDIADQASIDITKLSSRIVVIFNEFLKTSSFHQNYVESLSLRTHKLRIKRFSEAFFFQE 1237
            MS VQ  + F+VE+ KF+N+DLF +G +QIR+  K     P  IE   +   +  + FP   + + V              SK   I+YK E + + D+    + + +D   IEE + +    + ++L+F +      +   ++ +  R LK+H    +GLH HI V+FDY++L+ + +V+H SLV++      + R+ + +    ++  +   S   +  S++F S+              ++C  +HA    H+ LC  LL     L S F        P  + +++              I+V A         L  L   ++   + D++A+  ++++ +L S ++ ++ +FL+           ++ + H LR++RF+EAFF  E
Sbjct:    1 MSEVQATVEFSVELQKFYNVDLFQRGFYQIRTSMKIPPRIPHKIE-ASLLRITGDLAFPASVQDTVV-------------FSKIFQILYKNEEITVNDVMIFKIKMLLDERKIEETLNELNFQMFIDLYFTDTDYSPNDPNALQLISSRSLKLHFNLHRGLHDHINVMFDYFHLSVISVVIHGSLVALHQPLISFHRVIKNTWLNRNAPAQSKESSIPTLESVVFGSSYTKQLSADGNSFVVQDCFLQHAYSF-HSTLCACLLFAFKGLDSYFITVSKELPPSLKLELE-------------KIDVDA--------RLTELCEEVKKIENPDELAELINMNLAQLCSLLMALWGQFLEVVVLQDEITTFIAQQHHILRVRRFAEAFFCLE 354          
BLAST of Family with sequence similarity 135 member A vs. Ensembl Mouse
Match: Fam135b (family with sequence similarity 135, member B [Source:MGI Symbol;Acc:MGI:1917613])

HSP 1 Score: 312.383 bits (799), Expect = 1.859e-87
Identity = 157/319 (49.22%), Postives = 221/319 (69.28%), Query Frame = 2
Query: 2507 TFYQLKAKLMTDLSPQFQGNVYSEMSNIPASKKPYFSHRDSDELSASSSLHYIICVHGLDGEHRDLRLVKAYLSLALPEQRFEFLMSEANEPNTFADIDEMKELLVDEILEKIQDLRENPDKISFIGHSLGCLLIRAAIASPRLSKLVPKFHTFLSLGGPHLGTLYGSSVLVNVGLWVMQKVRKSICLQQLALKDSPTDLRRSYLYRLSGQSGLEHFKYILLASSSQDRYVPYHSTRIELCKAAVKDNSELGIVYMEMVTKILQRLLRSGKTTVIRYDAHYTLPRSANNYIGRAAHIALIDSELFLEKFISVSAAKYFR 3463
            +FYQ K K   +L  + +G +YS++S + AS  PYF   + +E +    +H ++CVHGLDG   DLRLVK ++ L LP  + +FLMSE N+ +TFAD D M + L+DEI++ IQ    +  +ISFIGHSLG ++IR+ +  PR    + K HTFLSL GPHLGTLY +S LV+ GLW+MQK++KS  L QL  +D+  DLR+ +LY+LS ++GL++FK ++L +S QDRYVP+HS RIE+CK A+KD    G VY EM+  +L  L+ +   T+IR++  + LP +AN  IGRAAHIA++DSELFLEKF  V+   YF+
Sbjct: 1091 SFYQAKEKFKKEL--KIEGFLYSDLS-VLASDIPYFP-PEEEEENLEDGIHLVVCVHGLDGNSADLRLVKTFIELGLPGGKLDFLMSEKNQTDTFADFDTMTDRLLDEIIQHIQLYNLSISRISFIGHSLGNIIIRSVLTRPRFRYYLNKLHTFLSLSGPHLGTLYNNSTLVSTGLWLMQKLKKSGSLLQLTFRDN-ADLRKCFLYQLSQKTGLQYFKNVVLVASPQDRYVPFHSARIEMCKTALKDR-HTGPVYAEMINNLLGPLVEAKDCTLIRHNVFHALPNTANTLIGRAAHIAVLDSELFLEKFFLVAGLNYFK 1403          

HSP 2 Score: 120.168 bits (300), Expect = 8.596e-27
Identity = 102/400 (25.50%), Postives = 169/400 (42.25%), Query Frame = 2
Query:  125 MSIVQVALSFAVEIWKFHNIDLFHQGAFQIRSYFKTTSSSPALIENPKIWDRSKSINFPECTKPSFVSSSDPKLNLPAKAVSKSVLIIYKEESLRMYDIFEQTMHLQMDALSIEEQIYKSEIILVVELWFGEKRNEI--IEEMRCVCERQLKVHLIASQGLHHHITVIFDYYYLAAVELVVHASLVSISPCYLRL-------------PQTSANEADSNFERNV--SLY---QSWHSILFTSTKNCGRRHAACLVHNHLCQLLLAVIDSLMSTFQDALSFFSPDQRSQIDDKLHAQLCPAQSKSINVLADWMKFAPNELERLAF---------ILQSQTSEDDIADQASIDITKLSSRIVVIFNEFLKTSSFHQNYVESLSLRTHKLRIKRFSEAFFFQE 1237
            MS VQ  + F+VE+ KF+N+DLF +G +QIR   K +S  P  +    +     S     C   S V S             +   I+Y+ E + + D     +HL +D   +E+ + + E  L V+L F +   ++  +     +  R L +H    +GLHH + V+FDY++L+ + + +HA+LV++    +               P T   +   + E  V  + Y    S     +  ++NC +   A   H  LC LLL     L   F                              + ++ D  +    ELE LA           LQ   + + IA+Q S D+  L+S ++ ++ +FL T + H      L+   H LR++RFSEAFF+ E
Sbjct:    1 MSEVQGTVEFSVELHKFYNVDLFQRGYYQIRVTLKVSSRIPHRLSASIVGQSESSSLHSACVHESAVHS-------------RVFQILYRNEEVSINDAMLFRVHLLLDGERVEDALSEVEFQLKVDLHFTDSEQQLRDVTGTPMISSRTLGLHFHPRRGLHHQVPVMFDYFHLSVISVAIHAALVALQQPLISFTRPGRGSWLGKGGPDTGPEQPTISLENLVFGAGYCKPTSSEGSFYVPSENCIQH--AHKWHRDLCLLLLHAYQGLRLYF------------------------------LVIMRDIPELPTMELEALAVEETLSQLCSELQMLNNPEKIAEQISKDLAWLASHLMALWTQFLDTVTLHSQVTTYLTQEHHTLRVRRFSEAFFYME 355          
BLAST of Family with sequence similarity 135 member A vs. Ensembl Mouse
Match: Fam135a (family with sequence similarity 135, member A [Source:MGI Symbol;Acc:MGI:1915437])

HSP 1 Score: 310.071 bits (793), Expect = 6.713e-87
Identity = 162/318 (50.94%), Postives = 215/318 (67.61%), Query Frame = 2
Query: 2510 FYQLKAKLMTDLSPQFQGNVYSEMSNIPASKKPYFSHRDSDELSASSSLHYIICVHGLDGEHRDLRLVKAYLSLALPEQRFEFLMSEANEPNTFADIDEMKELLVDEILEKIQDLRENPDKISFIGHSLGCLLIRAAIASPRLSKLVPKFHTFLSLGGPHLGTLYGSSVLVNVGLWVMQKVRKSICLQQLALKDSPTDLRRSYLYRLSGQSGLEHFKYILLASSSQDRYVPYHSTRIELCKAAVKDNSELGIVYMEMVTKILQRLLRSGKTTVIRYDAHYTLPRSANNYIGRAAHIALIDSELFLEKFISVSAAKYFR 3463
            F Q K +L     P F   +YS++  + AS  PYFS  + D   +   +H I+CVHGLDG   DLRLVK Y+ L LP  R +FLMSE N+ +TFAD D M + L+DEI++ IQ       KISFIGHSLG L+IR+ +  PR    + K HTFLSL GPHLGTLY SS LVN GLW MQK +KS  L QL  +D  +D R+++LY+LS ++GL +FK ++L  S QDRYVPYHS RIE+CK A+KD  + G +Y EM+  +L+ +L+S    ++RY+    LP +A++ IGRAAHIA++DSE+FLEKF  V+A KYF+
Sbjct:  984 FLQAKEELKQLRLPGF---MYSDVPLL-ASSAPYFSMDEED--GSEDGVHLIVCVHGLDGNSADLRLVKTYIELGLPGGRVDFLMSERNQNDTFADFDCMTDRLLDEIIQYIQIYSLTVSKISFIGHSLGNLIIRSVLTRPRFKYYLSKLHTFLSLSGPHLGTLYNSSALVNTGLWFMQKWKKSGSLLQLTCRDH-SDPRQTFLYKLSNKAGLHYFKNVVLVGSLQDRYVPYHSARIEMCKTALKDK-QSGQIYSEMIHNLLRPVLQSKGCNLVRYNVINALPNTADSLIGRAAHIAVLDSEIFLEKFFLVAALKYFQ 1293          

HSP 2 Score: 84.7297 bits (208), Expect = 5.471e-16
Identity = 77/310 (24.84%), Postives = 142/310 (45.81%), Query Frame = 2
Query:  368 SKSVLIIYKEESLRMYDIFEQTMHLQMDALSIEEQIYKSEIILVVELWF--GEKRNEIIEEMRCVCERQLKVHLIASQGLHHHITVIFDYYYLAAVELVVHASLVSISPCYLRLP---QTSANEADSNFERNVSLYQSWHSILFT-------STKNC------GRRHAACLVHNHLCQLLLAVIDSLMSTFQDALSFFSPDQRSQIDDK----LHAQLC-PAQSKSINVLADWMKFAPNELERLAFILQSQTSEDDIADQASIDITKLSSRIVVIFNEFLKTSSFHQNYVESLSLRTHKLRIKRFSEAFF 1228
             K+  I+YK E + + D+    + + +D   IEE + +   +L + L F  G+   + +  ++ +  R LK+H    +GLHHH  V+FDY++L+ V + VHASLV++    +  P   +T+    ++  +   S   +  S++F        S   C         H A   H  LC  LL     L S F          Q+  +       L+ +L    Q ++ N            L  L   ++   + D++A+  ++++ +L S ++ ++ +FL+  + H++    L+   H LR++RFSEAFF
Sbjct:   26 GKTFQILYKNEEVVLNDVMIFKVKMLLDERKIEETLEEISFLLSLGLHFTDGDYSADDLNALQLISSRTLKLHYSICRGLHHHANVMFDYFHLSVVSVTVHASLVALHQPLISFPRPVKTTWLNRNAPAQSKDSAIPTLESVVFGINYTKQLSPDGCSFLIAESFLHHAYHFHYTLCATLLLAFKGLHSYFITVTEEIPSCQKLDLAKASMQVLYERLLRRTQPRTQNDTCLEEMDVEARLTELCEEVKKVENPDELAELINMNLAQLCSLLMALWGQFLEAITLHEDLRVLLAQEHHTLRVRRFSEAFF 335          
BLAST of Family with sequence similarity 135 member A vs. Ensembl Mouse
Match: Fam135a (family with sequence similarity 135, member A [Source:MGI Symbol;Acc:MGI:1915437])

HSP 1 Score: 309.686 bits (792), Expect = 8.129e-87
Identity = 162/318 (50.94%), Postives = 215/318 (67.61%), Query Frame = 2
Query: 2510 FYQLKAKLMTDLSPQFQGNVYSEMSNIPASKKPYFSHRDSDELSASSSLHYIICVHGLDGEHRDLRLVKAYLSLALPEQRFEFLMSEANEPNTFADIDEMKELLVDEILEKIQDLRENPDKISFIGHSLGCLLIRAAIASPRLSKLVPKFHTFLSLGGPHLGTLYGSSVLVNVGLWVMQKVRKSICLQQLALKDSPTDLRRSYLYRLSGQSGLEHFKYILLASSSQDRYVPYHSTRIELCKAAVKDNSELGIVYMEMVTKILQRLLRSGKTTVIRYDAHYTLPRSANNYIGRAAHIALIDSELFLEKFISVSAAKYFR 3463
            F Q K +L     P F   +YS++  + AS  PYFS  + D   +   +H I+CVHGLDG   DLRLVK Y+ L LP  R +FLMSE N+ +TFAD D M + L+DEI++ IQ       KISFIGHSLG L+IR+ +  PR    + K HTFLSL GPHLGTLY SS LVN GLW MQK +KS  L QL  +D  +D R+++LY+LS ++GL +FK ++L  S QDRYVPYHS RIE+CK A+KD  + G +Y EM+  +L+ +L+S    ++RY+    LP +A++ IGRAAHIA++DSE+FLEKF  V+A KYF+
Sbjct: 1001 FLQAKEELKQLRLPGF---MYSDVPLL-ASSAPYFSMDEED--GSEDGVHLIVCVHGLDGNSADLRLVKTYIELGLPGGRVDFLMSERNQNDTFADFDCMTDRLLDEIIQYIQIYSLTVSKISFIGHSLGNLIIRSVLTRPRFKYYLSKLHTFLSLSGPHLGTLYNSSALVNTGLWFMQKWKKSGSLLQLTCRDH-SDPRQTFLYKLSNKAGLHYFKNVVLVGSLQDRYVPYHSARIEMCKTALKDK-QSGQIYSEMIHNLLRPVLQSKGCNLVRYNVINALPNTADSLIGRAAHIAVLDSEIFLEKFFLVAALKYFQ 1310          

HSP 2 Score: 123.25 bits (308), Expect = 9.989e-28
Identity = 98/386 (25.39%), Postives = 178/386 (46.11%), Query Frame = 2
Query:  125 MSIVQVALSFAVEIWKFHNIDLFHQGAFQIRSYFKTTSSSPALIENPKIWDRSKSINFPECTKPSFVSSSDPKLNLPAKAVSKSVLIIYKEESLRMYDIFEQTMHLQMDALSIEEQIYKSEIILVVELWF--GEKRNEIIEEMRCVCERQLKVHLIASQGLHHHITVIFDYYYLAAVELVVHASLVSISPCYLRLP---QTSANEADSNFERNVSLYQSWHSILFT-------STKNC------GRRHAACLVHNHLCQLLLAVIDSLMSTFQDALSFFSPDQRSQIDDKLHAQLCPAQSKSINVLADWMKFAPNELERLAFILQSQTSEDDIADQASIDITKLSSRIVVIFNEFLKTSSFHQNYVESLSLRTHKLRIKRFSEAFF 1228
            M+ VQ  + F+VE+ KF+N+DLF +G +QIR+  K  +  P  +E   +     ++ FP     + V              SK+  I+YK E + + D+    + + +D   IEE + +   +L + L F  G+   + +  ++ +  R LK+H    +GLHHH  V+FDY++L+ V + VHASLV++    +  P   +T+    ++  +   S   +  S++F        S   C         H A   H  LC  LL     L S F          Q+  +++             ++V A         L  L   ++   + D++A+  ++++ +L S ++ ++ +FL+  + H++    L+   H LR++RFSEAFF
Sbjct:    1 MTEVQAMVEFSVELNKFYNVDLFQRGFYQIRASMKIPARIPHRVEASLLHATGMTLAFPASVHDALV-------------CSKTFQILYKNEEVVLNDVMIFKVKMLLDERKIEETLEEISFLLSLGLHFTDGDYSADDLNALQLISSRTLKLHYSICRGLHHHANVMFDYFHLSVVSVTVHASLVALHQPLISFPRPVKTTWLNRNAPAQSKDSAIPTLESVVFGINYTKQLSPDGCSFLIAESFLHHAYHFHYTLCATLLLAFKGLHSYFITVTEEIPSCQKLDLEE-------------MDVEA--------RLTELCEEVKKVENPDELAELINMNLAQLCSLLMALWGQFLEAITLHEDLRVLLAQEHHTLRVRRFSEAFF 352          
BLAST of Family with sequence similarity 135 member A vs. Ensembl Mouse
Match: Fam135a (family with sequence similarity 135, member A [Source:MGI Symbol;Acc:MGI:1915437])

HSP 1 Score: 310.842 bits (795), Expect = 1.295e-86
Identity = 162/318 (50.94%), Postives = 215/318 (67.61%), Query Frame = 2
Query: 2510 FYQLKAKLMTDLSPQFQGNVYSEMSNIPASKKPYFSHRDSDELSASSSLHYIICVHGLDGEHRDLRLVKAYLSLALPEQRFEFLMSEANEPNTFADIDEMKELLVDEILEKIQDLRENPDKISFIGHSLGCLLIRAAIASPRLSKLVPKFHTFLSLGGPHLGTLYGSSVLVNVGLWVMQKVRKSICLQQLALKDSPTDLRRSYLYRLSGQSGLEHFKYILLASSSQDRYVPYHSTRIELCKAAVKDNSELGIVYMEMVTKILQRLLRSGKTTVIRYDAHYTLPRSANNYIGRAAHIALIDSELFLEKFISVSAAKYFR 3463
            F Q K +L     P F   +YS++  + AS  PYFS  + D   +   +H I+CVHGLDG   DLRLVK Y+ L LP  R +FLMSE N+ +TFAD D M + L+DEI++ IQ       KISFIGHSLG L+IR+ +  PR    + K HTFLSL GPHLGTLY SS LVN GLW MQK +KS  L QL  +D  +D R+++LY+LS ++GL +FK ++L  S QDRYVPYHS RIE+CK A+KD  + G +Y EM+  +L+ +L+S    ++RY+    LP +A++ IGRAAHIA++DSE+FLEKF  V+A KYF+
Sbjct: 1197 FLQAKEELKQLRLPGF---MYSDVPLL-ASSAPYFSMDEED--GSEDGVHLIVCVHGLDGNSADLRLVKTYIELGLPGGRVDFLMSERNQNDTFADFDCMTDRLLDEIIQYIQIYSLTVSKISFIGHSLGNLIIRSVLTRPRFKYYLSKLHTFLSLSGPHLGTLYNSSALVNTGLWFMQKWKKSGSLLQLTCRDH-SDPRQTFLYKLSNKAGLHYFKNVVLVGSLQDRYVPYHSARIEMCKTALKDK-QSGQIYSEMIHNLLRPVLQSKGCNLVRYNVINALPNTADSLIGRAAHIAVLDSEIFLEKFFLVAALKYFQ 1506          

HSP 2 Score: 122.479 bits (306), Expect = 1.925e-27
Identity = 98/386 (25.39%), Postives = 178/386 (46.11%), Query Frame = 2
Query:  125 MSIVQVALSFAVEIWKFHNIDLFHQGAFQIRSYFKTTSSSPALIENPKIWDRSKSINFPECTKPSFVSSSDPKLNLPAKAVSKSVLIIYKEESLRMYDIFEQTMHLQMDALSIEEQIYKSEIILVVELWF--GEKRNEIIEEMRCVCERQLKVHLIASQGLHHHITVIFDYYYLAAVELVVHASLVSISPCYLRLP---QTSANEADSNFERNVSLYQSWHSILFT-------STKNC------GRRHAACLVHNHLCQLLLAVIDSLMSTFQDALSFFSPDQRSQIDDKLHAQLCPAQSKSINVLADWMKFAPNELERLAFILQSQTSEDDIADQASIDITKLSSRIVVIFNEFLKTSSFHQNYVESLSLRTHKLRIKRFSEAFF 1228
            M+ VQ  + F+VE+ KF+N+DLF +G +QIR+  K  +  P  +E   +     ++ FP     + V              SK+  I+YK E + + D+    + + +D   IEE + +   +L + L F  G+   + +  ++ +  R LK+H    +GLHHH  V+FDY++L+ V + VHASLV++    +  P   +T+    ++  +   S   +  S++F        S   C         H A   H  LC  LL     L S F          Q+  +++             ++V A         L  L   ++   + D++A+  ++++ +L S ++ ++ +FL+  + H++    L+   H LR++RFSEAFF
Sbjct:    1 MTEVQAMVEFSVELNKFYNVDLFQRGFYQIRASMKIPARIPHRVEASLLHATGMTLAFPASVHDALV-------------CSKTFQILYKNEEVVLNDVMIFKVKMLLDERKIEETLEEISFLLSLGLHFTDGDYSADDLNALQLISSRTLKLHYSICRGLHHHANVMFDYFHLSVVSVTVHASLVALHQPLISFPRPVKTTWLNRNAPAQSKDSAIPTLESVVFGINYTKQLSPDGCSFLIAESFLHHAYHFHYTLCATLLLAFKGLHSYFITVTEEIPSCQKLDLEE-------------MDVEA--------RLTELCEEVKKVENPDELAELINMNLAQLCSLLMALWGQFLEAITLHEDLRVLLAQEHHTLRVRRFSEAFF 352          
BLAST of Family with sequence similarity 135 member A vs. Ensembl Mouse
Match: Fam135a (family with sequence similarity 135, member A [Source:MGI Symbol;Acc:MGI:1915437])

HSP 1 Score: 255.373 bits (651), Expect = 1.267e-76
Identity = 139/301 (46.18%), Postives = 182/301 (60.47%), Query Frame = 2
Query: 2561 GNVYSEMSNIPASKKPYFSHRDSDELSASSSLHYIICVHGLDGEHRDLRLVKAYLSLALPEQRFEFLMSEANEPNTFADIDEMKELLVDEILEKIQDLRENPDKISFIGHSLGCLLIRAAIASPRLSKLVPKFHTFLSLGGPHLGTLYGSSVLVNVGLWVMQKVRKSICLQQLALKDSPTDLRRSYLYRLSGQSGLEHFKYILLASSSQDRYVPYHSTRIELCKAAVKDNSELGIVYMEMVTKILQRLLRSGKTTVIRYDAHYTLPRSANNYIGRAAHIALIDSELFLEKFISVSAAKYFR 3463
            G +YS++  + AS  PYFS  + D   +   +H I+CVHGLDG   DLRLVK Y+ L LP  R +FLMSE N+ +TFAD D M + L+DEI++ IQ       KISFIGHSLG L+IR+ +  PR    + K HTFLSL GPHLGTLY SS LVN                                      +GL +FK ++L  S QDRYVPYHS RIE+CK A+KD    G +Y EM+  +L+ +L+S    ++RY+    LP +A++ IGRAAHIA++DSE+FLEKF  V+A KYF+
Sbjct:   13 GFMYSDVP-LLASSAPYFSMDEED--GSEDGVHLIVCVHGLDGNSADLRLVKTYIELGLPGGRVDFLMSERNQNDTFADFDCMTDRLLDEIIQYIQIYSLTVSKISFIGHSLGNLIIRSVLTRPRFKYYLSKLHTFLSLSGPHLGTLYNSSALVN--------------------------------------TGLHYFKNVVLVGSLQDRYVPYHSARIEMCKTALKDKQS-GQIYSEMIHNLLRPVLQSKGCNLVRYNVINALPNTADSLIGRAAHIAVLDSEIFLEKFFLVAALKYFQ 271          
BLAST of Family with sequence similarity 135 member A vs. UniProt/SwissProt
Match: sp|Q641I1|F135B_XENLA (Protein FAM135B OS=Xenopus laevis OX=8355 GN=fam135b PE=2 SV=1)

HSP 1 Score: 319.316 bits (817), Expect = 6.655e-89
Identity = 159/320 (49.69%), Postives = 217/320 (67.81%), Query Frame = 2
Query: 2504 VTFYQLKAKLMTDLSPQFQGNVYSEMSNIPASKKPYFSHRDSDELSASSSLHYIICVHGLDGEHRDLRLVKAYLSLALPEQRFEFLMSEANEPNTFADIDEMKELLVDEILEKIQDLRENPDKISFIGHSLGCLLIRAAIASPRLSKLVPKFHTFLSLGGPHLGTLYGSSVLVNVGLWVMQKVRKSICLQQLALKDSPTDLRRSYLYRLSGQSGLEHFKYILLASSSQDRYVPYHSTRIELCKAAVKDNSELGIVYMEMVTKILQRLLRSGKTTVIRYDAHYTLPRSANNYIGRAAHIALIDSELFLEKFISVSAAKYFR 3463
            ++F+Q K K   +L  +F+G +YS+   + AS  PYF     +E      +H ++CVHGLDG   DLRLVK +L L LP    +FLMSE N+ +TFAD D M + L+DEI++ IQ    +  +ISFIGHSLG ++IR+ +  PR    + K HTFLSL GPHLGTLY +S LVN GLW+MQK++KS  L QL  +D+  DLR+ +LY+LS + GL++FK ++L +S QDRYVP+HS RIE+CK A KD    G VY EM+  +LQ ++ S   T+IR++  + LP +AN  IGRAAHIA++DSELFLEKF  V+   YF+
Sbjct: 1065 LSFHQAKDKFRKEL--KFEGFLYSDQP-VLASDVPYFP---PEEEQTEDGIHLVVCVHGLDGNSADLRLVKTFLELGLPGANLDFLMSEKNQTDTFADFDAMTDRLIDEIVQHIQLYNLSISRISFIGHSLGTIIIRSVLTRPRFRYYLNKLHTFLSLSGPHLGTLYSNSTLVNTGLWLMQKLKKSGSLLQLTFRDN-ADLRKCFLYQLSQKPGLQYFKNVVLVASPQDRYVPFHSARIEMCKNATKDR-HTGPVYTEMINNLLQPVIDSKDCTLIRHNVSHALPNTANTLIGRAAHIAVLDSELFLEKFFLVAGLGYFK 1376          

HSP 2 Score: 122.865 bits (307), Expect = 1.050e-26
Identity = 98/394 (24.87%), Postives = 183/394 (46.45%), Query Frame = 2
Query:  125 MSIVQVALSFAVEIWKFHNIDLFHQGAFQIRSYFKTTSSSPALIENPKIWDRSKSINFPECTKPSFVSSSDPKLNLPAKAVSKSVLIIYKEESLRMYDIFEQTMHLQMDALSIEEQIYKSEIILVVELWFGEKRNEI--IEEMRCVCERQLKVHLIASQGLHHHITVIFDYYYLAAVELVVHASLVSISPCYLRL--PQTSANEADSNFE---RNVSLYQSWHSILFTS--------------TKNCGRRHAACLVHNHLCQLLLAVIDSLMSTFQDALSFFSPDQRSQIDDKLHAQLCPAQSKSINVLADWMKFAPNE--LERLAFILQSQTSEDDIADQASIDITKLSSRIVVIFNEFLKTSSFHQNYVESLSLRTHKLRIKRFSEAFFFQE 1237
            MS VQ  + F++E+ KFHN+DLF +G + +R+  K +S  P  +    +        +P C   + V              S+   I+Y+ E + + D+    +HL +D   +E+ + + +  L ++L F +   ++  +  +  +  R L ++   + GLHHH+ V+FDY++L+ + + VH SL+++    +    P  ++    S  E    N S+  S  +++F S              +++C +   A   H  LCQLLL+   +L     + L         +I D  H+++               +  P E  L +L   LQ  +  ++I +Q S D+  L S++++ ++ FL+T +   +    L    H LR++RFSEAFF+ E
Sbjct:    1 MSEVQGTIEFSIELHKFHNVDLFQRGYYHVRASLKASSRIPHRLVATLVGQTDDPGPYPPCVYDNVV-------------YSRMFQILYRNEDIDINDVMAFKVHLLLDGERVEDALSEVDFQLKLDLHFTDSEQQLKDMSAVPLISSRTLGLYFHPTSGLHHHVPVMFDYFHLSVISVTVHGSLIALHQPLISFARPVKASWLGKSGQELVTDNTSI--SMENLVFGSAYCKPPSSEGSYVPSEDCIQH--AYKWHKDLCQLLLSAYSALGLCHANVL--------KEIPDLPHSEI---------------EELPTERTLSQLCNQLQLLSDPEEITEQISKDLAWLRSQLLITWSHFLETVTLQPDVTSYLMQEHHTLRVRRFSEAFFYTE 354          
BLAST of Family with sequence similarity 135 member A vs. UniProt/SwissProt
Match: sp|Q5RA75|F135A_PONAB (Protein FAM135A OS=Pongo abelii OX=9601 GN=FAM135A PE=2 SV=1)

HSP 1 Score: 313.153 bits (801), Expect = 4.253e-88
Identity = 159/304 (52.30%), Postives = 209/304 (68.75%), Query Frame = 2
Query: 2552 QFQGNVYSEMSNIPASKKPYFSHRDSDELSASSSLHYIICVHGLDGEHRDLRLVKAYLSLALPEQRFEFLMSEANEPNTFADIDEMKELLVDEILEKIQDLRENPDKISFIGHSLGCLLIRAAIASPRLSKLVPKFHTFLSLGGPHLGTLYGSSVLVNVGLWVMQKVRKSICLQQLALKDSPTDLRRSYLYRLSGQSGLEHFKYILLASSSQDRYVPYHSTRIELCKAAVKDNSELGIVYMEMVTKILQRLLRSGKTTVIRYDAHYTLPRSANNYIGRAAHIALIDSELFLEKFISVSAAKYFR 3463
            +  G +YSE+  + AS  PYFS  + D   +   +H I+CVHGLDG   DLRLVK Y+ L LP  R +FLMSE N+ +TFAD D M + L+DEI++ IQ       KISFIGHSLG L+IR+ +  PR    + K HTFLSL GPHLGTLY SS LVN GLW MQK +KS  L QL  +D  +D R+++LY+LS ++GL +FK ++L  S QDRYVPYHS RIE+CK A+KD    G +Y EM+  +LQ +L+S    ++RY+    LP +A++ IGRAAHIA++DSE+FLEKF  V+A KYF+
Sbjct:  797 KLPGFMYSEVP-LLASSVPYFSVEEED--GSEDGVHLIVCVHGLDGNSADLRLVKTYIELGLPGGRIDFLMSERNQNDTFADFDSMTDRLLDEIIQYIQIYSLTVSKISFIGHSLGNLIIRSVLTRPRFKYYLNKLHTFLSLSGPHLGTLYNSSALVNTGLWFMQKWKKSGSLLQLTCRDH-SDPRQTFLYKLSKKAGLHYFKNVVLVGSLQDRYVPYHSARIEMCKTALKDKQS-GQIYSEMIHNLLQPVLQSKDCNLVRYNVINALPNTADSLIGRAAHIAVLDSEIFLEKFFLVAALKYFQ 1095          

HSP 2 Score: 129.798 bits (325), Expect = 5.551e-29
Identity = 102/391 (26.09%), Postives = 183/391 (46.80%), Query Frame = 2
Query:  125 MSIVQVALSFAVEIWKFHNIDLFHQGAFQIRSYFKTTSSSPALIENPKIWDRSKSINFPECTKPSFVSSSDPKLNLPAKAVSKSVLIIYKEESLRMYDIFEQTMHLQMDALSIEEQIYKSEIILVVELWF--GEKRNEIIEEMRCVCERQLKVHLIASQGLHHHITVIFDYYYLAAVELVVHASLVSISPCYLRLP---QTSANEADSNFERNVSLYQSWHSILFT-------STKNC------GRRHAACLVHNHLCQLLLAVIDSLMSTFQDALSFFSPDQRSQIDDKLHAQLCPAQSKSINVLADWMKFAPNELERLAFILQSQTSEDDIADQASIDITKLSSRIVVIFNEFLKTSSFHQNYVESLSLRTHKLRIKRFSEAFFFQEFS 1243
            M+ VQ  + F+VE+ KF+N+DLF +G +QIRS  K  S  P  +E   +     ++ FP     S +              SK+  I+YK E + + D+    + + +D   IEE + +   +L ++L F  G+   + +  ++ +  R LK+H    +GLHHH+ V+FDY++L+ V + VHASLV++    +  P   +T+    ++  +   S+  +  S++F        S   C         H A   H  LC  LL     L S F          Q+ ++++             ++V A         L  L   ++   + D++A+  ++++ +L S ++ ++ +FL+  + H+     L+   H LR++RFSEAFF  E S
Sbjct:    1 MTEVQAMVEFSVELNKFYNVDLFQRGFYQIRSSMKIPSRIPHRVEASLLHATGMTLAFPASVHDSLI-------------CSKTFQILYKNEEVVLNDVMIFKVKMLLDERKIEETLEEMNFLLSLDLHFTDGDYSADDLNALQLISSRTLKLHFSPHRGLHHHVNVMFDYFHLSVVSVTVHASLVALHQPLISFPRPVKTTWLNRNAPAQNKDSVIPTLESVVFGINYTKQLSPDGCSFIIADSFLHHAYRFHYTLCATLLLAFKGLHSYFITVTEEIPSCQKLELEE-------------MDVEA--------RLTELCEEVKKIENPDELAELINMNLAQLCSLLMALWGQFLEVITLHEELRILLAQEHHTLRVRRFSEAFFCFEHS 357          
BLAST of Family with sequence similarity 135 member A vs. UniProt/SwissProt
Match: sp|Q9DAI6|F135B_MOUSE (Protein FAM135B OS=Mus musculus OX=10090 GN=Fam135b PE=1 SV=3)

HSP 1 Score: 312.383 bits (799), Expect = 1.300e-86
Identity = 157/319 (49.22%), Postives = 221/319 (69.28%), Query Frame = 2
Query: 2507 TFYQLKAKLMTDLSPQFQGNVYSEMSNIPASKKPYFSHRDSDELSASSSLHYIICVHGLDGEHRDLRLVKAYLSLALPEQRFEFLMSEANEPNTFADIDEMKELLVDEILEKIQDLRENPDKISFIGHSLGCLLIRAAIASPRLSKLVPKFHTFLSLGGPHLGTLYGSSVLVNVGLWVMQKVRKSICLQQLALKDSPTDLRRSYLYRLSGQSGLEHFKYILLASSSQDRYVPYHSTRIELCKAAVKDNSELGIVYMEMVTKILQRLLRSGKTTVIRYDAHYTLPRSANNYIGRAAHIALIDSELFLEKFISVSAAKYFR 3463
            +FYQ K K   +L  + +G +YS++S + AS  PYF   + +E +    +H ++CVHGLDG   DLRLVK ++ L LP  + +FLMSE N+ +TFAD D M + L+DEI++ IQ    +  +ISFIGHSLG ++IR+ +  PR    + K HTFLSL GPHLGTLY +S LV+ GLW+MQK++KS  L QL  +D+  DLR+ +LY+LS ++GL++FK ++L +S QDRYVP+HS RIE+CK A+KD    G VY EM+  +L  L+ +   T+IR++  + LP +AN  IGRAAHIA++DSELFLEKF  V+   YF+
Sbjct: 1091 SFYQAKEKFKKEL--KIEGFLYSDLS-VLASDIPYFP-PEEEEENLEDGIHLVVCVHGLDGNSADLRLVKTFIELGLPGGKLDFLMSEKNQTDTFADFDTMTDRLLDEIIQHIQLYNLSISRISFIGHSLGNIIIRSVLTRPRFRYYLNKLHTFLSLSGPHLGTLYNNSTLVSTGLWLMQKLKKSGSLLQLTFRDN-ADLRKCFLYQLSQKTGLQYFKNVVLVASPQDRYVPFHSARIEMCKTALKDR-HTGPVYAEMINNLLGPLVEAKDCTLIRHNVFHALPNTANTLIGRAAHIAVLDSELFLEKFFLVAGLNYFK 1403          

HSP 2 Score: 120.168 bits (300), Expect = 6.013e-26
Identity = 102/400 (25.50%), Postives = 169/400 (42.25%), Query Frame = 2
Query:  125 MSIVQVALSFAVEIWKFHNIDLFHQGAFQIRSYFKTTSSSPALIENPKIWDRSKSINFPECTKPSFVSSSDPKLNLPAKAVSKSVLIIYKEESLRMYDIFEQTMHLQMDALSIEEQIYKSEIILVVELWFGEKRNEI--IEEMRCVCERQLKVHLIASQGLHHHITVIFDYYYLAAVELVVHASLVSISPCYLRL-------------PQTSANEADSNFERNV--SLY---QSWHSILFTSTKNCGRRHAACLVHNHLCQLLLAVIDSLMSTFQDALSFFSPDQRSQIDDKLHAQLCPAQSKSINVLADWMKFAPNELERLAF---------ILQSQTSEDDIADQASIDITKLSSRIVVIFNEFLKTSSFHQNYVESLSLRTHKLRIKRFSEAFFFQE 1237
            MS VQ  + F+VE+ KF+N+DLF +G +QIR   K +S  P  +    +     S     C   S V S             +   I+Y+ E + + D     +HL +D   +E+ + + E  L V+L F +   ++  +     +  R L +H    +GLHH + V+FDY++L+ + + +HA+LV++    +               P T   +   + E  V  + Y    S     +  ++NC +   A   H  LC LLL     L   F                              + ++ D  +    ELE LA           LQ   + + IA+Q S D+  L+S ++ ++ +FL T + H      L+   H LR++RFSEAFF+ E
Sbjct:    1 MSEVQGTVEFSVELHKFYNVDLFQRGYYQIRVTLKVSSRIPHRLSASIVGQSESSSLHSACVHESAVHS-------------RVFQILYRNEEVSINDAMLFRVHLLLDGERVEDALSEVEFQLKVDLHFTDSEQQLRDVTGTPMISSRTLGLHFHPRRGLHHQVPVMFDYFHLSVISVAIHAALVALQQPLISFTRPGRGSWLGKGGPDTGPEQPTISLENLVFGAGYCKPTSSEGSFYVPSENCIQH--AHKWHRDLCLLLLHAYQGLRLYF------------------------------LVIMRDIPELPTMELEALAVEETLSQLCSELQMLNNPEKIAEQISKDLAWLASHLMALWTQFLDTVTLHSQVTTYLTQEHHTLRVRRFSEAFFYME 355          
BLAST of Family with sequence similarity 135 member A vs. UniProt/SwissProt
Match: sp|Q9P2D6|F135A_HUMAN (Protein FAM135A OS=Homo sapiens OX=9606 GN=FAM135A PE=1 SV=2)

HSP 1 Score: 313.153 bits (801), Expect = 1.528e-86
Identity = 163/318 (51.26%), Postives = 215/318 (67.61%), Query Frame = 2
Query: 2510 FYQLKAKLMTDLSPQFQGNVYSEMSNIPASKKPYFSHRDSDELSASSSLHYIICVHGLDGEHRDLRLVKAYLSLALPEQRFEFLMSEANEPNTFADIDEMKELLVDEILEKIQDLRENPDKISFIGHSLGCLLIRAAIASPRLSKLVPKFHTFLSLGGPHLGTLYGSSVLVNVGLWVMQKVRKSICLQQLALKDSPTDLRRSYLYRLSGQSGLEHFKYILLASSSQDRYVPYHSTRIELCKAAVKDNSELGIVYMEMVTKILQRLLRSGKTTVIRYDAHYTLPRSANNYIGRAAHIALIDSELFLEKFISVSAAKYFR 3463
            F Q K +L     P F   +YSE+  + AS  PYFS  + D   +   +H I+CVHGLDG   DLRLVK Y+ L LP  R +FLMSE N+ +TFAD D M + L+DEI++ IQ       KISFIGHSLG L+IR+ +  PR    + K HTFLSL GPHLGTLY SS LVN GLW MQK +KS  L QL  +D  +D R+++LY+LS ++GL +FK ++L  S QDRYVPYHS RIE+CK A+KD  + G +Y EM+  +L+ +L+S    ++RY+    LP +A++ IGRAAHIA++DSE+FLEKF  V+A KYF+
Sbjct: 1206 FLQAKEELKLLKLPGF---MYSEVP-LLASSVPYFSVEEED--GSEDGVHLIVCVHGLDGNSADLRLVKTYIELGLPGGRIDFLMSERNQNDTFADFDSMTDRLLDEIIQYIQIYSLTVSKISFIGHSLGNLIIRSVLTRPRFKYYLNKLHTFLSLSGPHLGTLYNSSALVNTGLWFMQKWKKSGSLLQLTCRDH-SDPRQTFLYKLSNKAGLHYFKNVVLVGSLQDRYVPYHSARIEMCKTALKDK-QSGQIYSEMIHNLLRPVLQSKDCNLVRYNVINALPNTADSLIGRAAHIAVLDSEIFLEKFFLVAALKYFQ 1515          

HSP 2 Score: 128.257 bits (321), Expect = 2.089e-28
Identity = 99/386 (25.65%), Postives = 181/386 (46.89%), Query Frame = 2
Query:  125 MSIVQVALSFAVEIWKFHNIDLFHQGAFQIRSYFKTTSSSPALIENPKIWDRSKSINFPECTKPSFVSSSDPKLNLPAKAVSKSVLIIYKEESLRMYDIFEQTMHLQMDALSIEEQIYKSEIILVVELWF--GEKRNEIIEEMRCVCERQLKVHLIASQGLHHHITVIFDYYYLAAVELVVHASLVSISPCYLRLP---QTSANEADSNFERNVSLYQSWHSILFT-------STKNC------GRRHAACLVHNHLCQLLLAVIDSLMSTFQDALSFFSPDQRSQIDDKLHAQLCPAQSKSINVLADWMKFAPNELERLAFILQSQTSEDDIADQASIDITKLSSRIVVIFNEFLKTSSFHQNYVESLSLRTHKLRIKRFSEAFF 1228
            M+ VQ  + F+VE+ KF+N+DLF +G +QIR+  K  S  P  +E   +     ++ FP     S +              SK+  I+YK E + + D+    + + +D   IEE + +   +L ++L F  G+   + +  ++ +  R LK+H    +GLHHH+ V+FDY++L+ V + VHASLV++    +  P   +T+    ++  +   S+  +  S++F        S   C         H A   H  LC  LL     L S F          Q+ ++++             ++V A         L  L   ++   + D++A+  ++++ +L S ++ ++ +FL+  + H+     L+   H LR++RFSEAFF
Sbjct:    1 MTEVQAMVEFSVELNKFYNVDLFQRGFYQIRASMKIPSRIPHRVEASLLHATGMTLAFPASVHDSLI-------------CSKTFQILYKNEEVVLNDVMIFKVKMLLDERKIEETLEEMNFLLSLDLHFTDGDYSADDLNALQLISSRTLKLHFSPHRGLHHHVNVMFDYFHLSVVSVTVHASLVALHQPLISFPRPVKTTWLNRNAPAQNKDSVIPTLESVVFGINYTKQLSPDGCSFIIADSFLHHAYRFHYTLCATLLLAFKGLHSYFITVTEEIPSCQKLELEE-------------MDVEA--------RLTELCEEVKKIENPDELAELINMNLAQLCSLLMALWGQFLEVITLHEELRILLAQEHHTLRVRRFSEAFF 352          
BLAST of Family with sequence similarity 135 member A vs. UniProt/SwissProt
Match: sp|Q49AJ0|F135B_HUMAN (Protein FAM135B OS=Homo sapiens OX=9606 GN=FAM135B PE=2 SV=2)

HSP 1 Score: 311.227 bits (796), Expect = 3.670e-86
Identity = 159/329 (48.33%), Postives = 226/329 (68.69%), Query Frame = 2
Query: 2492 LNEQVT-----FYQLKAKLMTDLSPQFQGNVYSEMSNIPASKKPYFSHRDSDELSASSSLHYIICVHGLDGEHRDLRLVKAYLSLALPEQRFEFLMSEANEPNTFADIDEMKELLVDEILEKIQDLRENPDKISFIGHSLGCLLIRAAIASPRLSKLVPKFHTFLSLGGPHLGTLYGSSVLVNVGLWVMQKVRKSICLQQLALKDSPTDLRRSYLYRLSGQSGLEHFKYILLASSSQDRYVPYHSTRIELCKAAVKDNSELGIVYMEMVTKILQRLLRSGKTTVIRYDAHYTLPRSANNYIGRAAHIALIDSELFLEKFISVSAAKYFR 3463
            L+E+V+     FYQ K K   +L  + +G +YS+++ + AS  PYF   + +E +    +H ++CVHGLDG   DLRLVK ++ L LP  + +FLMSE N+ +TFAD D M + L+DEI++ IQ    +  +ISFIGHSLG ++IR+ +  PR    + K HTFLSL GPHLGTLY +S LV+ GLW+MQK++KS  L QL  +D+  DLR+ +LY+LS ++GL++FK ++L +S QDRYVP+HS RIE+CK A+KD    G VY EM+  +L  L+ +   T+IR++  + LP +AN  IGRAAHIA++DSELFLEKF  V+   YF+
Sbjct: 1084 LDEEVSERMFSFYQAKEKFKKEL--KIEGFLYSDLT-VLASDIPYFP-PEEEEENLEDGIHLVVCVHGLDGNSADLRLVKTFIELGLPGGKLDFLMSEKNQMDTFADFDTMTDRLLDEIIQHIQLYNLSISRISFIGHSLGNIIIRSVLTRPRFRYYLNKLHTFLSLSGPHLGTLYNNSTLVSTGLWLMQKLKKSGSLLQLTFRDN-ADLRKCFLYQLSQKTGLQYFKNVVLVASPQDRYVPFHSARIEMCKTALKDR-HTGPVYAEMINNLLGPLVEAKDCTLIRHNVFHALPNTANTLIGRAAHIAVLDSELFLEKFFLVAGLNYFK 1406          

HSP 2 Score: 114.775 bits (286), Expect = 2.868e-24
Identity = 101/400 (25.25%), Postives = 170/400 (42.50%), Query Frame = 2
Query:  125 MSIVQVALSFAVEIWKFHNIDLFHQGAFQIRSYFKTTSSSPALIENPKIWDRSKSINFPECTKPSFVSSSDPKLNLPAKAVSKSVLIIYKEESLRMYDIFEQTMHLQMDALSIEEQIYKSEIILVVELWFGEKRNEI--IEEMRCVCERQLKVHLIASQGLHHHITVIFDYYYLAAVELVVHASLVSISPCYL------RLPQTSANEADSNFERNVSLYQ------------SWHSILFTSTKNCGRRHAACLVHNHLCQLLLAVIDSLMSTFQDALSFFSPDQRSQIDDKLHAQLCPAQSKSINVLADWMKFAPNELERLAF---------ILQSQTSEDDIADQASIDITKLSSRIVVIFNEFLKTSSFHQNYVESLSLRTHKLRIKRFSEAFFFQE 1237
            MS +Q  + F+VE+ KF+N+DLF +G +QIR   K +S  P  +          S     C   S V S             +   I+Y+ E + + D     +HL +    +E+ + + +  L V+L F +   ++  +     V  R L +H     GLHH + V+FDY++L+ + + VHA+LV++    +      R         D+  E+++   +            S     + +++NC  +HA    H  LC LLL     L                     +LH          + ++ D  +    ELE LA           LQ   + + IA+Q S D+  L+S ++ ++ +FL T + H      L+   H LR++RFSEAFF+ E
Sbjct:    1 MSEIQGTVEFSVELHKFYNVDLFQRGYYQIRVTLKVSSRIPHRLSASIAGQTESSSLHSACVHDSTVHS-------------RVFQILYRNEEVPINDAVVFRVHLLLGGERMEDALSEVDFQLKVDLHFTDSEQQLRDVAGAPMVSSRTLGLHFHPRNGLHHQVPVMFDYFHLSVISVTVHAALVALQQPLISFTRPGRGSWLGKGGPDTGQEQSIISLENLVFGAGYCKPTSSEGSFYITSENC-MQHAHKW-HRDLCLLLLHAYRGL---------------------RLHF---------LVIMRDIPELPHTELEALAVEETLSQLCSELQMLNNPEKIAEQISKDLAWLTSHMMTLWTQFLDTVTLHSQVTTYLTQEHHTLRVRRFSEAFFYME 355          
BLAST of Family with sequence similarity 135 member A vs. TrEMBL
Match: A0A183W670 (DUF676 domain-containing protein OS=Trichobilharzia regenti OX=157069 GN=TRE_LOCUS7783 PE=4 SV=1)

HSP 1 Score: 388.267 bits (996), Expect = 1.669e-120
Identity = 186/318 (58.49%), Postives = 241/318 (75.79%), Query Frame = 2
Query: 2510 FYQLKAKLMTDLSPQFQGNVYSEMSNIPASKKPYFSHRDSDELSASSSLHYIICVHGLDGEHRDLRLVKAYLSLALPEQRFEFLMSEANEPNTFADIDEMKELLVDEILEKIQDLRENPDKISFIGHSLGCLLIRAAIASPRLSKLVPKFHTFLSLGGPHLGTLYGSSVLVNVGLWVMQKVRKSICLQQLALKDSPTDLRRSYLYRLSGQSGLEHFKYILLASSSQDRYVPYHSTRIELCKAAVKDNSELGIVYMEMVTKILQRLLRSGKTTVIRYDAHYTLPRSANNYIGRAAHIALIDSELFLEKFISVSAAKYFR 3463
            F +LK ++  +++P FQG+VYS+ + + A+   YFS    D    +  +H IICVHGLDG   DLRLV+ YL LALP+ R +FLMSE N+ +TF   + M E LV+EI+  I+D+ E P +ISFIGHS+GC++IRAA+   R+ + + K HTFLSL GPHLGT+Y SS L+N+G+WVMQK++KS  L QL L+D P DLR +YLYRLS   GL+ F+Y+LL  S QDRYVPYHSTRIELCKAA++D+S LG +YMEMVT +LQRL++S +TTV+RYD HY+L  SAN  IGRAAHIA++DSE+FLEKFI VS AKYFR
Sbjct:   71 FLRLKEQVKREIAPHFQGHVYSDFATL-AAPYAYFS----DAPIFNEDVHLIICVHGLDGNSCDLRLVRVYLQLALPDCRLQFLMSECNQQDTFGGFEIMSEKLVNEIVNYIEDMEEEPKRISFIGHSMGCVIIRAALLDHRMKRYLSKLHTFLSLSGPHLGTVYNSSGLINMGIWVMQKIKKSESLSQLRLRDDP-DLRNTYLYRLSSSPGLDLFRYVLLVGSPQDRYVPYHSTRIELCKAAIRDSSTLGFIYMEMVTNLLQRLIKSTRTTVVRYDVHYSLTNSANTLIGRAAHIAVLDSEIFLEKFICVSGAKYFR 382          
BLAST of Family with sequence similarity 135 member A vs. TrEMBL
Match: A0A4S2MKZ5 (DUF676 domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_000488 PE=4 SV=1)

HSP 1 Score: 405.986 bits (1042), Expect = 4.669e-117
Identity = 194/320 (60.62%), Postives = 248/320 (77.50%), Query Frame = 2
Query: 2504 VTFYQLKAKLMTDLSPQFQGNVYSEMSNIPASKKPYFSHRDSDELSASSSLHYIICVHGLDGEHRDLRLVKAYLSLALPEQRFEFLMSEANEPNTFADIDEMKELLVDEILEKIQDLRENPDKISFIGHSLGCLLIRAAIASPRLSKLVPKFHTFLSLGGPHLGTLYGSSVLVNVGLWVMQKVRKSICLQQLALKDSPTDLRRSYLYRLSGQSGLEHFKYILLASSSQDRYVPYHSTRIELCKAAVKDNSELGIVYMEMVTKILQRLLRSGKTTVIRYDAHYTLPRSANNYIGRAAHIALIDSELFLEKFISVSAAKYFR 3463
            + F QLK  +   +S  FQG+VYS+ + + AS   YFS  DS     S  +H ++CVHGLDG   DLRLV+ YL LALPE R EFLMSE N+ +TF   D M++ LVDE+++ I++L E P +ISFIGHS+GC+L+RAA+ SP +   +PK +TFLSL GPHLGT+Y SS LVN+G+WVMQK +KS  L QL L+D P DLR++Y+Y+L+  +GL+ F+Y+LL SS QDRYVPYHSTRIELC+AAV+D+S LGIVYMEMVT +LQRL++S +TTV+RYD HY+L  SANN IGRAAHIA++DSE+FLEKFI VSAAKYFR
Sbjct: 1012 IDFLQLKEDIKRKISVDFQGHVYSDFATV-ASPYAYFSETDSQ----SEDVHLVVCVHGLDGNASDLRLVRVYLQLALPECRLEFLMSECNQQDTFGSFDSMRDNLVDEVIDFIRELGEPPTRISFIGHSMGCILVRAALLSPLMKPYLPKLYTFLSLSGPHLGTVYNSSGLVNMGMWVMQKWKKSESLSQLRLRDDP-DLRQTYMYKLNASAGLDLFRYVLLVSSPQDRYVPYHSTRIELCRAAVRDSSSLGIVYMEMVTNVLQRLIKSQRTTVVRYDIHYSLGTSANNLIGRAAHIAVLDSEIFLEKFICVSAAKYFR 1325          

HSP 2 Score: 160.229 bits (404), Expect = 7.829e-36
Identity = 85/252 (33.73%), Postives = 145/252 (57.54%), Query Frame = 2
Query:  560 ERQLKVHLIASQGLHHHITVIFDYYYLAAVELVVHASLVSISPCYLRLPQTSANEADSNFERNVSLY----QSWHSILFTSTKNCGRRHAACLVHNHLCQLLLAVIDSLMSTFQDALSFFSPDQRSQIDDKLHAQLCPAQSKSINVLADWMKFAPNELERLAFILQSQTSEDDIADQASIDITKLSSRIVVIFNEFLKTSSFHQNYVESLSLRTHKLRIKRFSEAFFFQEFSIVHLLAVYDPKYANPMYLNN 1303
            ER+L++H   ++GLHHH  V FDY++L AVEL +H +L +ISP  +  P+ +  +  S+  R+ S+     QSWH ILF+   +  R+  A  +H HLC  LLA  +S++  +++ L +     + ++D                     + F+ ++LE+L   + +Q++++D+A+Q S+D+++LSS+  V+  +  K+ +        L  +TH++R+KRF+E+FF QE S+VHLLAVYDP       L N
Sbjct:    6 ERELRIHFTPTRGLHHHFDVFFDYFHLCAVELAIHGALTNISPSVISPPKPA--QRVSSLPRSASMQNLAQQSWHRILFSVRSHATRKQLALAIHRHLCHALLAARESMLLFWREILPYLPIHFKPRVDS--------------------LDFS-HKLEQLVETMMAQSTDEDMANQISLDVSRLSSQNTVLIKQLCKSCALQPKVATYLRRKTHQIRMKRFAESFFCQELSLVHLLAVYDPNTVGHEALAN 234          
BLAST of Family with sequence similarity 135 member A vs. TrEMBL
Match: A0A4S2MJC2 (DUF676 domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_000488 PE=4 SV=1)

HSP 1 Score: 405.986 bits (1042), Expect = 5.184e-116
Identity = 194/320 (60.62%), Postives = 248/320 (77.50%), Query Frame = 2
Query: 2504 VTFYQLKAKLMTDLSPQFQGNVYSEMSNIPASKKPYFSHRDSDELSASSSLHYIICVHGLDGEHRDLRLVKAYLSLALPEQRFEFLMSEANEPNTFADIDEMKELLVDEILEKIQDLRENPDKISFIGHSLGCLLIRAAIASPRLSKLVPKFHTFLSLGGPHLGTLYGSSVLVNVGLWVMQKVRKSICLQQLALKDSPTDLRRSYLYRLSGQSGLEHFKYILLASSSQDRYVPYHSTRIELCKAAVKDNSELGIVYMEMVTKILQRLLRSGKTTVIRYDAHYTLPRSANNYIGRAAHIALIDSELFLEKFISVSAAKYFR 3463
            + F QLK  +   +S  FQG+VYS+ + + AS   YFS  DS     S  +H ++CVHGLDG   DLRLV+ YL LALPE R EFLMSE N+ +TF   D M++ LVDE+++ I++L E P +ISFIGHS+GC+L+RAA+ SP +   +PK +TFLSL GPHLGT+Y SS LVN+G+WVMQK +KS  L QL L+D P DLR++Y+Y+L+  +GL+ F+Y+LL SS QDRYVPYHSTRIELC+AAV+D+S LGIVYMEMVT +LQRL++S +TTV+RYD HY+L  SANN IGRAAHIA++DSE+FLEKFI VSAAKYFR
Sbjct: 1179 IDFLQLKEDIKRKISVDFQGHVYSDFATV-ASPYAYFSETDSQ----SEDVHLVVCVHGLDGNASDLRLVRVYLQLALPECRLEFLMSECNQQDTFGSFDSMRDNLVDEVIDFIRELGEPPTRISFIGHSMGCILVRAALLSPLMKPYLPKLYTFLSLSGPHLGTVYNSSGLVNMGMWVMQKWKKSESLSQLRLRDDP-DLRQTYMYKLNASAGLDLFRYVLLVSSPQDRYVPYHSTRIELCRAAVRDSSSLGIVYMEMVTNVLQRLIKSQRTTVVRYDIHYSLGTSANNLIGRAAHIAVLDSEIFLEKFICVSAAKYFR 1492          

HSP 2 Score: 267.7 bits (683), Expect = 2.431e-69
Identity = 149/416 (35.82%), Postives = 242/416 (58.17%), Query Frame = 2
Query:  125 MSIVQVALSFAVEIWKFHNIDLFHQGAFQIRSYFKTTS---SSP--------ALIENPKIWDR-SKSINFPECTKPSFVSSSDPKLNLPA----KAVSKSVLIIYKEESLRMYDIFEQTMHLQMDALSIEEQIYKSEIILVVELWFGEKR-NE--IIEEMRCVCERQLKVHLIASQGLHHHITVIFDYYYLAAVELVVHASLVSISPCYLRLPQTSANEADSNFERNVSLY----QSWHSILFTSTKNCGRRHAACLVHNHLCQLLLAVIDSLMSTFQDALSFFSPDQRSQIDDKLHAQLCPAQSKSINVLADWMKFAPNELERLAFILQSQTSEDDIADQASIDITKLSSRIVVIFNEFLKTSSFHQNYVESLSLRTHKLRIKRFSEAFFFQEFSIVHLLAVYDPKYANPMYLNN 1303
            M ++Q  LSF VE+ +FHN+DL+H+G +Q+R+YF++ S   S+P        ++ E P  WDR S   + PE   PS+V   DP    P     K  SK +LI+Y+EE+ ++ D+FEQ + LQ+D   +EE   K E+ L VELWF E+  NE  +++ M  + ER+L++H   ++GLHHH  V FDY++L AVEL +H +L +ISP  +  P+ +  +  S+  R+ S+     QSWH ILF+   +  R+  A  +H HLC  LLA  +S++  +++ L +     + ++D                     + F+ ++LE+L   + +Q++++D+A+Q S+D+++LSS+  V+  +  K+ +        L  +TH++R+KRF+E+FF QE S+VHLLAVYDP       L N
Sbjct:   12 MPVIQATLSFVVEMREFHNVDLYHRGYYQVRAYFRSGSQALSTPNSAQSKSISIAETPLRWDRLSCRAHVPEAVHPSYV---DPGSQTPTFVTEKMCSKILLIMYREETAKLCDVFEQRLLLQVDPARLEESFMKHELFLCVELWFAEESVNEAFVVQAMEKLHERELRIHFTPTRGLHHHFDVFFDYFHLCAVELAIHGALTNISPSVISPPKPA--QRVSSLPRSASMQNLAQQSWHRILFSVRSHATRKQLALAIHRHLCHALLAARESMLLFWREILPYLPIHFKPRVDS--------------------LDFS-HKLEQLVETMMAQSTDEDMANQISLDVSRLSSQNTVLIKQLCKSCALQPKVATYLRRKTHQIRMKRFAESFFCQELSLVHLLAVYDPNTVGHEALAN 401          
BLAST of Family with sequence similarity 135 member A vs. TrEMBL
Match: A0A4S2MEU6 (DUF676 domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_000488 PE=4 SV=1)

HSP 1 Score: 405.986 bits (1042), Expect = 5.553e-116
Identity = 194/320 (60.62%), Postives = 248/320 (77.50%), Query Frame = 2
Query: 2504 VTFYQLKAKLMTDLSPQFQGNVYSEMSNIPASKKPYFSHRDSDELSASSSLHYIICVHGLDGEHRDLRLVKAYLSLALPEQRFEFLMSEANEPNTFADIDEMKELLVDEILEKIQDLRENPDKISFIGHSLGCLLIRAAIASPRLSKLVPKFHTFLSLGGPHLGTLYGSSVLVNVGLWVMQKVRKSICLQQLALKDSPTDLRRSYLYRLSGQSGLEHFKYILLASSSQDRYVPYHSTRIELCKAAVKDNSELGIVYMEMVTKILQRLLRSGKTTVIRYDAHYTLPRSANNYIGRAAHIALIDSELFLEKFISVSAAKYFR 3463
            + F QLK  +   +S  FQG+VYS+ + + AS   YFS  DS     S  +H ++CVHGLDG   DLRLV+ YL LALPE R EFLMSE N+ +TF   D M++ LVDE+++ I++L E P +ISFIGHS+GC+L+RAA+ SP +   +PK +TFLSL GPHLGT+Y SS LVN+G+WVMQK +KS  L QL L+D P DLR++Y+Y+L+  +GL+ F+Y+LL SS QDRYVPYHSTRIELC+AAV+D+S LGIVYMEMVT +LQRL++S +TTV+RYD HY+L  SANN IGRAAHIA++DSE+FLEKFI VSAAKYFR
Sbjct: 1190 IDFLQLKEDIKRKISVDFQGHVYSDFATV-ASPYAYFSETDSQ----SEDVHLVVCVHGLDGNASDLRLVRVYLQLALPECRLEFLMSECNQQDTFGSFDSMRDNLVDEVIDFIRELGEPPTRISFIGHSMGCILVRAALLSPLMKPYLPKLYTFLSLSGPHLGTVYNSSGLVNMGMWVMQKWKKSESLSQLRLRDDP-DLRQTYMYKLNASAGLDLFRYVLLVSSPQDRYVPYHSTRIELCRAAVRDSSSLGIVYMEMVTNVLQRLIKSQRTTVVRYDIHYSLGTSANNLIGRAAHIAVLDSEIFLEKFICVSAAKYFR 1503          

HSP 2 Score: 261.151 bits (666), Expect = 2.833e-67
Identity = 150/427 (35.13%), Postives = 242/427 (56.67%), Query Frame = 2
Query:  125 MSIVQVALSFAVEIWKFHNIDLFHQGAFQIRSYFKTTS---SSP--------ALIENPKIWDR-SKSINFPECTKPSFVSSSDPKLNLPA----KAVSKSVLIIYKEESLRMYDIFEQTMHLQMDALSIEEQIYKSEIILVVELWFGEKR-NE--IIEEMRCVCERQLKVHLIASQGLHHHITVIFDYYYLAAVELVVHASLVSISPCYLRLPQTSANEADSNFERNVSLY----QSWHSILF-----------TSTKNCGRRHAACLVHNHLCQLLLAVIDSLMSTFQDALSFFSPDQRSQIDDKLHAQLCPAQSKSINVLADWMKFAPNELERLAFILQSQTSEDDIADQASIDITKLSSRIVVIFNEFLKTSSFHQNYVESLSLRTHKLRIKRFSEAFFFQEFSIVHLLAVYDPKYANPMYLNN 1303
            M ++Q  LSF VE+ +FHN+DL+H+G +Q+R+YF++ S   S+P        ++ E P  WDR S   + PE   PS+V   DP    P     K  SK +LI+Y+EE+ ++ D+FEQ + LQ+D   +EE   K E+ L VELWF E+  NE  +++ M  + ER+L++H   ++GLHHH  V FDY++L AVEL +H +L +ISP  +  P+ +  +  S+  R+ S+     QSWH ILF           T   +  R+  A  +H HLC  LLA  +S++  +++ L +     + ++D                     + F+ ++LE+L   + +Q++++D+A+Q S+D+++LSS+  V+  +  K+ +        L  +TH++R+KRF+E+FF QE S+VHLLAVYDP       L N
Sbjct:   12 MPVIQATLSFVVEMREFHNVDLYHRGYYQVRAYFRSGSQALSTPNSAQSKSISIAETPLRWDRLSCRAHVPEAVHPSYV---DPGSQTPTFVTEKMCSKILLIMYREETAKLCDVFEQRLLLQVDPARLEESFMKHELFLCVELWFAEESVNEAFVVQAMEKLHERELRIHFTPTRGLHHHFDVFFDYFHLCAVELAIHGALTNISPSVISPPKPA--QRVSSLPRSASMQNLAQQSWHRILFSVRSHLSICACTPVMSATRKQLALAIHRHLCHALLAARESMLLFWREILPYLPIHFKPRVDS--------------------LDFS-HKLEQLVETMMAQSTDEDMANQISLDVSRLSSQNTVLIKQLCKSCALQPKVATYLRRKTHQIRMKRFAESFFCQELSLVHLLAVYDPNTVGHEALAN 412          
BLAST of Family with sequence similarity 135 member A vs. TrEMBL
Match: A0A4S2MET8 (DUF676 domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_000488 PE=4 SV=1)

HSP 1 Score: 405.986 bits (1042), Expect = 8.591e-116
Identity = 194/320 (60.62%), Postives = 248/320 (77.50%), Query Frame = 2
Query: 2504 VTFYQLKAKLMTDLSPQFQGNVYSEMSNIPASKKPYFSHRDSDELSASSSLHYIICVHGLDGEHRDLRLVKAYLSLALPEQRFEFLMSEANEPNTFADIDEMKELLVDEILEKIQDLRENPDKISFIGHSLGCLLIRAAIASPRLSKLVPKFHTFLSLGGPHLGTLYGSSVLVNVGLWVMQKVRKSICLQQLALKDSPTDLRRSYLYRLSGQSGLEHFKYILLASSSQDRYVPYHSTRIELCKAAVKDNSELGIVYMEMVTKILQRLLRSGKTTVIRYDAHYTLPRSANNYIGRAAHIALIDSELFLEKFISVSAAKYFR 3463
            + F QLK  +   +S  FQG+VYS+ + + AS   YFS  DS     S  +H ++CVHGLDG   DLRLV+ YL LALPE R EFLMSE N+ +TF   D M++ LVDE+++ I++L E P +ISFIGHS+GC+L+RAA+ SP +   +PK +TFLSL GPHLGT+Y SS LVN+G+WVMQK +KS  L QL L+D P DLR++Y+Y+L+  +GL+ F+Y+LL SS QDRYVPYHSTRIELC+AAV+D+S LGIVYMEMVT +LQRL++S +TTV+RYD HY+L  SANN IGRAAHIA++DSE+FLEKFI VSAAKYFR
Sbjct: 1245 IDFLQLKEDIKRKISVDFQGHVYSDFATV-ASPYAYFSETDSQ----SEDVHLVVCVHGLDGNASDLRLVRVYLQLALPECRLEFLMSECNQQDTFGSFDSMRDNLVDEVIDFIRELGEPPTRISFIGHSMGCILVRAALLSPLMKPYLPKLYTFLSLSGPHLGTVYNSSGLVNMGMWVMQKWKKSESLSQLRLRDDP-DLRQTYMYKLNASAGLDLFRYVLLVSSPQDRYVPYHSTRIELCRAAVRDSSSLGIVYMEMVTNVLQRLIKSQRTTVVRYDIHYSLGTSANNLIGRAAHIAVLDSEIFLEKFICVSAAKYFR 1558          

HSP 2 Score: 267.7 bits (683), Expect = 2.688e-69
Identity = 149/416 (35.82%), Postives = 242/416 (58.17%), Query Frame = 2
Query:  125 MSIVQVALSFAVEIWKFHNIDLFHQGAFQIRSYFKTTS---SSP--------ALIENPKIWDR-SKSINFPECTKPSFVSSSDPKLNLPA----KAVSKSVLIIYKEESLRMYDIFEQTMHLQMDALSIEEQIYKSEIILVVELWFGEKR-NE--IIEEMRCVCERQLKVHLIASQGLHHHITVIFDYYYLAAVELVVHASLVSISPCYLRLPQTSANEADSNFERNVSLY----QSWHSILFTSTKNCGRRHAACLVHNHLCQLLLAVIDSLMSTFQDALSFFSPDQRSQIDDKLHAQLCPAQSKSINVLADWMKFAPNELERLAFILQSQTSEDDIADQASIDITKLSSRIVVIFNEFLKTSSFHQNYVESLSLRTHKLRIKRFSEAFFFQEFSIVHLLAVYDPKYANPMYLNN 1303
            M ++Q  LSF VE+ +FHN+DL+H+G +Q+R+YF++ S   S+P        ++ E P  WDR S   + PE   PS+V   DP    P     K  SK +LI+Y+EE+ ++ D+FEQ + LQ+D   +EE   K E+ L VELWF E+  NE  +++ M  + ER+L++H   ++GLHHH  V FDY++L AVEL +H +L +ISP  +  P+ +  +  S+  R+ S+     QSWH ILF+   +  R+  A  +H HLC  LLA  +S++  +++ L +     + ++D                     + F+ ++LE+L   + +Q++++D+A+Q S+D+++LSS+  V+  +  K+ +        L  +TH++R+KRF+E+FF QE S+VHLLAVYDP       L N
Sbjct:   12 MPVIQATLSFVVEMREFHNVDLYHRGYYQVRAYFRSGSQALSTPNSAQSKSISIAETPLRWDRLSCRAHVPEAVHPSYV---DPGSQTPTFVTEKMCSKILLIMYREETAKLCDVFEQRLLLQVDPARLEESFMKHELFLCVELWFAEESVNEAFVVQAMEKLHERELRIHFTPTRGLHHHFDVFFDYFHLCAVELAIHGALTNISPSVISPPKPA--QRVSSLPRSASMQNLAQQSWHRILFSVRSHATRKQLALAIHRHLCHALLAARESMLLFWREILPYLPIHFKPRVDS--------------------LDFS-HKLEQLVETMMAQSTDEDMANQISLDVSRLSSQNTVLIKQLCKSCALQPKVATYLRRKTHQIRMKRFAESFFCQELSLVHLLAVYDPNTVGHEALAN 401          
BLAST of Family with sequence similarity 135 member A vs. Ensembl Cavefish
Match: fam135a (family with sequence similarity 135 member A [Source:ZFIN;Acc:ZDB-GENE-080130-1])

HSP 1 Score: 309.301 bits (791), Expect = 3.061e-88
Identity = 156/304 (51.32%), Postives = 211/304 (69.41%), Query Frame = 2
Query: 2552 QFQGNVYSEMSNIPASKKPYFSHRDSDELSASSSLHYIICVHGLDGEHRDLRLVKAYLSLALPEQRFEFLMSEANEPNTFADIDEMKELLVDEILEKIQDLRENPDKISFIGHSLGCLLIRAAIASPRLSKLVPKFHTFLSLGGPHLGTLYGSSVLVNVGLWVMQKVRKSICLQQLALKDSPTDLRRSYLYRLSGQSGLEHFKYILLASSSQDRYVPYHSTRIELCKAAVKDNSELGIVYMEMVTKILQRLLRSGKTTVIRYDAHYTLPRSANNYIGRAAHIALIDSELFLEKFISVSAAKYFR 3463
            +  G +YSE++ + AS  PYFS  D DE S    +H I+CVHGLDG   DLRLVK YL L LP  R +FLMSE N+ +TFAD + M + L+DEI++ IQ       KISF+GHSLG L++R+ +  PR    + + HTFLSL GPHLGTLY +S LVN GLW MQK +KS  L QL  +D  +D R+++LY+LS ++GL+ F+ ++L  S QDRYVPYHS RIE+CK A+KD  + G VY EM+  +L  +L++    ++RYD  + LP +AN+ IGRAAHIA++DSE+FLEKF  V+  K+F+
Sbjct:  705 KLPGFLYSEVAEL-ASTVPYFS-LDEDE-SCDEGVHLIVCVHGLDGNSADLRLVKTYLELGLPGARIDFLMSERNQNDTFADFESMTDRLLDEIVQYIQIYNLTVSKISFVGHSLGNLIVRSVLTRPRFKCYLSRLHTFLSLSGPHLGTLYNTSALVNTGLWFMQKWKKSGSLLQLTCRDH-SDPRQTFLYKLSKKAGLQFFRNVVLVGSLQDRYVPYHSARIEMCKTALKDK-QTGPVYSEMIENLLVPVLQNKDCNLVRYDVIHALPNTANSLIGRAAHIAVLDSEIFLEKFFLVAGLKFFQ 1003          

HSP 2 Score: 129.798 bits (325), Expect = 6.218e-30
Identity = 101/389 (25.96%), Postives = 182/389 (46.79%), Query Frame = 2
Query:  125 MSIVQVALSFAVEIWKFHNIDLFHQGAFQIRSYFKTTSSSPALIENPKIWDRSKSINFPECTKPSFVSSSDPKLNLPAKAVSKSVLIIYKEESLRMYDIFEQTMHLQMDALSIEEQIYKSEIILVVELWFGEKRNEIIEEMRCVCERQLKVHLIASQGLHHHITVIFDYYYLAAVELVVHASLVSISP---CYLRLPQTSANEADSNFERNVSLYQSWHSILFTST---------------KNCGRRHAACLVHNHLCQLLLAVIDSLMSTFQDALSFFSPDQRSQIDDKLHAQLCPAQSKSINVLADWMKFAPNELERLAFILQSQTSEDDIADQASIDITKLSSRIVVIFNEFLKTSSFHQNYVESLSLRTHKLRIKRFSEAFFFQE 1237
            MS VQ  + F+VE+ KF+N+DLF +G +QIR   K    +P  +E   +   S  + FP   +   +              SK+  I+YK E + + D+    + + +D   +EE + + +  L ++L+F +   E I ++     R L++H    +G+H H+ V+FDY++L+ + + +HASLV++      + RL +++    ++  +   SL  +  S++F ST                 C  +HA  L H  LC  LL     L   F          QR ++ +KL  +        I  L + +K A               S D++A+  ++++ +L S  + ++ +FL+  S H++    L+   H LR++RF+EAFF  E
Sbjct:    1 MSEVQATVEFSVELHKFYNVDLFQRGFYQIRGSMKIPPRTPHRVEASLLHPTSSDLAFPASVQDDVI-------------CSKTFQILYKNEEIVVNDVLIFKVMMLLDEKKVEESLNEMDFQLALDLFFTDGNTENIFKIF----RTLRLHFSLHRGIHQHVNVMFDYFHLSVISVTIHASLVALHQPLISFPRLVKSTWLNRNAPAQSKDSLIPTLESVVFGSTYVKQLSPDGKTFLVSDQC-LQHAFTL-HQSLCASLLLAYQGLFEYFMTLTKSLPASQRLEL-EKLDVE------ARIQELCEQVKRA--------------ESPDELAELVNMNLAQLCSLQMALWGQFLEAISLHESVSALLAQEHHALRVRRFAEAFFCLE 349          

HSP 3 Score: 51.6026 bits (122), Expect = 5.542e-6
Identity = 20/51 (39.22%), Postives = 33/51 (64.71%), Query Frame = 2
Query: 1487 FVPFSINSHETLAAKVRDSAYYRRLPPLPIECPDTDGESHDQPIILEEIFI 1639
            F     +SH+ + A ++ S+Y+  LPPLP+EC D DG+ +  PII E+ ++
Sbjct:  358 FQELHAHSHQQMTAAIKSSSYFLSLPPLPVECADLDGDVNSLPIIFEDRYL 408          
BLAST of Family with sequence similarity 135 member A vs. Ensembl Cavefish
Match: FAM135B (family with sequence similarity 135 member B [Source:HGNC Symbol;Acc:HGNC:28029])

HSP 1 Score: 302.753 bits (774), Expect = 1.611e-84
Identity = 155/325 (47.69%), Postives = 216/325 (66.46%), Query Frame = 2
Query: 2489 ILNEQVTFYQLKAKLMTDLSPQFQGNVYSEMSNIPASKKPYFSHRDSDELSASSSLHYIICVHGLDGEHRDLRLVKAYLSLALPEQRFEFLMSEANEPNTFADIDEMKELLVDEILEKIQDLRENPDKISFIGHSLGCLLIRAAIASPRLSKLVPKFHTFLSLGGPHLGTLYGSSVLVNVGLWVMQKVRKSICLQQLALKDSPTDLRRSYLYRLSGQSGLEHFKYILLASSSQDRYVPYHSTRIELCKAAVKDNSELGIVYMEMVTKILQRLLRSGKTTVIRYDAHYTLPRSANNYIGRAAHIALIDSELFLEKFISVSAAKYFR 3463
            I    + FY+ K   + +LS  F+  +YS++  + AS  PYF   +  E      +H ++CVHGLDG   DLRLVK ++ L LP  R +FLMSE N+ +TFAD D M + L+DEI++ IQ       +ISFIGHSLG ++IR+ +  PR    + K HTFLSL GPHLGTL+ SS LV+ GLW+MQK++KS  L QL  +D P D R+++LY LS + GL+ F+ ++L +S QDRYVP+HS RIE+C+ A++D +  G VY EM+  +LQ LL +    +IR +  + LP +AN  IGRAAHIA++DSELFLEKF+ V+   YF+
Sbjct: 1003 ISERMLNFYKAKEAFLRELS--FRATLYSDLPLL-ASDHPYFPPEEE-EEEFEDGIHLVVCVHGLDGNSADLRLVKTFIELGLPGSRLDFLMSERNQTDTFADFDTMTDRLLDEIIQHIQLYNLTVGRISFIGHSLGNVIIRSVLTRPRFRCYLRKLHTFLSLSGPHLGTLFNSSTLVSTGLWLMQKLKKSGSLLQLTFRDHP-DPRQTFLYTLSQKPGLQFFRNVVLVASPQDRYVPFHSARIEMCRTALRDRT-TGPVYTEMINNLLQPLLDAPNCRLIRQNVFHALPNTANTLIGRAAHIAVLDSELFLEKFLLVTGLNYFK 1321          

HSP 2 Score: 85.5001 bits (210), Expect = 2.695e-16
Identity = 70/291 (24.05%), Postives = 128/291 (43.99%), Query Frame = 2
Query:  125 MSIVQVALSFAVEIWKFHNIDLFHQGAFQIRSYFKTTSSSPALIENPKIWDRSKSINFPECTKPSFVSSSDPKLNLPAKAVSKSVLIIYKEESLRMYDIFEQTMHLQMDALSIEEQIYKSEIILVVELWFGEKRNEI--IEEMRCVCERQLKVHLIASQGLHHHITVIFDYYYLAAVELVVHASLVSISPCYLRLPQTSANE---ADSNFERNVSLYQSWHSILFTS---------------TKNCGRRHAACLVHNHLCQLLLAVIDSLMSTFQDALSFFSPDQRSQIDD 937
            MS VQ  + F+VE+ KFHN+DLF +G+       ++ S S A + +  ++                               S+   I+Y+ E + + D     +HL +D   +EE + + +  L ++L F +   ++  I  +  +  R L +H +   GLHHH+ V+FDY++L+ + + VHASLV++    +   ++         S      S   S  +++F +               ++NC +R  A   H  LC+LLLA    L   +   ++     +R +I+D
Sbjct:    1 MSEVQGTVEFSVELHKFHNVDLFQRGS-------RSCSFSSAGVHDGLVF-------------------------------SRIFQILYRNEEISLEDRMTFRVHLLLDGDRVEEALSEVDFQLRLDLHFTDVEQQLADISSVPVISSRTLGLHFLPQNGLHHHLPVMFDYFHLSVISITVHASLVALHQPLISFARSGKGAWLGKGSPESEAASSVMSVENLMFGAGYCRPVLTEGSFYVPSENCLQR--AHTWHRSLCRLLLAAYKGLCFYYTALMNDVPELKRVEIED 251          
BLAST of Family with sequence similarity 135 member A vs. Ensembl Sea Lamprey
Match: fam135a (family with sequence similarity 135 member A [Source:ZFIN;Acc:ZDB-GENE-080130-1])

HSP 1 Score: 332.798 bits (852), Expect = 5.898e-95
Identity = 167/320 (52.19%), Postives = 226/320 (70.62%), Query Frame = 2
Query: 2507 TFYQLKAKLMTDLSPQFQGNVYSEMSNIPASKKPYFSHRDSDEL-SASSSLHYIICVHGLDGEHRDLRLVKAYLSLALPEQRFEFLMSEANEPNTFADIDEMKELLVDEILEKIQDLRENPDKISFIGHSLGCLLIRAAIASPRLSKLVPKFHTFLSLGGPHLGTLYGSSVLVNVGLWVMQKVRKSICLQQLALKDSPTDLRRSYLYRLSGQSGLEHFKYILLASSSQDRYVPYHSTRIELCKAAVKDNSELGIVYMEMVTKILQRLLRSGKTTVIRYDAHYTLPRSANNYIGRAAHIALIDSELFLEKFISVSAAKYFR 3463
            +F+  K +L   ++  F G  YS++  + AS  PYFS    DEL S    +H I+CVHGLDG + DLRLVK Y+   LP ++ EFLMSE+N+ +TFAD + M + L+DEI++ IQ       KISF+GHSLG ++IR+ +A PR    +PK HTFLSL GPHLGTLY SS LVN GLW MQK +KS  L QL  +D  +D R+++LYRLS ++GL+HFKY++L  S QDRYVP+HS RIE+CK A KD  + G VYMEM+  +L+ +L + + +++RY+A + LP +AN+ IGRAAHIA++DSE+FLEKF  V+  KYFR
Sbjct: 1131 SFFHAKQELKKTMN--FTGRWYSDLPEL-ASSVPYFS---PDELESPGGGIHLIVCVHGLDGNYADLRLVKTYIEQGLPGEKMEFLMSESNQGDTFADFETMTDHLLDEIVQHIQIYNLVVSKISFVGHSLGNIIIRSVLARPRFKYYLPKLHTFLSLSGPHLGTLYNSSTLVNTGLWFMQKWKKSGSLLQLTCRDH-SDPRQTFLYRLSQKTGLQHFKYVVLVGSMQDRYVPFHSARIEVCKTATKDK-QSGPVYMEMIFNLLKPMLENKECSLVRYNAIHALPSTANSIIGRAAHIAVLDSEIFLEKFFLVAGLKYFR 1442          

HSP 2 Score: 144.821 bits (364), Expect = 3.738e-35
Identity = 109/418 (26.08%), Postives = 197/418 (47.13%), Query Frame = 2
Query:  125 MSIVQVALSFAVEIWKFHNIDLFHQGAFQIRSYFKTTSSSPALIENPKIWDRSKSINFPECTKPSFVSSSDPKLNLPAKAVSKSVLIIYKEESLRMYDIFEQTMHLQMDALSIEEQIYKSEIILVVELWF--GEKRNEIIEEMRCVCERQLKVHLIASQGLHHHITVIFDYYYLAAVELVVHASLVSIS---PCYLRLPQTS-ANEADSNFERNVSLYQSWHSILFTS--TKNCGRRHAACLV-----------HNHLCQLLLAVIDSLMSTFQDALSFFSPDQRSQIDDKLHAQLCPAQSKSINVLADWMKFAPNELERLAFILQSQTSEDDIADQASIDITKLSSRIVVIFNEFLKTSSFHQNYVESLSLRTHKLRIKRFSEAFFFQEFSIVHLLAVYDPKYANPMYLNNIGRGRP 1321
            MS VQ ++ F VE+ KF+N+DLF +G +QIR   K     P  ++   I      + FP     + V              SK+ LI+YK E + + ++      L +D+  ++E +      +VV+L F  G+   + +  M+ +  R LK++    QGLHHH+ ++FDY++L+ V + VHASLV++     C+ R P+++  N++     R V+   S   ILF     K       + LV           H  +C+ +L+   +L + +   +      QR+Q+DD             +++ A         + +L   +Q   S D++ +  ++D+  L S ++ ++ +FL+T +        L+L  H +R++RFSEAFF+Q+ +    LA  +    N   + +I +  P
Sbjct:    1 MSEVQASVEFCVELHKFYNVDLFQRGLYQIRVSLKLPPRIPHKVDAILIQSEGNELIFPASVHDNLV-------------CSKTFLILYKNEEVVLNEVILLKALLLVDSKKVQESLNDVCFQIVVDLHFTDGDFAQDDLSAMQLISSRTLKMNFSPPQGLHHHLPLMFDYFHLSVVSMSVHASLVALHQPLTCFQRPPKSTWLNKSSQPTNREVT-NPSLEMILFGPGYVKQLAADGCSFLVSETALQHAYNWHRTMCRTILSAYKNLFNYYACIMKVIPETQRAQLDD-------------LDIRA--------RMAQLTSEIQKVRSPDELVEVINMDLAHLCSLLMSLWGQFLETVNLQPEVTSGLALEHHCMRVRRFSEAFFYQDHNKQAALAFQETHAQNHAVIASIVKASP 383          
BLAST of Family with sequence similarity 135 member A vs. Ensembl Sea Lamprey
Match: fam135a (family with sequence similarity 135 member A [Source:ZFIN;Acc:ZDB-GENE-080130-1])

HSP 1 Score: 316.235 bits (809), Expect = 2.754e-89
Identity = 163/327 (49.85%), Postives = 220/327 (67.28%), Query Frame = 2
Query: 2495 NEQVTFYQLKAKLMTDLSPQFQGNVYSEMSNIPASKKPYFSHRDSDELSASSSLHYIICVHGLDGEHRDLRLVKAYLSLALPEQRFEFLMSEANEPNTFADIDEMKELLVDEILEKIQDLRENPDKI---SFIGHSLGCLLIRAAIASPRLSKLVPKFHTFLSLGGPHLGTLYGSSVLVNVG-LWVMQKVRKSICLQQLALKDSPTDLRRSYLYRLSGQSGLEHFKYILLASSSQDRYVPYHSTRIELCKAAVKDNSELGIVYMEMVTKILQRLLRSGKTTVIRYDAHYTLPRSANNYIGRAAHIALIDSELFLEKFISVSAAKYFR 3463
            N Q+  + ++AK       +F G +YS+ +   AS  PYF+    D L+ + ++H ++CVHGLDG   DLRLVK Y+ L LP  + +FLMSE N+ +TFAD + M + L+DEI++ IQ       KI   SFIGHSLG L++R+ +  PR    +PK HTFLSL GPHLGTLY SS LVN G LW MQK +KS  L QL  +D P D R+++LY+LS + GL+HF+ ++L  S QDRYVPYHS RIE+CK A+KD  +LG VY +M+  +L  +L S +  ++RYD  + LP +AN+ IGRAAHIA++DSELFLEKF+ V    YFR
Sbjct: 1140 NPQLQCF-MRAKEEVKKQLKFPGFLYSDQATF-ASAVPYFAPETPDGLADADAIHLVVCVHGLDGNSADLRLVKTYIELGLPTAKIDFLMSERNQNDTFADFETMTDRLLDEIVQHIQIYSLTLCKISYCSFIGHSLGTLIVRSVLTRPRFRCFLPKLHTFLSLSGPHLGTLYNSSALVNTGRLWFMQKWKKSGSLLQLTCRDHP-DPRQTFLYKLSQKPGLQHFRNVVLVGSLQDRYVPYHSARIEMCKLALKDK-QLGAVYADMIANLLGPVLASERCRLVRYDVVHALPNTANSIIGRAAHIAVLDSELFLEKFLLVRGLDYFR 1462          

HSP 2 Score: 100.523 bits (249), Expect = 1.359e-21
Identity = 86/350 (24.57%), Postives = 156/350 (44.57%), Query Frame = 2
Query:  338 PKLNLPAKAVSKSVLIIYKEESLRMYDIFEQTMHLQMDALSIEEQIYKSEIILVVELWFGEKR--NEIIEEMRCVCERQLKVHLIASQGLHHHITVIFDYYYLAAVELVVHASLVSISPCYLRLPQT------------SANEADSNFERNVSLYQSWHSILFTSTKNC-------GRRHAACLVHNHLCQLLLAVIDSLMSTFQDALSFFSPDQRSQIDDKLHAQLCPA-QSKSINVLADWMKFAPNELERLAFILQSQTSEDDIADQASIDITKLSSRIVVIFNEFLKTSSFHQNYVESLSLRTHKLRIKRFSEAFFFQEFSIVHLLAVYDPKYANPMYLNNIGRGRP 1321
            P    PA   S++  I+YK E + + D+    +H+ +DA  +EE + + +  L++EL F +     +    M+ +  R L +H+ A +GLH H  V+FDY++LA   L VH SLV++    +  P+              A + D     +V L+ S +S   +    C       GRR     V   LC  L  +I  L S                +  +  A  CP  + +  +V          +L +L   +Q  TS +++ +  ++D+ +L S ++ ++ +FL++ +   +    L+   H  R++RFSEAFF  E S+   L   +    +  Y+ ++ +  P
Sbjct:   57 PATECPASVSSRTFQILYKSEEVVLGDVVLFKVHVLLDARRMEESLAEVDFQLILELCFTDTNCVQDGWNLMQPMSTRTLVLHVSAGRGLHQHRPVMFDYFHLAVASLSVHGSLVALHHPLVSFPRQVKSWLGRSSQTLPARDCDIPAPESV-LFGSGYSSQGSPNDGCYVKASGEGRRSKEEEV--RLCLGLAVIIQGLYSLL--------------VQTQNPAPYCPRLRIEKCDV--------STKLSQLCSHVQGLTSAEELVEAITVDLAQLCSLLMALWAQFLQSVALRPDVTGYLAREHHHSRVRRFSEAFFCMEHSLQSALTYQEMHAQSHAYIASVVKNSP 381          
BLAST of Family with sequence similarity 135 member A vs. Ensembl Nematostella
Match: EDO47512 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLZ6])

HSP 1 Score: 312.768 bits (800), Expect = 6.058e-98
Identity = 151/267 (56.55%), Postives = 194/267 (72.66%), Query Frame = 2
Query: 2663 IICVHGLDGEHRDLRLVKAYLSLALPEQRFEFLMSEANEPNTFADIDEMKELLVDEILEKIQDLRENPDKISFIGHSLGCLLIRAAIASPRLSKLVPKFHTFLSLGGPHLGTLYGSSVLVNVGLWVMQKVRKSICLQQLALKDSPTDLRRSYLYRLSGQSGLEHFKYILLASSSQDRYVPYHSTRIELCKAAVKDNSELGIVYMEMVTKILQRLLRSGKTTVIRYDAHYTLPRSANNYIGRAAHIALIDSELFLEKFISVSAAKYFR 3463
            I+CVHGLDG   DLRL + YL +ALP  R +FLMSE N+ +TF   +EM E LV EI   I+     P K+SFIGHSLG ++IR+A+  P +     KFHT LSL GPHLG LY +S LV+ GLW+MQK +KS  LQQL+L D  TDLR+++LY+LS  SGLE+FK ILL SS+QD YVPYHS R+E+C+AA KD+SE G +Y EMVT ++  L     +T++RY  ++ LP SAN++IGRAAHIA++DSELF+EK + VSA  YFR
Sbjct:    3 IVCVHGLDGNSGDLRLFRCYLEMALPSTRLDFLMSEVNQADTFVTFEEMTEKLVQEIRHYIEAYSIFPSKLSFIGHSLGNIIIRSALTHPDMRLFAGKFHTLLSLSGPHLGMLYPTSPLVSTGLWLMQKWKKSDALQQLSLHDH-TDLRQTFLYKLSKSSGLEYFKNILLVSSTQDHYVPYHSARMEMCRAAAKDSSEFGTIYREMVTNLMAPLKSKTGSTLVRYSVYHGLPSSANSFIGRAAHIAMLDSELFIEKMLLVSAMDYFR 268          
BLAST of Family with sequence similarity 135 member A vs. Ensembl Nematostella
Match: EDO47513 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLZ7])

HSP 1 Score: 126.716 bits (317), Expect = 5.587e-31
Identity = 104/390 (26.67%), Postives = 189/390 (48.46%), Query Frame = 2
Query:  125 MSIVQVALSFAVEIWKFHNIDLFHQGAFQIRSYFKTTSSSPALIENPKIWDRSKSINFPECTKPSFVSSSDPKLNLPAKAVSKSVLIIYKEESLRMYDIFEQTMHLQMDALSIEEQIYKSEIILVVELWFGEK--RNEIIEEMRCVCERQLKVHLIASQGLHHHITVIFDYYYLAAVELVVHASLVSIS---PCYLRLPQTSANEADSNFERNVSLYQS---WHSILFTST--KNCGRRHAA------CLVHNHLCQLLLAVIDSLMSTFQDALSFFSPDQRSQIDDKLHAQLCPAQSK-SINVLADWMKFAPNELERLAFILQSQTSEDDIADQASIDITKLSSRIVVIFNEFLKTSSFHQNYVESLSLRTHKLRIKRFSEAFFFQEFS 1243
            M  +Q  +  AVE   FHN+DLF +G + IR   K    +   ++    + R       EC  P+ +S S         A+S+++ I+Y+ E + + D F   +HL +D+  I +Q+  +++ L +EL+F E     E  E +  V  + LK+HL   +G+HHH+ V+FDY++ A V+  +HA L  +S   P  ++  +TS     S       L QS   +++ LF +    +   ++ A       L+   LC  LL+   +L++ FQ                   A+  PA  +  I  + D+ +     ++ L   +++ T+ ++I  Q   D++ +SS I +++++FL++ + ++  +       H+ RI  FSEAFF QE+S
Sbjct:    1 MGDLQATIEIAVEFSSFHNVDLFQRGYYHIRCTLKPPEKTATNVDVE--YQRRPE---EECLFPALISPSG------MTAISRTIQILYRNEEVPINDAFIFRLHLLVDSNKITQQVDSADVQLSLELFFSESDVGPESPESLMGVSSQTLKLHLSCIKGIHHHVPVLFDYFHFAVVDTTIHAVLTGLSLPDPSIIKPVKTSWFGVKS----GPPLRQSTPPFYTKLFGTKPPSSIEVKYVALDVFEYILISRSLCSTLLSAQVNLLAYFQ-----------------CLAEYLPASERLDIGKVVDFGE----RVDGLINGIEAATTPNEIFAQICGDLSSISSEICLVWSQFLESYTLNKRVISYFREEHHRQRIGHFSEAFFVQEYS 354          
BLAST of Family with sequence similarity 135 member A vs. Ensembl Medaka
Match: fam135a (family with sequence similarity 135 member A [Source:NCBI gene;Acc:101173405])

HSP 1 Score: 310.842 bits (795), Expect = 3.663e-87
Identity = 155/304 (50.99%), Postives = 210/304 (69.08%), Query Frame = 2
Query: 2552 QFQGNVYSEMSNIPASKKPYFSHRDSDELSASSSLHYIICVHGLDGEHRDLRLVKAYLSLALPEQRFEFLMSEANEPNTFADIDEMKELLVDEILEKIQDLRENPDKISFIGHSLGCLLIRAAIASPRLSKLVPKFHTFLSLGGPHLGTLYGSSVLVNVGLWVMQKVRKSICLQQLALKDSPTDLRRSYLYRLSGQSGLEHFKYILLASSSQDRYVPYHSTRIELCKAAVKDNSELGIVYMEMVTKILQRLLRSGKTTVIRYDAHYTLPRSANNYIGRAAHIALIDSELFLEKFISVSAAKYFR 3463
            +  G +YSE+  + AS  PYFS  + +  +    +H I+CVHGLDG   DLRLVK YL L LP  R +FLMSE N+ +TFAD + M + L+DEI++ IQ       KISF+GHSLG L++R+ +  PR    + K HTFLSL GPHLGTLY SS LVN GLW MQK +KS  L QL  +D  +D R+++LY+LS +SGL++FK ++L  S QDRYVPYHS RIE+CK A+KD  + G +Y EM+  +L  +L++    ++RYD  + LP +AN+ IGRAAHIA++DSE+FLEKF  V+  K+F+
Sbjct: 1027 KLPGFLYSEVPEL-ASTVPYFSLEEDE--NCDEGIHLIVCVHGLDGNSADLRLVKTYLELGLPGARIDFLMSERNQNDTFADFESMTDRLLDEIVQYIQLYNLTVSKISFVGHSLGNLIVRSVLTRPRFKCYLSKLHTFLSLSGPHLGTLYNSSALVNTGLWFMQKWKKSGSLLQLTCRDH-SDPRQTFLYKLSKKSGLQYFKNVVLVGSLQDRYVPYHSARIEMCKTALKDK-QTGPMYTEMIQNLLLPVLQNKDCNLVRYDVIHALPNTANSLIGRAAHIAVLDSEIFLEKFFLVAGLKFFQ 1325          

HSP 2 Score: 128.642 bits (322), Expect = 1.769e-29
Identity = 98/397 (24.69%), Postives = 183/397 (46.10%), Query Frame = 2
Query:  125 MSIVQVALSFAVEIWKFHNIDLFHQGAFQIRSYFKTTSSSPALIENPKIWDRSKSINFPECTKPSFVSSSDPKLNLPAKAVSKSVLIIYKEESLRMYDIFEQTMHLQMDALSIEEQIYKSEIILVVELWF--GEKRNEIIEEMRCVCERQLKVHLIASQGLHHHITVIFDYYYLAAVELVVHASLVSISPCYLRLP---QTSANEADSNFERNVSLYQSWHSILFTST-----KNCGR---------RHAACLVHNHLCQLLLAVIDSLMSTFQDALSFFSPDQRSQIDDKLHAQLC-------PAQSKSINVLADWMKFAPNELERLAFILQSQTSEDDIADQASIDITKLSSRIVVIFNEFLKTSSFHQNYVESLSLRTHKLRIKRFSEAFFFQE 1237
            M+ VQ  + F+VE+ KF+N+DLF +G +Q+R+  K     P  +E   +  R   + FP   +   +              SK+  I+YK E + + D+    + + +D   +EE + + +  L++EL+F  G+   E    ++ +  R L +H    +G+H HI ++FDY++L+ + + +HASLV++    +  P   +T+    ++  +   S+     +++F ST        GR         +HA  L HN LC  LL     L   F           R ++  K   Q+        P      +V  +         E    + Q   S D++A+  ++++ +L S ++ ++ +FL+  S  ++    L++  H LR++RF+EAFF  E
Sbjct:    1 MTEVQATVEFSVELHKFYNVDLFQRGFYQMRANLKVPPRFPHKVEASLLHPRDCDLAFPASVQDDVI-------------CSKTFQILYKNEEIVVNDVLLFKVTMLLDEKKVEESLNEMDFQLLLELYFTDGDYTPEDSSSLQNISSRTLHLHFSLERGIHQHINIMFDYFHLSVISVAIHASLVALHQPLISFPRPVKTTWLNRNAPAQSKDSVIPPLENVVFGSTYVKQVSPDGRTFLVSDHCLQHAFSLHHN-LCSKLLTAYQGLFGFFTSITKNLPSSHRMEL-AKPSMQVVYERVLRRPYPRGQRHVYIEQHDVEARLTELCEHVKQKAESPDELAELVNMNLAQLCSLLMALWGQFLEVVSLQEHIAARLAMEHHTLRVRRFAEAFFCLE 382          
BLAST of Family with sequence similarity 135 member A vs. Ensembl Medaka
Match: FAM135B (family with sequence similarity 135 member B [Source:NCBI gene;Acc:101165079])

HSP 1 Score: 306.99 bits (785), Expect = 6.319e-86
Identity = 158/322 (49.07%), Postives = 217/322 (67.39%), Query Frame = 2
Query: 2504 VTFYQLKAKLMTDLSPQFQGNVYSEMSNIP--ASKKPYFSHRDSDELSASSSLHYIICVHGLDGEHRDLRLVKAYLSLALPEQRFEFLMSEANEPNTFADIDEMKELLVDEILEKIQDLRENPDKISFIGHSLGCLLIRAAIASPRLSKLVPKFHTFLSLGGPHLGTLYGSSVLVNVGLWVMQKVRKSICLQQLALKDSPTDLRRSYLYRLSGQSGLEHFKYILLASSSQDRYVPYHSTRIELCKAAVKDNSELGIVYMEMVTKILQRLLRSGKTTVIRYDAHYTLPRSANNYIGRAAHIALIDSELFLEKFISVSAAKYFR 3463
            + FY+ K +L+ +LS  FQ  +YS   N+P  AS  PYF   + D+      +H ++CVHGLDG   DLRLVK ++ L LP+ R +FLMSE N+ +TFAD D M + L+DEI++ IQ       +ISFIGHSLG ++IR+ +  PR    +PK HT LSL GPHLGTLY +S LV+ GLW+MQK++KS  L QL  +D   D R+++LY LS + GL+ FK ++L +S QDRYVP+HS RIE+C+ A+KD +  G VY EM+  +LQ L+ +    +IR +  + LP +AN  IGRAAHIA++DSELFLEKF  V+   YF+
Sbjct: 1015 LNFYKAKEELLKELS--FQATLYS---NLPLLASDLPYFP-PEEDDEEFEDGIHLVVCVHGLDGNSADLRLVKTFIELGLPQSRLDFLMSERNQADTFADFDTMTDRLLDEIIQHIQLYNLTIGRISFIGHSLGNIIIRSVLTRPRFRCYLPKLHTLLSLSGPHLGTLYNNSALVSTGLWLMQKLKKSGSLLQLTFRDH-VDPRKTFLYLLSQKPGLQFFKNVVLVASPQDRYVPFHSARIEMCRTALKDRT-TGPVYTEMINNLLQPLVEAKDCRLIRQNVFHALPNTANTLIGRAAHIAVLDSELFLEKFFLVAGLSYFK 1328          

HSP 2 Score: 135.961 bits (341), Expect = 9.845e-32
Identity = 108/391 (27.62%), Postives = 185/391 (47.31%), Query Frame = 2
Query:  125 MSIVQVALSFAVEIWKFHNIDLFHQGAFQIRSYFKTTSSSPALIENPKIWDRSKSINFPECTKPSFVSSSDPKLNLPAKAVSKSVLIIYKEESLRMYDIFEQTMHLQMDALSIEEQIYKSEIILVVELWFGEKRNEI--IEEMRCVCERQLKVHLIASQGLHHHITVIFDYYYLAAVELVVHASLVSISPCYLRLPQT------------SANEADSNFERNVSLYQSW------HSILFTSTKNCGRRHAACLVHNHLCQLLLAVIDSLMSTFQDALSFFSPDQRSQIDDKLHAQLCPAQSKSINVLADWMKFAPNELERLAFILQSQTSEDDIADQASIDITKLSSRIVVIFNEFLKTSSFHQNYVESLSLRTHKLRIKRFSEAFFFQE 1237
            MS VQ  L F++E+ KFHN+DLF +G +QIR+  K +         P++  R          + SF S+            S+   I+Y+ E + + D     +HL +D   +EE   + +  L ++L F +   ++  I  +  +  R L +H    +GLHHHI V+FDY++L+ + + +HASLV++    +   +T            SA++  +    N+     +          +  ++NC  R  A   H  LC+LLL     L S +  AL+   P Q  QI         PA+++ + V           L +L+  LQ Q   +  A+Q S D+++L S++  ++  FL+ + F+ + +  L+   H LR++RFSEA+FF E
Sbjct:   50 MSEVQGTLEFSLELHKFHNVDLFQRGFYQIRAGMKVS---------PRVPHRLTVATQNSSGECSFSSAG----VYDGTVFSRIFQILYRNEEIAVNDCMIFKVHLLLDGERVEEAFSEVDFQLKLDLHFTDSEQQLADITTVPLISTRTLGLHFHPRKGLHHHIPVMFDYFHLSVISVSIHASLVALHQPLISFARTGKGSWLGKGSPESASDPSAVSVENLMFGAGYCKPAISEGSFYVPSENCLERAHAW--HRRLCRLLLVAHGGLHS-YCTALTKEVP-QLQQI---------PAETELVPV--------EETLSQLSIQLQLQGGHEAAAEQISRDVSQLCSQLAALWRRFLEAAVFNPHILSYLAQEHHTLRVRRFSEAYFFTE 406          

HSP 3 Score: 52.373 bits (124), Expect = 3.347e-6
Identity = 22/46 (47.83%), Postives = 32/46 (69.57%), Query Frame = 2
Query: 1502 INSHETLAAKVRDSAYYRRLPPLPIECPDTDGESHDQPIILEEIFI 1639
            IN H  +AA+VR S Y  ++PPLP+EC D DG+ +  PII E+ ++
Sbjct:  420 INRHAQIAAEVRSSDYLIKMPPLPVECLDIDGDWNSLPIIFEDRYV 465          
BLAST of Family with sequence similarity 135 member A vs. Planmine SMEST
Match: SMESG000040644.1 (SMESG000040644.1)

HSP 1 Score: 1208.74 bits (3126), Expect = 0.000e+0
Identity = 662/692 (95.66%), Postives = 666/692 (96.24%), Query Frame = 2
Query: 1421 YECSLNTRSSATLVRRSSTINPFVPFSI-----------NSHETLAAKVRDSAYYRRLPPLPIECPDTDGESHDQPIILEEIFIPXXXXXXXXXXXXXXXXXXXXXXXXXXXXKRDGSIYXXXXXXXFDNNSIPVMRKLNPTFNRKNLPVQEKKVNLVGYRSVDCSAFDDNVHLSSTRSDSGDFYKLASKQGIGTLKKLNGLSCFSTASNDEIKIIKTMSCSMPDLSNIGSXXXXXXXXXXXXSYHRFSSIYELEETQSWICVSNNENVAHSNGNCNIPPDNNDALVRNEVSEFNDKRVDSDEKLTIIEMLSNFRSQRPASAYVYTQSNNFNGTLEPNEARFKLDQKSLSRSTMXXXXXXXXXXXXXILNEQVTFYQLKAKLMTDLSPQFQGNVYSEMSNIPASKKPYFSHRDSDELSASSSLHYIICVHGLDGEHRDLRLVKAYLSLALPEQRFEFLMSEANEPNTFADIDEMKELLVDEILEKIQDLRENPDKISFIGHSLGCLLIRAAIASPRLSKLVPKFHTFLSLGGPHLGTLYGSSVLVNVGLWVMQKVRKSICLQQLALKDSPTDLRRSYLYRLSGQSGLEHFKYILLASSSQDRYVPYHSTRIELCKAAVKDNSELGIVYMEMVTKILQRLLRSGKTTVIRYDAHYTLPRSANNYIGRAAHIALIDSELFLEKFISVSAAKYFR 3463
            Y  SL+ R+    ++R S    F  FSI           NSHETLAAKVRDSAYYRRLPPLPIECPDTDGESHDQPIILEEIFIPDSKRTTTTSSIRSSDSSSSSDADGLRSSKRDGSIYKKKSKSKFDNNSIPVMRKLNPTFNRKNLPVQEKKVNLVGYRSVDCSAFDDNVHLSSTRSDSGDFYKLASKQGIGTLKKLNGLSCFSTASNDEIKIIKTMSCSMPDLSNIGSKVKLRKKREDKKSYHRFSSIYELEETQSWICVSNNENVAHSNGNCNIPPDNNDAL RNEVSEFNDKRVDSDEKLTIIEMLSNFRSQRPASAYVYTQSNNFNGTLEPNEARFKLDQKSLSRSTMELSSLDSLLPPESILNEQVTFYQLKAKLMTDLSPQFQGNVYSEMSNIPASKKPYFSHRDSDELSASSSLHYIICVHGLDGEHRDLRLVKAYLSLALPEQRFEFLMSEANEPNTFADIDEMKELLVDEILEKIQDLRENPDKISFIGHSLGCLLIRAAIASPRLSKLVPKFHTFLSLGGPHLGTLYGSSVLVNVGLWVMQKVRKSICLQQLALKDSPTDLRRSYLYRLSGQSGLEHFKYILLASSSQDRYVPYHSTRIELCKAAVKDNSELGIVYMEMVTKILQRLLRSGKTTVIRYDAHYTLPRSANNYIGRAAHIALIDSELFLEKFISVSAAKYFR
Sbjct:  347 YVESLSLRTHKLRIKRFSEAFFFQEFSIVHLLAVYDPNINSHETLAAKVRDSAYYRRLPPLPIECPDTDGESHDQPIILEEIFIPDSKRTTTTSSIRSSDSSSSSDADGLRSSKRDGSIYKKKSKSKFDNNSIPVMRKLNPTFNRKNLPVQEKKVNLVGYRSVDCSAFDDNVHLSSTRSDSGDFYKLASKQGIGTLKKLNGLSCFSTASNDEIKIIKTMSCSMPDLSNIGSKVKLRKKREDKKSYHRFSSIYELEETQSWICVSNNENVAHSNGNCNIPPDNNDALARNEVSEFNDKRVDSDEKLTIIEMLSNFRSQRPASAYVYTQSNNFNGTLEPNEARFKLDQKSLSRSTMELSSLDSLLPPESILNEQVTFYQLKAKLMTDLSPQFQGNVYSEMSNIPASKKPYFSHRDSDELSASSSLHYIICVHGLDGEHRDLRLVKAYLSLALPEQRFEFLMSEANEPNTFADIDEMKELLVDEILEKIQDLRENPDKISFIGHSLGCLLIRAAIASPRLSKLVPKFHTFLSLGGPHLGTLYGSSVLVNVGLWVMQKVRKSICLQQLALKDSPTDLRRSYLYRLSGQSGLEHFKYILLASSSQDRYVPYHSTRIELCKAAVKDNSELGIVYMEMVTKILQRLLRSGKTTVIRYDAHYTLPRSANNYIGRAAHIALIDSELFLEKFISVSAAKYFR 1038          

HSP 2 Score: 792.341 bits (2045), Expect = 0.000e+0
Identity = 383/383 (100.00%), Postives = 383/383 (100.00%), Query Frame = 2
Query:  125 MSIVQVALSFAVEIWKFHNIDLFHQGAFQIRSYFKTTSSSPALIENPKIWDRSKSINFPECTKPSFVSSSDPKLNLPAKAVSKSVLIIYKEESLRMYDIFEQTMHLQMDALSIEEQIYKSEIILVVELWFGEKRNEIIEEMRCVCERQLKVHLIASQGLHHHITVIFDYYYLAAVELVVHASLVSISPCYLRLPQTSANEADSNFERNVSLYQSWHSILFTSTKNCGRRHAACLVHNHLCQLLLAVIDSLMSTFQDALSFFSPDQRSQIDDKLHAQLCPAQSKSINVLADWMKFAPNELERLAFILQSQTSEDDIADQASIDITKLSSRIVVIFNEFLKTSSFHQNYVESLSLRTHKLRIKRFSEAFFFQEFSIVHLLAVYDP 1273
            MSIVQVALSFAVEIWKFHNIDLFHQGAFQIRSYFKTTSSSPALIENPKIWDRSKSINFPECTKPSFVSSSDPKLNLPAKAVSKSVLIIYKEESLRMYDIFEQTMHLQMDALSIEEQIYKSEIILVVELWFGEKRNEIIEEMRCVCERQLKVHLIASQGLHHHITVIFDYYYLAAVELVVHASLVSISPCYLRLPQTSANEADSNFERNVSLYQSWHSILFTSTKNCGRRHAACLVHNHLCQLLLAVIDSLMSTFQDALSFFSPDQRSQIDDKLHAQLCPAQSKSINVLADWMKFAPNELERLAFILQSQTSEDDIADQASIDITKLSSRIVVIFNEFLKTSSFHQNYVESLSLRTHKLRIKRFSEAFFFQEFSIVHLLAVYDP
Sbjct:    1 MSIVQVALSFAVEIWKFHNIDLFHQGAFQIRSYFKTTSSSPALIENPKIWDRSKSINFPECTKPSFVSSSDPKLNLPAKAVSKSVLIIYKEESLRMYDIFEQTMHLQMDALSIEEQIYKSEIILVVELWFGEKRNEIIEEMRCVCERQLKVHLIASQGLHHHITVIFDYYYLAAVELVVHASLVSISPCYLRLPQTSANEADSNFERNVSLYQSWHSILFTSTKNCGRRHAACLVHNHLCQLLLAVIDSLMSTFQDALSFFSPDQRSQIDDKLHAQLCPAQSKSINVLADWMKFAPNELERLAFILQSQTSEDDIADQASIDITKLSSRIVVIFNEFLKTSSFHQNYVESLSLRTHKLRIKRFSEAFFFQEFSIVHLLAVYDP 383          
BLAST of Family with sequence similarity 135 member A vs. Planmine SMEST
Match: SMESG000040644.1 (SMESG000040644.1)

HSP 1 Score: 1174.84 bits (3038), Expect = 0.000e+0
Identity = 646/692 (93.35%), Postives = 652/692 (94.22%), Query Frame = 2
Query: 1421 YECSLNTRSSATLVRRSSTINPFVPFSI-----------NSHETLAAKVRDSAYYRRLPPLPIECPDTDGESHDQPIILEEIFIPXXXXXXXXXXXXXXXXXXXXXXXXXXXXKRDGSIYXXXXXXXFDNNSIPVMRKLNPTFNRKNLPVQEKKVNLVGYRSVDCSAFDDNVHLSSTRSDSGDFYKLASKQGIGTLKKLNGLSCFSTASNDEIKIIKTMSCSMPDLSNIGSXXXXXXXXXXXXSYHRFSSIYELEETQSWICVSNNENVAHSNGNCNIPPDNNDALVRNEVSEFNDKRVDSDEKLTIIEMLSNFRSQRPASAYVYTQSNNFNGTLEPNEARFKLDQKSLSRSTMXXXXXXXXXXXXXILNEQVTFYQLKAKLMTDLSPQFQGNVYSEMSNIPASKKPYFSHRDSDELSASSSLHYIICVHGLDGEHRDLRLVKAYLSLALPEQRFEFLMSEANEPNTFADIDEMKELLVDEILEKIQDLRENPDKISFIGHSLGCLLIRAAIASPRLSKLVPKFHTFLSLGGPHLGTLYGSSVLVNVGLWVMQKVRKSICLQQLALKDSPTDLRRSYLYRLSGQSGLEHFKYILLASSSQDRYVPYHSTRIELCKAAVKDNSELGIVYMEMVTKILQRLLRSGKTTVIRYDAHYTLPRSANNYIGRAAHIALIDSELFLEKFISVSAAKYFR 3463
            Y  SL+ R+    ++R S    F  FSI           NSHETLAAKVRDSAYYRRLPPLPIECPDTDGESHDQPIILEEIFIPDSKRTTTTSSIRSSDSSSSSDADGLRSSKRDGSIYKKKSKSKFDNNSIPVMRKLNPTFNRKNLPVQEKKVNLVGYRSVDCSAFDDNVHLSSTRSDSGDFYKLASKQGIGTLKKLNGLSCFSTASNDEIKIIKTMSCSMPDLSNIGSKVKLRKKRE            + + TQSWICVSNNENVAHSNGNCNIPPDNNDAL RNEVSEFNDKRVDSDEKLTIIEMLSNFRSQRPASAYVYTQSNNFNGTLEPNEARFKLDQKSLSRSTMELSSLDSLLPPESILNEQVTFYQLKAKLMTDLSPQFQGNVYSEMSNIPASKKPYFSHRDSDELSASSSLHYIICVHGLDGEHRDLRLVKAYLSLALPEQRFEFLMSEANEPNTFADIDEMKELLVDEILEKIQDLRENPDKISFIGHSLGCLLIRAAIASPRLSKLVPKFHTFLSLGGPHLGTLYGSSVLVNVGLWVMQKVRKSICLQQLALKDSPTDLRRSYLYRLSGQSGLEHFKYILLASSSQDRYVPYHSTRIELCKAAVKDNSELGIVYMEMVTKILQRLLRSGKTTVIRYDAHYTLPRSANNYIGRAAHIALIDSELFLEKFISVSAAKYFR
Sbjct:  343 YVESLSLRTHKLRIKRFSEAFFFQEFSIVHLLAVYDPNINSHETLAAKVRDSAYYRRLPPLPIECPDTDGESHDQPIILEEIFIPDSKRTTTTSSIRSSDSSSSSDADGLRSSKRDGSIYKKKSKSKFDNNSIPVMRKLNPTFNRKNLPVQEKKVNLVGYRSVDCSAFDDNVHLSSTRSDSGDFYKLASKQGIGTLKKLNGLSCFSTASNDEIKIIKTMSCSMPDLSNIGSKVKLRKKRE------------DKKRTQSWICVSNNENVAHSNGNCNIPPDNNDALARNEVSEFNDKRVDSDEKLTIIEMLSNFRSQRPASAYVYTQSNNFNGTLEPNEARFKLDQKSLSRSTMELSSLDSLLPPESILNEQVTFYQLKAKLMTDLSPQFQGNVYSEMSNIPASKKPYFSHRDSDELSASSSLHYIICVHGLDGEHRDLRLVKAYLSLALPEQRFEFLMSEANEPNTFADIDEMKELLVDEILEKIQDLRENPDKISFIGHSLGCLLIRAAIASPRLSKLVPKFHTFLSLGGPHLGTLYGSSVLVNVGLWVMQKVRKSICLQQLALKDSPTDLRRSYLYRLSGQSGLEHFKYILLASSSQDRYVPYHSTRIELCKAAVKDNSELGIVYMEMVTKILQRLLRSGKTTVIRYDAHYTLPRSANNYIGRAAHIALIDSELFLEKFISVSAAKYFR 1022          

HSP 2 Score: 779.63 bits (2012), Expect = 0.000e+0
Identity = 379/383 (98.96%), Postives = 379/383 (98.96%), Query Frame = 2
Query:  125 MSIVQVALSFAVEIWKFHNIDLFHQGAFQIRSYFKTTSSSPALIENPKIWDRSKSINFPECTKPSFVSSSDPKLNLPAKAVSKSVLIIYKEESLRMYDIFEQTMHLQMDALSIEEQIYKSEIILVVELWFGEKRNEIIEEMRCVCERQLKVHLIASQGLHHHITVIFDYYYLAAVELVVHASLVSISPCYLRLPQTSANEADSNFERNVSLYQSWHSILFTSTKNCGRRHAACLVHNHLCQLLLAVIDSLMSTFQDALSFFSPDQRSQIDDKLHAQLCPAQSKSINVLADWMKFAPNELERLAFILQSQTSEDDIADQASIDITKLSSRIVVIFNEFLKTSSFHQNYVESLSLRTHKLRIKRFSEAFFFQEFSIVHLLAVYDP 1273
            MSIVQVALSFAVEIWKFHNIDLFHQGAFQIRSYFKTTSSSPALIENPKIWDRSKSINFPECTKPSFVSSSDPKLNLPAKAVSKSVLIIYKEESLRMYDIFEQTMHLQMDALSIEEQIYKSEIILVVELWFGEKRNEIIEEMRCVCERQLKVHLIASQGLHHHITVIFDYYYLAAVELVVHASLVSISPCYLRLPQTSANEADSNFERNVSLYQSWHSILFTSTKNCGRRHAACLVHNHLCQLLLAVIDSLMSTFQDALSFFSPDQRSQIDDKLHAQLCPAQSKSIN    WMKFAPNELERLAFILQSQTSEDDIADQASIDITKLSSRIVVIFNEFLKTSSFHQNYVESLSLRTHKLRIKRFSEAFFFQEFSIVHLLAVYDP
Sbjct:    1 MSIVQVALSFAVEIWKFHNIDLFHQGAFQIRSYFKTTSSSPALIENPKIWDRSKSINFPECTKPSFVSSSDPKLNLPAKAVSKSVLIIYKEESLRMYDIFEQTMHLQMDALSIEEQIYKSEIILVVELWFGEKRNEIIEEMRCVCERQLKVHLIASQGLHHHITVIFDYYYLAAVELVVHASLVSISPCYLRLPQTSANEADSNFERNVSLYQSWHSILFTSTKNCGRRHAACLVHNHLCQLLLAVIDSLMSTFQDALSFFSPDQRSQIDDKLHAQLCPAQSKSIN----WMKFAPNELERLAFILQSQTSEDDIADQASIDITKLSSRIVVIFNEFLKTSSFHQNYVESLSLRTHKLRIKRFSEAFFFQEFSIVHLLAVYDP 379          
The following BLAST results are available for this feature:
BLAST of Family with sequence similarity 135 member A vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FAM135A2.752e-8851.97family with sequence similarity 135 member A [Sour... [more]
FAM135A1.151e-8751.26family with sequence similarity 135 member A [Sour... [more]
FAM135A1.918e-8751.97family with sequence similarity 135 member A [Sour... [more]
FAM135A3.182e-8751.26family with sequence similarity 135 member A [Sour... [more]
FAM135A3.182e-8751.26family with sequence similarity 135 member A [Sour... [more]
back to top
BLAST of Family with sequence similarity 135 member A vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
C09D4.42.028e-3730.38pep chromosome:WBcel235:I:5479550:5484643:-1 gene:... [more]
C09D4.42.124e-3730.38pep chromosome:WBcel235:I:5479550:5484643:-1 gene:... [more]
C09D4.42.357e-3730.38pep chromosome:WBcel235:I:5479550:5484643:-1 gene:... [more]
back to top
BLAST of Family with sequence similarity 135 member A vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CG323331.254e-9553.47gene:FBgn0052333 transcript:FBtr0331863[more]
CG323331.356e-9553.47gene:FBgn0052333 transcript:FBtr0072662[more]
CG323337.560e-2025.42gene:FBgn0052333 transcript:FBtr0100256[more]
back to top
BLAST of Family with sequence similarity 135 member A vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FAM135B8.080e-9648.62family with sequence similarity 135 member B [Sour... [more]
FAM135B6.912e-9550.17family with sequence similarity 135 member B [Sour... [more]
FAM135B2.674e-8848.62family with sequence similarity 135 member B [Sour... [more]
FAM135B2.949e-8848.62family with sequence similarity 135 member B [Sour... [more]
fam135a8.503e-8850.31family with sequence similarity 135 member A [Sour... [more]
back to top
BLAST of Family with sequence similarity 135 member A vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FAM135B4.381e-9050.00uncharacterized loc733553 [Source:Xenbase;Acc:XB-G... [more]
ENSXETT00000006749.14.407e-9050.94family with sequence similarity 135 member A [Sour... [more]
ENSXETT00000006781.16.287e-9050.94family with sequence similarity 135 member A [Sour... [more]
ENSXETT00000006704.12.019e-8950.94family with sequence similarity 135 member A [Sour... [more]
ENSXETT00000006804.12.082e-8950.94family with sequence similarity 135 member A [Sour... [more]
back to top
BLAST of Family with sequence similarity 135 member A vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Fam135b1.859e-8749.22family with sequence similarity 135, member B [Sou... [more]
Fam135a6.713e-8750.94family with sequence similarity 135, member A [Sou... [more]
Fam135a8.129e-8750.94family with sequence similarity 135, member A [Sou... [more]
Fam135a1.295e-8650.94family with sequence similarity 135, member A [Sou... [more]
Fam135a1.267e-7646.18family with sequence similarity 135, member A [Sou... [more]
back to top
BLAST of Family with sequence similarity 135 member A vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q641I1|F135B_XENLA6.655e-8949.69Protein FAM135B OS=Xenopus laevis OX=8355 GN=fam13... [more]
sp|Q5RA75|F135A_PONAB4.253e-8852.30Protein FAM135A OS=Pongo abelii OX=9601 GN=FAM135A... [more]
sp|Q9DAI6|F135B_MOUSE1.300e-8649.22Protein FAM135B OS=Mus musculus OX=10090 GN=Fam135... [more]
sp|Q9P2D6|F135A_HUMAN1.528e-8651.26Protein FAM135A OS=Homo sapiens OX=9606 GN=FAM135A... [more]
sp|Q49AJ0|F135B_HUMAN3.670e-8648.33Protein FAM135B OS=Homo sapiens OX=9606 GN=FAM135B... [more]
back to top
BLAST of Family with sequence similarity 135 member A vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183W6701.669e-12058.49DUF676 domain-containing protein OS=Trichobilharzi... [more]
A0A4S2MKZ54.669e-11760.63DUF676 domain-containing protein OS=Opisthorchis f... [more]
A0A4S2MJC25.184e-11660.63DUF676 domain-containing protein OS=Opisthorchis f... [more]
A0A4S2MEU65.553e-11660.63DUF676 domain-containing protein OS=Opisthorchis f... [more]
A0A4S2MET88.591e-11660.63DUF676 domain-containing protein OS=Opisthorchis f... [more]
back to top
BLAST of Family with sequence similarity 135 member A vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
fam135a3.061e-8851.32family with sequence similarity 135 member A [Sour... [more]
FAM135B1.611e-8447.69family with sequence similarity 135 member B [Sour... [more]
back to top
BLAST of Family with sequence similarity 135 member A vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
fam135a5.898e-9552.19family with sequence similarity 135 member A [Sour... [more]
fam135a2.754e-8949.85family with sequence similarity 135 member A [Sour... [more]
back to top
BLAST of Family with sequence similarity 135 member A vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Family with sequence similarity 135 member A vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO475126.058e-9856.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO475135.587e-3126.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Family with sequence similarity 135 member A vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
fam135a3.663e-8750.99family with sequence similarity 135 member A [Sour... [more]
FAM135B6.319e-8649.07family with sequence similarity 135 member B [Sour... [more]
back to top
BLAST of Family with sequence similarity 135 member A vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000040644.10.000e+095.66SMESG000040644.1[more]
SMESG000040644.10.000e+093.35SMESG000040644.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024423 ID=SMED30024423|Name=Family with sequence similarity 135 member A|organism=Schmidtea mediterranea sexual|type=transcript|length=3682bp
CTAAAATTCAATAATATATTTTTAGAATATAGTTTAATTTTTAATAAAAG
TTTTTTCACACTAAACAAACAGGAATATCGGATTTAATTTTTTTGGTTTT
TCTTTGACTGCTCCAGTTTGTGAAATGTCCATTGTTCAAGTGGCTCTTTC
ATTTGCTGTCGAGATTTGGAAATTTCATAATATAGATTTATTTCATCAAG
GGGCGTTTCAAATCCGCTCCTACTTCAAAACAACGAGCTCATCGCCGGCA
CTGATTGAGAACCCGAAAATTTGGGACCGCTCAAAGAGTATCAATTTCCC
AGAATGCACGAAACCCTCATTTGTCAGCAGTTCGGATCCGAAACTGAATC
TGCCAGCTAAGGCAGTCAGTAAAAGCGTATTAATCATTTATAAGGAAGAA
TCCTTGAGAATGTACGACATATTTGAGCAAACTATGCATTTACAGATGGA
TGCTCTGTCAATCGAGGAACAGATTTACAAATCAGAGATCATTCTAGTCG
TCGAGTTGTGGTTCGGAGAGAAAAGAAACGAAATCATTGAGGAAATGAGG
TGTGTTTGTGAGCGTCAGTTGAAGGTGCACCTTATTGCTAGTCAAGGGCT
TCACCATCATATCACAGTAATATTTGATTATTACTATCTTGCCGCAGTTG
AACTAGTCGTTCATGCTTCTCTAGTCAGTATTTCCCCATGTTACCTTAGG
TTGCCCCAGACTTCTGCAAATGAGGCAGATTCAAATTTTGAAAGGAATGT
TTCATTATATCAGTCTTGGCACAGCATTTTGTTCACGTCCACAAAAAATT
GCGGTCGGCGGCATGCTGCTTGTCTAGTCCACAATCACCTTTGCCAATTA
CTGTTGGCTGTGATCGACAGTCTCATGTCTACATTCCAGGATGCTCTTTC
ATTCTTCAGTCCGGATCAGAGATCACAAATAGATGACAAGCTCCATGCCC
AGCTCTGTCCCGCTCAGTCCAAATCCATTAATGTGCTTGCAGATTGGATG
AAATTCGCACCGAATGAGCTTGAGCGGCTGGCGTTCATCTTGCAGTCACA
GACAAGTGAGGATGACATTGCTGACCAAGCTAGCATAGACATTACCAAGT
TATCATCGAGAATTGTCGTTATCTTCAATGAATTTCTCAAAACTTCTTCA
TTTCATCAGAATTATGTGGAGTCACTCAGCCTCAGGACTCACAAATTACG
GATAAAGAGATTTTCCGAGGCATTCTTTTTCCAAGAGTTTTCTATAGTTC
ATTTACTGGCAGTTTATGATCCTAAGTATGCTAATCCTATGTATTTAAAT
AATATTGGCCGCGGCCGCCCGTCTCATTCGACTGCTAGCAAGCGAGACGA
TAGCAGCAATGACGAAACTGTCAGTTTGTCGTCGTCAAGCTCATCTAGCA
GTTCGCATAGCACATTTAAATATGAGTGCAGCCTAAATACCAGATCTAGC
GCTACTCTTGTTCGAAGAAGTTCAACAATCAATCCTTTCGTTCCATTTAG
CATAAACAGTCATGAGACGCTGGCAGCCAAGGTGCGGGACTCAGCGTATT
ACCGGCGGTTGCCTCCGTTACCCATTGAATGTCCGGATACTGATGGGGAG
TCACATGACCAACCTATCATCCTTGAGGAGATATTCATTCCAGATTCAAA
GCGAACGACAACAACAAGCAGTATAAGGAGCTCAGACTCAAGTTCTAGCA
GTGATGCTGATGGATTGCGCAGCTCCAAACGCGACGGATCCATCTACAAG
AAGAAATCCAAATCTAAATTTGATAACAACTCCATTCCCGTTATGCGCAA
GCTTAATCCGACTTTCAATCGCAAAAATTTGCCAGTGCAAGAAAAGAAAG
TTAATCTTGTTGGATACCGATCCGTTGATTGCAGCGCCTTTGATGACAAT
GTGCACCTTTCCTCTACGCGCTCAGATTCCGGGGATTTCTATAAATTGGC
CTCCAAACAGGGCATCGGGACATTGAAAAAGCTCAATGGATTGTCATGTT
TCTCCACGGCAAGTAATGACGAAATAAAAATTATCAAAACAATGTCTTGC
TCAATGCCTGATTTGTCAAATATTGGTTCAAAGGTTAAATTGAGGAAAAA
GCGTGAGGATAAAAAAAGTTATCACCGTTTCTCAAGCATTTACGAGTTAG
AGGAGACTCAATCGTGGATCTGTGTTAGCAACAATGAAAATGTTGCCCAC
TCAAATGGAAATTGCAACATTCCCCCGGACAACAATGACGCCCTAGTTCG
CAATGAAGTTTCGGAATTTAATGACAAGCGAGTGGATAGCGATGAAAAAT
TGACTATCATTGAAATGCTGTCGAATTTCCGTTCGCAACGACCTGCAAGT
GCCTATGTTTATACGCAATCGAATAACTTCAATGGAACGCTGGAGCCGAA
TGAGGCTAGATTCAAATTGGATCAAAAATCATTGAGTAGATCTACCATGG
AGTTGTCATCCTTAGATTCCCTATTACCACCAGAATCTATTTTGAACGAG
CAGGTGACGTTTTACCAGTTGAAAGCCAAATTGATGACTGATCTCAGTCC
TCAATTTCAAGGCAATGTCTATTCGGAAATGAGCAATATTCCCGCCAGTA
AAAAGCCATATTTCAGTCATCGAGATAGTGACGAGCTGTCGGCATCGTCG
AGCTTGCATTACATCATCTGTGTACACGGCCTTGATGGGGAACATCGTGA
TCTCAGGCTCGTGAAAGCTTATTTGAGTCTAGCTCTTCCTGAACAGAGAT
TTGAATTTCTCATGTCTGAGGCCAATGAGCCAAATACTTTTGCCGACATT
GACGAAATGAAGGAGCTTCTGGTGGATGAGATTCTCGAGAAAATTCAGGA
TTTGAGAGAGAATCCGGATAAAATTAGCTTCATCGGTCACAGTTTGGGGT
GCCTTCTAATCAGAGCTGCGATTGCTAGTCCGAGACTGTCGAAATTGGTA
CCTAAATTCCATACATTTCTGTCTCTTGGTGGGCCCCATTTAGGCACATT
GTATGGATCAAGTGTTCTAGTCAATGTCGGCTTGTGGGTCATGCAGAAGG
TTCGTAAGTCGATATGCTTGCAGCAGCTAGCTCTGAAGGACAGTCCCACT
GATCTGAGGCGATCTTATCTCTACCGATTGAGTGGTCAGTCGGGACTGGA
ACATTTCAAATACATTTTGCTGGCCAGCTCCTCCCAGGACCGCTACGTGC
CTTACCATAGCACTCGGATTGAACTGTGTAAAGCTGCTGTGAAGGACAAT
TCTGAATTGGGTATTGTTTACATGGAAATGGTGACTAAGATTCTACAGCG
ACTGCTGCGGTCAGGCAAAACGACAGTGATCCGATATGATGCCCATTACA
CGTTGCCGCGGTCCGCAAATAACTACATTGGGCGCGCTGCTCATATTGCC
TTGATTGATTCGGAATTATTCCTAGAGAAATTTATCAGCGTCAGTGCTGC
GAAATACTTCAGATGAATGAATTGTCTGTCGAATGCTGAGTGCCTTCATT
AATACTGTGCAGATATAATGGCCGGAGGTTTCCTCAGGCTGGGTGATGTA
ACTGGGCCCTTTTGACGGGGGGACTGCTGATGACGATCTTGTAGCTCGTT
ACGATCCGCATTCCTTGCACTTCTTAGATTTATGTACTTCTTGTAGCAGC
ATTCCAGTCTGTGAATGTTTATGACCAAATAC
back to top

protein sequence of SMED30024423-orf-1

>SMED30024423-orf-1 ID=SMED30024423-orf-1|Name=SMED30024423-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1114bp
MSIVQVALSFAVEIWKFHNIDLFHQGAFQIRSYFKTTSSSPALIENPKIW
DRSKSINFPECTKPSFVSSSDPKLNLPAKAVSKSVLIIYKEESLRMYDIF
EQTMHLQMDALSIEEQIYKSEIILVVELWFGEKRNEIIEEMRCVCERQLK
VHLIASQGLHHHITVIFDYYYLAAVELVVHASLVSISPCYLRLPQTSANE
ADSNFERNVSLYQSWHSILFTSTKNCGRRHAACLVHNHLCQLLLAVIDSL
MSTFQDALSFFSPDQRSQIDDKLHAQLCPAQSKSINVLADWMKFAPNELE
RLAFILQSQTSEDDIADQASIDITKLSSRIVVIFNEFLKTSSFHQNYVES
LSLRTHKLRIKRFSEAFFFQEFSIVHLLAVYDPKYANPMYLNNIGRGRPS
HSTASKRDDSSNDETVSLSSSSSSSSSHSTFKYECSLNTRSSATLVRRSS
TINPFVPFSINSHETLAAKVRDSAYYRRLPPLPIECPDTDGESHDQPIIL
EEIFIPDSKRTTTTSSIRSSDSSSSSDADGLRSSKRDGSIYKKKSKSKFD
NNSIPVMRKLNPTFNRKNLPVQEKKVNLVGYRSVDCSAFDDNVHLSSTRS
DSGDFYKLASKQGIGTLKKLNGLSCFSTASNDEIKIIKTMSCSMPDLSNI
GSKVKLRKKREDKKSYHRFSSIYELEETQSWICVSNNENVAHSNGNCNIP
PDNNDALVRNEVSEFNDKRVDSDEKLTIIEMLSNFRSQRPASAYVYTQSN
NFNGTLEPNEARFKLDQKSLSRSTMELSSLDSLLPPESILNEQVTFYQLK
AKLMTDLSPQFQGNVYSEMSNIPASKKPYFSHRDSDELSASSSLHYIICV
HGLDGEHRDLRLVKAYLSLALPEQRFEFLMSEANEPNTFADIDEMKELLV
DEILEKIQDLRENPDKISFIGHSLGCLLIRAAIASPRLSKLVPKFHTFLS
LGGPHLGTLYGSSVLVNVGLWVMQKVRKSICLQQLALKDSPTDLRRSYLY
RLSGQSGLEHFKYILLASSSQDRYVPYHSTRIELCKAAVKDNSELGIVYM
EMVTKILQRLLRSGKTTVIRYDAHYTLPRSANNYIGRAAHIALIDSELFL
EKFISVSAAKYFR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000136whole organism
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR007751DUF676_lipase-like
IPR022122DUF3657
IPR029058AB_hydrolase
Vocabulary: biological process
TermDefinition
GO:0044255cellular lipid metabolic process
Vocabulary: molecular function
TermDefinition
GO:0052689carboxylic ester hydrolase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR029058Alpha/Beta hydrolase foldGENE3DG3DSA:3.40.50.1820coord: 845..1006
e-value: 8.3E-22
score: 80.0
IPR029058Alpha/Beta hydrolase foldSUPERFAMILYSSF53474alpha/beta-Hydrolasescoord: 844..1031
IPR007751Domain of unknown function DUF676, lipase-likePFAMPF05057DUF676coord: 842..1035
e-value: 2.3E-47
score: 161.3
IPR022122Protein FAM135PFAMPF12394DUF3657coord: 124..183
e-value: 1.7E-11
score: 44.5
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 398..421
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 510..529
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 530..546
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 510..546
NoneNo IPR availablePANTHERPTHR12482UNCHARACTERIZEDcoord: 10..1112
NoneNo IPR availablePANTHERPTHR12482:SF5F19C14.4 PROTEINcoord: 10..1112