High mobility group protein

Overview
NameHigh mobility group protein
Smed IDSMED30024417
Length (bp)983
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of High mobility group protein (SMED30024417) t-SNE clustered cells

Violin plots show distribution of expression levels for High mobility group protein (SMED30024417) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of High mobility group protein (SMED30024417) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for High mobility group protein (SMED30024417) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024417

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30024417h1SMcG0016562 SmedASXL_019346SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
parenchymal cellSMED30024417h1SMcG0016562 dd_Smed_v4_3089_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of High mobility group protein vs. Ensembl Human
Match: HMGB2 (high mobility group box 2 [Source:HGNC Symbol;Acc:HGNC:5000])

HSP 1 Score: 91.6633 bits (226), Expect = 2.216e-21
Identity = 55/170 (32.35%), Postives = 97/170 (57.06%), Query Frame = 3
Query:   96 KIAGYKYFIKLIRDEHQRMYPEKKLMLNSFATICAENWKAMSPVKRKWFEKLAEDDEDFRKMYLKPIK---------KRQNKVPGQPKRAWSAFLFFLAEHRMYVKTKNPKWRVAEISKELGRMW--EACTDRDKYEKLAVMDRKRYETDMAAFKT-GKVFSGE--PNRP 563
            K++ Y +F++  R+EH++ +P+  +    F+  C+E WK MS  ++  FE +A+ D   +  Y + +K         K + K P  PKR  SAF  F +EHR  +K+++P   + + +K+LG MW  ++  D+  YE+ A   +++YE D+AA++  GK  +G+  P RP
Sbjct:   12 KMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSD---KARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRP 178          
BLAST of High mobility group protein vs. Ensembl Human
Match: HMGB2 (high mobility group box 2 [Source:HGNC Symbol;Acc:HGNC:5000])

HSP 1 Score: 91.6633 bits (226), Expect = 2.216e-21
Identity = 55/170 (32.35%), Postives = 97/170 (57.06%), Query Frame = 3
Query:   96 KIAGYKYFIKLIRDEHQRMYPEKKLMLNSFATICAENWKAMSPVKRKWFEKLAEDDEDFRKMYLKPIK---------KRQNKVPGQPKRAWSAFLFFLAEHRMYVKTKNPKWRVAEISKELGRMW--EACTDRDKYEKLAVMDRKRYETDMAAFKT-GKVFSGE--PNRP 563
            K++ Y +F++  R+EH++ +P+  +    F+  C+E WK MS  ++  FE +A+ D   +  Y + +K         K + K P  PKR  SAF  F +EHR  +K+++P   + + +K+LG MW  ++  D+  YE+ A   +++YE D+AA++  GK  +G+  P RP
Sbjct:   12 KMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSD---KARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRP 178          
BLAST of High mobility group protein vs. Ensembl Human
Match: HMGB2 (high mobility group box 2 [Source:HGNC Symbol;Acc:HGNC:5000])

HSP 1 Score: 91.6633 bits (226), Expect = 2.216e-21
Identity = 55/170 (32.35%), Postives = 97/170 (57.06%), Query Frame = 3
Query:   96 KIAGYKYFIKLIRDEHQRMYPEKKLMLNSFATICAENWKAMSPVKRKWFEKLAEDDEDFRKMYLKPIK---------KRQNKVPGQPKRAWSAFLFFLAEHRMYVKTKNPKWRVAEISKELGRMW--EACTDRDKYEKLAVMDRKRYETDMAAFKT-GKVFSGE--PNRP 563
            K++ Y +F++  R+EH++ +P+  +    F+  C+E WK MS  ++  FE +A+ D   +  Y + +K         K + K P  PKR  SAF  F +EHR  +K+++P   + + +K+LG MW  ++  D+  YE+ A   +++YE D+AA++  GK  +G+  P RP
Sbjct:   12 KMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSD---KARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRP 178          
BLAST of High mobility group protein vs. Ensembl Human
Match: HMGB1 (high mobility group box 1 [Source:HGNC Symbol;Acc:HGNC:4983])

HSP 1 Score: 90.5077 bits (223), Expect = 7.280e-21
Identity = 52/153 (33.99%), Postives = 90/153 (58.82%), Query Frame = 3
Query:   96 KIAGYKYFIKLIRDEHQRMYPEKKLMLNSFATICAENWKAMSPVKRKWFEKLAEDD----EDFRKMYLKPI--KKRQNKVPGQPKRAWSAFLFFLAEHRMYVKTKNPKWRVAEISKELGRMWE--ACTDRDKYEKLAVMDRKRYETDMAAFKT 530
            K++ Y +F++  R+EH++ +P+  +  + F+  C+E WK MS  ++  FE +A+ D    E   K Y+ P    K++ K P  PKR  SAF  F +E+R  +K ++P   + +++K+LG MW   A  D+  YEK A   +++YE D+AA++ 
Sbjct:   12 KMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRA 164          
BLAST of High mobility group protein vs. Ensembl Human
Match: HMGB1 (high mobility group box 1 [Source:HGNC Symbol;Acc:HGNC:4983])

HSP 1 Score: 90.5077 bits (223), Expect = 7.280e-21
Identity = 52/153 (33.99%), Postives = 90/153 (58.82%), Query Frame = 3
Query:   96 KIAGYKYFIKLIRDEHQRMYPEKKLMLNSFATICAENWKAMSPVKRKWFEKLAEDD----EDFRKMYLKPI--KKRQNKVPGQPKRAWSAFLFFLAEHRMYVKTKNPKWRVAEISKELGRMWE--ACTDRDKYEKLAVMDRKRYETDMAAFKT 530
            K++ Y +F++  R+EH++ +P+  +  + F+  C+E WK MS  ++  FE +A+ D    E   K Y+ P    K++ K P  PKR  SAF  F +E+R  +K ++P   + +++K+LG MW   A  D+  YEK A   +++YE D+AA++ 
Sbjct:   12 KMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRA 164          
BLAST of High mobility group protein vs. Ensembl Celegans
Match: hmg-1.2 (High mobility group protein 1.2 [Source:UniProtKB/Swiss-Prot;Acc:Q09390])

HSP 1 Score: 90.5077 bits (223), Expect = 3.816e-21
Identity = 47/155 (30.32%), Postives = 85/155 (54.84%), Query Frame = 3
Query:   96 KIAGYKYFIKLIRDEHQRMYPEKKLMLNSFATICAENWKAMSPVKRKWFEKLAEDDEDFRKMYLKPI--------KKRQNKVPGQPKRAWSAFLFFLAEHRMYVKTKNPKWRVAEISKELGRMWEACTD--RDKYEKLAVMDRKRYETDMAAFKT 530
            K + Y +F+K+  +EH++ YP + + +   +  C+E WK M   +++ F +LA+ D +  +  +           +KR  K P  PKRA SAF F+  + R  ++  +P W+V ++++ELG+MW+      +D YE+ A  D+ RY  +M  +K 
Sbjct:   48 KTSPYGFFVKMCYEEHKKKYPNENVQVTEISKKCSEKWKTMVDDEKRRFYELAQKDAERYQAEVAAYGGEDAMRKRKRAKKDPHAPKRALSAFFFYSQDKRPEIQAGHPDWKVGQVAQELGKMWKLVPQETKDMYEQKAQADKDRYADEMRNYKA 202          
BLAST of High mobility group protein vs. Ensembl Celegans
Match: hmg-1.2 (High mobility group protein 1.2 [Source:UniProtKB/Swiss-Prot;Acc:Q09390])

HSP 1 Score: 90.5077 bits (223), Expect = 3.816e-21
Identity = 47/155 (30.32%), Postives = 85/155 (54.84%), Query Frame = 3
Query:   96 KIAGYKYFIKLIRDEHQRMYPEKKLMLNSFATICAENWKAMSPVKRKWFEKLAEDDEDFRKMYLKPI--------KKRQNKVPGQPKRAWSAFLFFLAEHRMYVKTKNPKWRVAEISKELGRMWEACTD--RDKYEKLAVMDRKRYETDMAAFKT 530
            K + Y +F+K+  +EH++ YP + + +   +  C+E WK M   +++ F +LA+ D +  +  +           +KR  K P  PKRA SAF F+  + R  ++  +P W+V ++++ELG+MW+      +D YE+ A  D+ RY  +M  +K 
Sbjct:   48 KTSPYGFFVKMCYEEHKKKYPNENVQVTEISKKCSEKWKTMVDDEKRRFYELAQKDAERYQAEVAAYGGEDAMRKRKRAKKDPHAPKRALSAFFFYSQDKRPEIQAGHPDWKVGQVAQELGKMWKLVPQETKDMYEQKAQADKDRYADEMRNYKA 202          
BLAST of High mobility group protein vs. Ensembl Celegans
Match: hmg-1.2 (High mobility group protein 1.2 [Source:UniProtKB/Swiss-Prot;Acc:Q09390])

HSP 1 Score: 89.7373 bits (221), Expect = 7.740e-21
Identity = 47/157 (29.94%), Postives = 85/157 (54.14%), Query Frame = 3
Query:   96 KIAGYKYFIKLIRDEHQRMYPEKKLMLNSFATICAENWKAMSPVKRKWFEKLAEDDEDFRKMYLKPI----------KKRQNKVPGQPKRAWSAFLFFLAEHRMYVKTKNPKWRVAEISKELGRMWEACTD--RDKYEKLAVMDRKRYETDMAAFKT 530
            K + Y +F+K+  +EH++ YP + + +   +  C+E WK M   +++ F +LA+ D +  +  +             +KR  K P  PKRA SAF F+  + R  ++  +P W+V ++++ELG+MW+      +D YE+ A  D+ RY  +M  +K 
Sbjct:   48 KTSPYGFFVKMCYEEHKKKYPNENVQVTEISKKCSEKWKTMVDDEKRRFYELAQKDAERYQAEVSVAAYGGEDAMRKRKRAKKDPHAPKRALSAFFFYSQDKRPEIQAGHPDWKVGQVAQELGKMWKLVPQETKDMYEQKAQADKDRYADEMRNYKA 204          
BLAST of High mobility group protein vs. Ensembl Celegans
Match: hmg-1.2 (High mobility group protein 1.2 [Source:UniProtKB/Swiss-Prot;Acc:Q09390])

HSP 1 Score: 89.7373 bits (221), Expect = 7.740e-21
Identity = 47/157 (29.94%), Postives = 85/157 (54.14%), Query Frame = 3
Query:   96 KIAGYKYFIKLIRDEHQRMYPEKKLMLNSFATICAENWKAMSPVKRKWFEKLAEDDEDFRKMYLKPI----------KKRQNKVPGQPKRAWSAFLFFLAEHRMYVKTKNPKWRVAEISKELGRMWEACTD--RDKYEKLAVMDRKRYETDMAAFKT 530
            K + Y +F+K+  +EH++ YP + + +   +  C+E WK M   +++ F +LA+ D +  +  +             +KR  K P  PKRA SAF F+  + R  ++  +P W+V ++++ELG+MW+      +D YE+ A  D+ RY  +M  +K 
Sbjct:   48 KTSPYGFFVKMCYEEHKKKYPNENVQVTEISKKCSEKWKTMVDDEKRRFYELAQKDAERYQAEVSVAAYGGEDAMRKRKRAKKDPHAPKRALSAFFFYSQDKRPEIQAGHPDWKVGQVAQELGKMWKLVPQETKDMYEQKAQADKDRYADEMRNYKA 204          
BLAST of High mobility group protein vs. Ensembl Celegans
Match: hmg-1.2 (High mobility group protein 1.2 [Source:UniProtKB/Swiss-Prot;Acc:Q09390])

HSP 1 Score: 89.7373 bits (221), Expect = 7.746e-21
Identity = 47/157 (29.94%), Postives = 85/157 (54.14%), Query Frame = 3
Query:   96 KIAGYKYFIKLIRDEHQRMYPEKKLMLNSFATICAENWKAMSPVKRKWFEKLAEDDEDFRKMYLKPI----------KKRQNKVPGQPKRAWSAFLFFLAEHRMYVKTKNPKWRVAEISKELGRMWEACTD--RDKYEKLAVMDRKRYETDMAAFKT 530
            K + Y +F+K+  +EH++ YP + + +   +  C+E WK M   +++ F +LA+ D +  +  +             +KR  K P  PKRA SAF F+  + R  ++  +P W+V ++++ELG+MW+      +D YE+ A  D+ RY  +M  +K 
Sbjct:   47 KTSPYGFFVKMCYEEHKKKYPNENVQVTEISKKCSEKWKTMVDDEKRRFYELAQKDAERYQAEVSVAAYGGEDAMRKRKRAKKDPHAPKRALSAFFFYSQDKRPEIQAGHPDWKVGQVAQELGKMWKLVPQETKDMYEQKAQADKDRYADEMRNYKA 203          
BLAST of High mobility group protein vs. Ensembl Fly
Match: Dsp1 (gene:FBgn0278608 transcript:FBtr0089259)

HSP 1 Score: 102.449 bits (254), Expect = 2.497e-24
Identity = 60/169 (35.50%), Postives = 95/169 (56.21%), Query Frame = 3
Query:   96 KIAGYKYFIKLIRDEHQRMYPEKKLMLNSFATICAENWKAMSPVKRKWFEKLAEDD----EDFRKMYLKP--------IKKRQNKVPGQPKRAWSAFLFFLAEHRMYVKTKNPKWRVAEISKELGRMWEACTD--RDKYEKLAVMDRKRYETDMAAFKT-GKVFSGEPN 557
            ++  Y YF++  R+EH++ +P++ ++   F+  CAE WK M   ++K F ++AE D    E   + Y+ P         K++Q K P  PKR+ SAF +F  + R  VK  NP++ V +I+KELGR W       + KYE +A  D+ RYE +M  +KT GK+    P+
Sbjct:  174 RMTAYAYFVQTCREEHKKKHPDETVIFAEFSRKCAERWKTMVDKEKKRFHEMAEKDKQRYEAEMQNYVPPKGAVVGRGKKRKQIKDPNAPKRSLSAFFWFCNDERNKVKALNPEFGVGDIAKELGRKWSDVDPEVKQKYESMAERDKARYEREMTEYKTSGKIAMSAPS 342          
BLAST of High mobility group protein vs. Ensembl Fly
Match: Dsp1 (gene:FBgn0278608 transcript:FBtr0089260)

HSP 1 Score: 102.449 bits (254), Expect = 2.497e-24
Identity = 60/169 (35.50%), Postives = 95/169 (56.21%), Query Frame = 3
Query:   96 KIAGYKYFIKLIRDEHQRMYPEKKLMLNSFATICAENWKAMSPVKRKWFEKLAEDD----EDFRKMYLKP--------IKKRQNKVPGQPKRAWSAFLFFLAEHRMYVKTKNPKWRVAEISKELGRMWEACTD--RDKYEKLAVMDRKRYETDMAAFKT-GKVFSGEPN 557
            ++  Y YF++  R+EH++ +P++ ++   F+  CAE WK M   ++K F ++AE D    E   + Y+ P         K++Q K P  PKR+ SAF +F  + R  VK  NP++ V +I+KELGR W       + KYE +A  D+ RYE +M  +KT GK+    P+
Sbjct:  174 RMTAYAYFVQTCREEHKKKHPDETVIFAEFSRKCAERWKTMVDKEKKRFHEMAEKDKQRYEAEMQNYVPPKGAVVGRGKKRKQIKDPNAPKRSLSAFFWFCNDERNKVKALNPEFGVGDIAKELGRKWSDVDPEVKQKYESMAERDKARYEREMTEYKTSGKIAMSAPS 342          
BLAST of High mobility group protein vs. Ensembl Fly
Match: Dsp1 (gene:FBgn0278608 transcript:FBtr0089261)

HSP 1 Score: 102.449 bits (254), Expect = 2.497e-24
Identity = 60/169 (35.50%), Postives = 95/169 (56.21%), Query Frame = 3
Query:   96 KIAGYKYFIKLIRDEHQRMYPEKKLMLNSFATICAENWKAMSPVKRKWFEKLAEDD----EDFRKMYLKP--------IKKRQNKVPGQPKRAWSAFLFFLAEHRMYVKTKNPKWRVAEISKELGRMWEACTD--RDKYEKLAVMDRKRYETDMAAFKT-GKVFSGEPN 557
            ++  Y YF++  R+EH++ +P++ ++   F+  CAE WK M   ++K F ++AE D    E   + Y+ P         K++Q K P  PKR+ SAF +F  + R  VK  NP++ V +I+KELGR W       + KYE +A  D+ RYE +M  +KT GK+    P+
Sbjct:  174 RMTAYAYFVQTCREEHKKKHPDETVIFAEFSRKCAERWKTMVDKEKKRFHEMAEKDKQRYEAEMQNYVPPKGAVVGRGKKRKQIKDPNAPKRSLSAFFWFCNDERNKVKALNPEFGVGDIAKELGRKWSDVDPEVKQKYESMAERDKARYEREMTEYKTSGKIAMSAPS 342          
BLAST of High mobility group protein vs. Ensembl Fly
Match: Dsp1 (gene:FBgn0278608 transcript:FBtr0089262)

HSP 1 Score: 102.449 bits (254), Expect = 2.525e-24
Identity = 60/169 (35.50%), Postives = 95/169 (56.21%), Query Frame = 3
Query:   96 KIAGYKYFIKLIRDEHQRMYPEKKLMLNSFATICAENWKAMSPVKRKWFEKLAEDD----EDFRKMYLKP--------IKKRQNKVPGQPKRAWSAFLFFLAEHRMYVKTKNPKWRVAEISKELGRMWEACTD--RDKYEKLAVMDRKRYETDMAAFKT-GKVFSGEPN 557
            ++  Y YF++  R+EH++ +P++ ++   F+  CAE WK M   ++K F ++AE D    E   + Y+ P         K++Q K P  PKR+ SAF +F  + R  VK  NP++ V +I+KELGR W       + KYE +A  D+ RYE +M  +KT GK+    P+
Sbjct:  175 RMTAYAYFVQTCREEHKKKHPDETVIFAEFSRKCAERWKTMVDKEKKRFHEMAEKDKQRYEAEMQNYVPPKGAVVGRGKKRKQIKDPNAPKRSLSAFFWFCNDERNKVKALNPEFGVGDIAKELGRKWSDVDPEVKQKYESMAERDKARYEREMTEYKTSGKIAMSAPS 343          
BLAST of High mobility group protein vs. Ensembl Fly
Match: Dsp1 (gene:FBgn0278608 transcript:FBtr0339766)

HSP 1 Score: 102.449 bits (254), Expect = 2.525e-24
Identity = 60/169 (35.50%), Postives = 95/169 (56.21%), Query Frame = 3
Query:   96 KIAGYKYFIKLIRDEHQRMYPEKKLMLNSFATICAENWKAMSPVKRKWFEKLAEDD----EDFRKMYLKP--------IKKRQNKVPGQPKRAWSAFLFFLAEHRMYVKTKNPKWRVAEISKELGRMWEACTD--RDKYEKLAVMDRKRYETDMAAFKT-GKVFSGEPN 557
            ++  Y YF++  R+EH++ +P++ ++   F+  CAE WK M   ++K F ++AE D    E   + Y+ P         K++Q K P  PKR+ SAF +F  + R  VK  NP++ V +I+KELGR W       + KYE +A  D+ RYE +M  +KT GK+    P+
Sbjct:  175 RMTAYAYFVQTCREEHKKKHPDETVIFAEFSRKCAERWKTMVDKEKKRFHEMAEKDKQRYEAEMQNYVPPKGAVVGRGKKRKQIKDPNAPKRSLSAFFWFCNDERNKVKALNPEFGVGDIAKELGRKWSDVDPEVKQKYESMAERDKARYEREMTEYKTSGKIAMSAPS 343          
BLAST of High mobility group protein vs. Ensembl Zebrafish
Match: hmgb3b (high mobility group box 3b [Source:ZFIN;Acc:ZDB-GENE-050417-290])

HSP 1 Score: 98.9821 bits (245), Expect = 2.330e-24
Identity = 53/151 (35.10%), Postives = 85/151 (56.29%), Query Frame = 3
Query:   96 KIAGYKYFIKLIRDEHQRMYPEKKLMLNSFATICAENWKAMSPVKRKWFEKLAEDDE---DFRKMYLKPIKK--RQNKVPGQPKRAWSAFLFFLAEHRMYVKTKNPKWRVAEISKELGRMWEACTDRDKYEKLAVMD--RKRYETDMAAFK 527
            K++ Y YF+K  R+EH +  P   +  + F+  C+E WK MSP ++  FE LA+ D+   D   M+  P KK  +Q K P  P+R  S F  F A+ R  +K +NP   + +++K+LG MW   +D +K   L+  D  + +Y+ DMA ++
Sbjct:   12 KMSAYAYFVKTCREEHNKKNPGVTVNFSEFSKKCSERWKTMSPKEKTKFEDLAKQDKARYDQEMMHYNPGKKGRKQKKDPNAPRRPPSGFFLFCAKQRPIIKAQNPSLGIGDVAKKLGGMWNNLSDSEKQPFLSNADKLKDKYQKDMAFYR 162          
BLAST of High mobility group protein vs. Ensembl Zebrafish
Match: hmgb3b (high mobility group box 3b [Source:ZFIN;Acc:ZDB-GENE-050417-290])

HSP 1 Score: 98.9821 bits (245), Expect = 2.330e-24
Identity = 53/151 (35.10%), Postives = 85/151 (56.29%), Query Frame = 3
Query:   96 KIAGYKYFIKLIRDEHQRMYPEKKLMLNSFATICAENWKAMSPVKRKWFEKLAEDDE---DFRKMYLKPIKK--RQNKVPGQPKRAWSAFLFFLAEHRMYVKTKNPKWRVAEISKELGRMWEACTDRDKYEKLAVMD--RKRYETDMAAFK 527
            K++ Y YF+K  R+EH +  P   +  + F+  C+E WK MSP ++  FE LA+ D+   D   M+  P KK  +Q K P  P+R  S F  F A+ R  +K +NP   + +++K+LG MW   +D +K   L+  D  + +Y+ DMA ++
Sbjct:   12 KMSAYAYFVKTCREEHNKKNPGVTVNFSEFSKKCSERWKTMSPKEKTKFEDLAKQDKARYDQEMMHYNPGKKGRKQKKDPNAPRRPPSGFFLFCAKQRPIIKAQNPSLGIGDVAKKLGGMWNNLSDSEKQPFLSNADKLKDKYQKDMAFYR 162          
BLAST of High mobility group protein vs. Ensembl Zebrafish
Match: hmgb3a (high mobility group box 3a [Source:ZFIN;Acc:ZDB-GENE-050428-1])

HSP 1 Score: 96.6709 bits (239), Expect = 2.361e-23
Identity = 50/150 (33.33%), Postives = 85/150 (56.67%), Query Frame = 3
Query:   96 KIAGYKYFIKLIRDEHQRMYPEKKLMLNSFATICAENWKAMSPVKRKWFEKLAEDDE---DFRKMYLKPIKKRQNKVPGQPKRAWSAFLFFLAEHRMYVKTKNPKWRVAEISKELGRMWEACTDRDKYEKLAVMD--RKRYETDMAAFKT 530
            K++ Y YF++  R+EH++  PE  +  + F+  C+  WKAM+  ++  FE +A+ D+   D   M+  P K+ + K P  PKR  S F  F +EHR  +K + P   + +++K+LG MW   TD +K   L   +  + +Y+ D+A +KT
Sbjct:   12 KMSAYAYFVQTCREEHKKKSPEIPVSFSEFSKRCSGRWKAMTDKEKSRFEDMAKQDKVRYDQEMMHYMPGKRGKKKDPNAPKRPPSGFFLFCSEHRPQIKAQYPSLGIGDVAKKLGEMWNGLTDANKQPFLMKANKLKDKYQKDVADYKT 161          
BLAST of High mobility group protein vs. Ensembl Zebrafish
Match: hmgb2b (high mobility group box 2b [Source:ZFIN;Acc:ZDB-GENE-040912-122])

HSP 1 Score: 96.6709 bits (239), Expect = 2.649e-23
Identity = 57/167 (34.13%), Postives = 96/167 (57.49%), Query Frame = 3
Query:   96 KIAGYKYFIKLIRDEHQRMYPEKKLMLNSFATICAENWKAMSPVKRKWFEKLAEDD----EDFRKMYLKP--IKK--RQNKVPGQPKRAWSAFLFFLAEHRMYVKTKNPKWRVAEISKELGRMW--EACTDRDKYEKLAVMDRKRYETDMAAFKTGKVFSGE-PNRP 563
            K + Y +F++  RDEH+R  P+  +  + F+  C+E WK+++   +  FE +A+ D    +   K Y+ P  + K  R+ K P  PKR  SAF  F +E+R  VK+++P   + EI+K+LG +W  ++  DR  +E+ A   R++YE ++AA++ G   S   P RP
Sbjct:   12 KTSAYAFFVQTCRDEHKRKSPDVPVNFSEFSKKCSERWKSLNASDKVKFEDMAKADKVRYDREMKTYVPPKGVGKTGRKKKDPNAPKRPPSAFFVFCSEYRPTVKSEHPNLTIGEIAKKLGELWSKQSSKDRAPFEQKAGKLREKYEKEVAAYRAGGGASKRGPGRP 178          
BLAST of High mobility group protein vs. Ensembl Zebrafish
Match: hmgb2b (high mobility group box 2b [Source:ZFIN;Acc:ZDB-GENE-040912-122])

HSP 1 Score: 96.6709 bits (239), Expect = 2.649e-23
Identity = 57/167 (34.13%), Postives = 96/167 (57.49%), Query Frame = 3
Query:   96 KIAGYKYFIKLIRDEHQRMYPEKKLMLNSFATICAENWKAMSPVKRKWFEKLAEDD----EDFRKMYLKP--IKK--RQNKVPGQPKRAWSAFLFFLAEHRMYVKTKNPKWRVAEISKELGRMW--EACTDRDKYEKLAVMDRKRYETDMAAFKTGKVFSGE-PNRP 563
            K + Y +F++  RDEH+R  P+  +  + F+  C+E WK+++   +  FE +A+ D    +   K Y+ P  + K  R+ K P  PKR  SAF  F +E+R  VK+++P   + EI+K+LG +W  ++  DR  +E+ A   R++YE ++AA++ G   S   P RP
Sbjct:   12 KTSAYAFFVQTCRDEHKRKSPDVPVNFSEFSKKCSERWKSLNASDKVKFEDMAKADKVRYDREMKTYVPPKGVGKTGRKKKDPNAPKRPPSAFFVFCSEYRPTVKSEHPNLTIGEIAKKLGELWSKQSSKDRAPFEQKAGKLREKYEKEVAAYRAGGGASKRGPGRP 178          
BLAST of High mobility group protein vs. Ensembl Xenopus
Match: hmgb2 (high mobility group box 2 [Source:NCBI gene;Acc:394499])

HSP 1 Score: 103.605 bits (257), Expect = 8.628e-26
Identity = 60/168 (35.71%), Postives = 99/168 (58.93%), Query Frame = 3
Query:   96 KIAGYKYFIKLIRDEHQRMYPEKKLMLNSFATICAENWKAMSPVKRKWFEKLAEDD----EDFRKMYLKPIKKRQNKV---PGQPKRAWSAFLFFLAEHRMYVKTKNPKWRVAEISKELGRMWEACTDRDK--YEKLAVMDRKRYETDMAAFKT-GKVFSGE--PNRP 563
            K++ Y YF++  R+EH++ +P+  +    F+  C+E WK MS  ++  FE++A++D    E   K Y+ P  +++ K    P  PKR  SAF  F +EHR  +K+++P   + + +K+LG MW   T +DK  YE+ A   +++YE D+AA+K  GK   G+  P RP
Sbjct:   12 KMSSYAYFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEEMAKNDKVRYEREMKTYIPPKGEKKGKKKKDPNAPKRPPSAFFLFCSEHRPQIKSESPGLSIGDTAKKLGEMWSEQTPKDKLPYEQKAAKLKEKYEKDVAAYKAKGKSDVGKKVPGRP 179          
BLAST of High mobility group protein vs. Ensembl Xenopus
Match: cep170b (centrosomal protein 170B [Source:Xenbase;Acc:XB-GENE-5943417])

HSP 1 Score: 93.9745 bits (232), Expect = 3.168e-22
Identity = 53/153 (34.64%), Postives = 88/153 (57.52%), Query Frame = 3
Query:   96 KIAGYKYFIKLIRDEHQRMYPEKKLMLNSFATICAENWKAMSPVKRKWFEKLAEDD----EDFRKMYLKPI--KKRQNKVPGQPKRAWSAFLFFLAEHRMYVKTKNPKWRVAEISKELGRMWE--ACTDRDKYEKLAVMDRKRYETDMAAFKT 530
            K++ Y YF++  R+EH++ +P+  +    F+  C+E WK MS  ++  FE +A+ D    E   K Y+ P    K++ K P  PKR  SAF  F +E R  +K ++P   + +I+K+LG MW   A  D+  YE+ A   +++YE D+AA++ 
Sbjct:   12 KMSSYAYFVQTCREEHKKKHPDASVNFAEFSKKCSERWKTMSAKEKSKFEDMAKADKVRYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEFRPKIKGEHPGSTIGDIAKKLGEMWNNTATDDKLPYERKAAKLKEKYEKDVAAYRA 164          
BLAST of High mobility group protein vs. Ensembl Xenopus
Match: hmgb3 (high mobility group box 3 [Source:NCBI gene;Acc:448228])

HSP 1 Score: 86.2705 bits (212), Expect = 1.733e-19
Identity = 53/163 (32.52%), Postives = 86/163 (52.76%), Query Frame = 3
Query:   99 IAGYKYFIKLIRDEHQRMYPEKKLMLNSFATICAENWKAMSPVKRKWFEKLAEDDE---DFRKMYLKPIKKRQNKV-PGQPKRAWSAFLFFLAEHRMYVKTKNPKWRVAEISKELGRMWEACTDRDK--YEKLAVMDRKRYETDMAAFKTGKVFSGEPNRPKV 569
            ++ Y YF++  R+EH++  PE  +    F+  C+E WK MS  ++  F+ LA+ D+   D       P+KK + K  P  PKR  S F  F +E R  +K+ NP   + +++K+LG MW    D +K  Y   A   +++YE D+A +K+   F      PK+
Sbjct:   13 MSAYAYFVQTCREEHKKKNPEIPVNFAEFSKKCSERWKTMSAKEKSKFDDLAKADKVRYDREMKDFGPVKKGKKKKDPNAPKRPPSGFFLFCSEFRPKIKSTNPGISIGDVAKKLGEMWNNLNDGEKQPYNNKAAKLKEKYEKDVADYKSKGKFDCAKGAPKL 175          
BLAST of High mobility group protein vs. Ensembl Xenopus
Match: hmgb3 (high mobility group box 3 [Source:NCBI gene;Acc:448228])

HSP 1 Score: 77.7962 bits (190), Expect = 1.485e-16
Identity = 47/142 (33.10%), Postives = 76/142 (53.52%), Query Frame = 3
Query:   99 IAGYKYFIKLIRDEHQRMYPEKKLMLNSFATICAENWKAMSPVKRKWFEKLAEDDE---DFRKMYLKPIKKRQNKV-PGQPKRAWSAFLFFLAEHRMYVKTKNPKWRVAEISKELGRMWEACTDRDK--YEKLAVMDRKRYE 506
            ++ Y YF++  R+EH++  PE  +    F+  C+E WK MS  ++  F+ LA+ D+   D       P+KK + K  P  PKR  S F  F +E R  +K+ NP   + +++K+LG MW    D +K  Y   A   +++YE
Sbjct:   13 MSAYAYFVQTCREEHKKKNPEIPVNFAEFSKKCSERWKTMSAKEKSKFDDLAKADKVRYDREMKDFGPVKKGKKKKDPNAPKRPPSGFFLFCSEFRPKIKSTNPGISIGDVAKKLGEMWNNLNDGEKQPYNNKAAKLKEKYE 154          
BLAST of High mobility group protein vs. Ensembl Mouse
Match: Hmgb1 (high mobility group box 1 [Source:MGI Symbol;Acc:MGI:96113])

HSP 1 Score: 90.8929 bits (224), Expect = 3.180e-21
Identity = 52/153 (33.99%), Postives = 90/153 (58.82%), Query Frame = 3
Query:   96 KIAGYKYFIKLIRDEHQRMYPEKKLMLNSFATICAENWKAMSPVKRKWFEKLAEDD----EDFRKMYLKPI--KKRQNKVPGQPKRAWSAFLFFLAEHRMYVKTKNPKWRVAEISKELGRMWE--ACTDRDKYEKLAVMDRKRYETDMAAFKT 530
            K++ Y +F++  R+EH++ +P+  +  + F+  C+E WK MS  ++  FE +A+ D    E   K Y+ P    K++ K P  PKR  SAF  F +E+R  +K ++P   + +++K+LG MW   A  D+  YEK A   +++YE D+AA++ 
Sbjct:   26 KMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRA 178          
BLAST of High mobility group protein vs. Ensembl Mouse
Match: Hmgb1 (high mobility group box 1 [Source:MGI Symbol;Acc:MGI:96113])

HSP 1 Score: 90.5077 bits (223), Expect = 4.998e-21
Identity = 52/153 (33.99%), Postives = 90/153 (58.82%), Query Frame = 3
Query:   96 KIAGYKYFIKLIRDEHQRMYPEKKLMLNSFATICAENWKAMSPVKRKWFEKLAEDD----EDFRKMYLKPI--KKRQNKVPGQPKRAWSAFLFFLAEHRMYVKTKNPKWRVAEISKELGRMWE--ACTDRDKYEKLAVMDRKRYETDMAAFKT 530
            K++ Y +F++  R+EH++ +P+  +  + F+  C+E WK MS  ++  FE +A+ D    E   K Y+ P    K++ K P  PKR  SAF  F +E+R  +K ++P   + +++K+LG MW   A  D+  YEK A   +++YE D+AA++ 
Sbjct:   12 KMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRA 164          
BLAST of High mobility group protein vs. Ensembl Mouse
Match: Hmgb1 (high mobility group box 1 [Source:MGI Symbol;Acc:MGI:96113])

HSP 1 Score: 90.5077 bits (223), Expect = 4.998e-21
Identity = 52/153 (33.99%), Postives = 90/153 (58.82%), Query Frame = 3
Query:   96 KIAGYKYFIKLIRDEHQRMYPEKKLMLNSFATICAENWKAMSPVKRKWFEKLAEDD----EDFRKMYLKPI--KKRQNKVPGQPKRAWSAFLFFLAEHRMYVKTKNPKWRVAEISKELGRMWE--ACTDRDKYEKLAVMDRKRYETDMAAFKT 530
            K++ Y +F++  R+EH++ +P+  +  + F+  C+E WK MS  ++  FE +A+ D    E   K Y+ P    K++ K P  PKR  SAF  F +E+R  +K ++P   + +++K+LG MW   A  D+  YEK A   +++YE D+AA++ 
Sbjct:   12 KMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRA 164          
BLAST of High mobility group protein vs. Ensembl Mouse
Match: Hmgb1 (high mobility group box 1 [Source:MGI Symbol;Acc:MGI:96113])

HSP 1 Score: 90.5077 bits (223), Expect = 4.998e-21
Identity = 52/153 (33.99%), Postives = 90/153 (58.82%), Query Frame = 3
Query:   96 KIAGYKYFIKLIRDEHQRMYPEKKLMLNSFATICAENWKAMSPVKRKWFEKLAEDD----EDFRKMYLKPI--KKRQNKVPGQPKRAWSAFLFFLAEHRMYVKTKNPKWRVAEISKELGRMWE--ACTDRDKYEKLAVMDRKRYETDMAAFKT 530
            K++ Y +F++  R+EH++ +P+  +  + F+  C+E WK MS  ++  FE +A+ D    E   K Y+ P    K++ K P  PKR  SAF  F +E+R  +K ++P   + +++K+LG MW   A  D+  YEK A   +++YE D+AA++ 
Sbjct:   12 KMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRA 164          
BLAST of High mobility group protein vs. Ensembl Mouse
Match: Hmgb2 (high mobility group box 2 [Source:MGI Symbol;Acc:MGI:96157])

HSP 1 Score: 88.5817 bits (218), Expect = 2.505e-20
Identity = 55/170 (32.35%), Postives = 96/170 (56.47%), Query Frame = 3
Query:   96 KIAGYKYFIKLIRDEHQRMYPEKKLMLNSFATICAENWKAMSPVKRKWFEKLAEDDEDFRKMYLKPIK---------KRQNKVPGQPKRAWSAFLFFLAEHRMYVKTKNPKWRVAEISKELGRMW--EACTDRDKYEKLAVMDRKRYETDMAAFKT-GKVFSGE--PNRP 563
            K++ Y +F++  R+EH++ +P+  +    F+  C+E WK MS  ++  FE LA+ D   +  Y + +K         K + K P  PKR  SAF  F +E+R  +K ++P   + + +K+LG MW  ++  D+  YE+ A   +++YE D+AA++  GK  +G+  P RP
Sbjct:   12 KMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDLAKSD---KARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSENRPKIKIEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRP 178          
BLAST of High mobility group protein vs. UniProt/SwissProt
Match: sp|Q24537|HMG2_DROME (High mobility group protein DSP1 OS=Drosophila melanogaster OX=7227 GN=Dsp1 PE=2 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 2.681e-23
Identity = 60/169 (35.50%), Postives = 95/169 (56.21%), Query Frame = 3
Query:   96 KIAGYKYFIKLIRDEHQRMYPEKKLMLNSFATICAENWKAMSPVKRKWFEKLAEDD----EDFRKMYLKP--------IKKRQNKVPGQPKRAWSAFLFFLAEHRMYVKTKNPKWRVAEISKELGRMWEACTD--RDKYEKLAVMDRKRYETDMAAFKT-GKVFSGEPN 557
            ++  Y YF++  R+EH++ +P++ ++   F+  CAE WK M   ++K F ++AE D    E   + Y+ P         K++Q K P  PKR+ SAF +F  + R  VK  NP++ V +I+KELGR W       + KYE +A  D+ RYE +M  +KT GK+    P+
Sbjct:  182 RMTAYAYFVQTCREEHKKKHPDETVIFAEFSRKCAERWKTMVDKEKKRFHEMAEKDKQRYEAEMQNYVPPKGAVVGRGKKRKQIKDPNAPKRSLSAFFWFCNDERNKVKALNPEFGVGDIAKELGRKWSDVDPEVKQKYESMAERDKARYEREMTEYKTSGKIAMSAPS 350          
BLAST of High mobility group protein vs. UniProt/SwissProt
Match: sp|P07746|HMGT_ONCMY (High mobility group-T protein OS=Oncorhynchus mykiss OX=8022 PE=2 SV=2)

HSP 1 Score: 94.7449 bits (234), Expect = 7.067e-22
Identity = 58/157 (36.94%), Postives = 90/157 (57.32%), Query Frame = 3
Query:   96 KIAGYKYFIKLIRDEHQRMYPEKKLMLNSFATICAENWKAMSPVKRKWFEKLAEDD----EDFRKMYLKPI--KKRQNKVPGQPKRAWSAFLFFLAEHRMYVKTKNPKWRVAEISKELGRMWEACTDRDK--YEKLAVMDRKRYETDMAAFKT-GKV 539
            K++ Y YF++  R+EH++ +PE  +  + F+  C+E WK MS  ++  FE LA+ D    E   + Y+ P   KK++ K P  PKR  SAF  F A+ R  VK + P   + +++K+LG  W   T  DK  YEK A   +++YE D+ A++  GKV
Sbjct:   11 KMSSYAYFVQTRREEHKKKHPEASVNFSEFSKKCSERWKTMSAKEKGKFEDLAKLDKVRYEREMRSYIPPKGEKKKRFKDPNAPKRPSSAFFIFCADFRPQVKGETPGLSIGDVAKKLGEKWNNLTAEDKVPYEKKASRLKEKYEKDITAYRNKGKV 167          
BLAST of High mobility group protein vs. UniProt/SwissProt
Match: sp|P26584|HMGB2_CHICK (High mobility group protein B2 OS=Gallus gallus OX=9031 GN=HMGB2 PE=2 SV=2)

HSP 1 Score: 93.9745 bits (232), Expect = 1.429e-21
Identity = 55/167 (32.93%), Postives = 94/167 (56.29%), Query Frame = 3
Query:   96 KIAGYKYFIKLIRDEHQRMYPEKKLMLNSFATICAENWKAMSPVKRKWFEKLAEDDEDF--RKM--YLKPIKKRQNKV--PGQPKRAWSAFLFFLAEHRMYVKTKNPKWRVAEISKELGRMW--EACTDRDKYEKLAVMDRKRYETDMAAFK------TGKVFSGEP 554
            K++ Y YF++  R+EH++ +P+  +    F+  C+E WK MS  ++  FE++A+ D+    R+M  Y+ P  +++ K   P  PKR  SAF  F +EHR  +K  +P   + + +K+LG MW  +   D+  YE+ A   +++YE D+AA++       GK   G P
Sbjct:   12 KMSSYAYFVQTCREEHKKKHPDSSVNFAEFSRKCSERWKTMSSKEKGKFEEMAKGDKARYDREMKNYVPPKGEKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKNDHPGLSIGDTAKKLGEMWSEQLAKDKQPYEQKAAKLKEKYEKDIAAYRAKSKSDAGKKGPGRP 178          
BLAST of High mobility group protein vs. UniProt/SwissProt
Match: sp|P26583|HMGB2_HUMAN (High mobility group protein B2 OS=Homo sapiens OX=9606 GN=HMGB2 PE=1 SV=2)

HSP 1 Score: 91.6633 bits (226), Expect = 1.064e-20
Identity = 55/170 (32.35%), Postives = 97/170 (57.06%), Query Frame = 3
Query:   96 KIAGYKYFIKLIRDEHQRMYPEKKLMLNSFATICAENWKAMSPVKRKWFEKLAEDDEDFRKMYLKPIK---------KRQNKVPGQPKRAWSAFLFFLAEHRMYVKTKNPKWRVAEISKELGRMW--EACTDRDKYEKLAVMDRKRYETDMAAFKT-GKVFSGE--PNRP 563
            K++ Y +F++  R+EH++ +P+  +    F+  C+E WK MS  ++  FE +A+ D   +  Y + +K         K + K P  PKR  SAF  F +EHR  +K+++P   + + +K+LG MW  ++  D+  YE+ A   +++YE D+AA++  GK  +G+  P RP
Sbjct:   12 KMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSD---KARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRP 178          
BLAST of High mobility group protein vs. UniProt/SwissProt
Match: sp|P40673|HMGB2_BOVIN (High mobility group protein B2 OS=Bos taurus OX=9913 GN=HMGB2 PE=1 SV=3)

HSP 1 Score: 91.6633 bits (226), Expect = 1.064e-20
Identity = 55/170 (32.35%), Postives = 97/170 (57.06%), Query Frame = 3
Query:   96 KIAGYKYFIKLIRDEHQRMYPEKKLMLNSFATICAENWKAMSPVKRKWFEKLAEDDEDFRKMYLKPIK---------KRQNKVPGQPKRAWSAFLFFLAEHRMYVKTKNPKWRVAEISKELGRMW--EACTDRDKYEKLAVMDRKRYETDMAAFKT-GKVFSGE--PNRP 563
            K++ Y +F++  R+EH++ +P+  +    F+  C+E WK MS  ++  FE +A+ D   +  Y + +K         K + K P  PKR  SAF  F +EHR  +K+++P   + + +K+LG MW  ++  D+  YE+ A   +++YE D+AA++  GK  +G+  P RP
Sbjct:   12 KMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSD---KARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRP 178          
BLAST of High mobility group protein vs. TrEMBL
Match: A0A4S2M7M8 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_002095 PE=4 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 9.046e-36
Identity = 72/155 (46.45%), Postives = 106/155 (68.39%), Query Frame = 3
Query:   99 IAGYKYFIKLIRDEHQRMYPEKKLMLNSFATICAENWKAMSPVKRKWFEKLAE-DDEDF-RKM--YLKP---IKKRQNKVP---GQPKRAWSAFLFFLAEHRMYVKTKNPKWRVAEISKELGRMWEACTDRDKYEKLAVMDRKRYETDMAAFKTG 533
            ++ Y  F+++IR+EH++ +P ++++ + F+  CAE WK M+P ++K FE LA  D E F R+M  Y+ P    K ++ KVP   G P+RAWSAF FF  EHR  VK  NP+++VA+++KELGR WEAC D+ KYE LA  D++RYE DM  ++ G
Sbjct:   14 MSAYACFVQVIREEHKKKHPGEQIVFSDFSKKCAERWKLMTPKEKKRFEDLAALDKERFNREMSDYVPPEGMKKGKKRKVPRDPGLPRRAWSAFFFFCDEHRGKVKENNPEFKVADVAKELGRQWEACQDKAKYELLAQQDKQRYEEDMVKYRAG 168          
BLAST of High mobility group protein vs. TrEMBL
Match: A0A5J4NYU2 (Uncharacterized protein OS=Paragonimus westermani OX=34504 GN=DEA37_0014045 PE=4 SV=1)

HSP 1 Score: 137.502 bits (345), Expect = 2.971e-35
Identity = 72/155 (46.45%), Postives = 105/155 (67.74%), Query Frame = 3
Query:   99 IAGYKYFIKLIRDEHQRMYPEKKLMLNSFATICAENWKAMSPVKRKWFEKLAE-DDEDF-RKM--YLKP---IKKRQNKVP---GQPKRAWSAFLFFLAEHRMYVKTKNPKWRVAEISKELGRMWEACTDRDKYEKLAVMDRKRYETDMAAFKTG 533
            ++ Y  F+++IR+EH++ +P ++++ + F+  CAE WK M+  ++K FE LA  D E F R+M  Y+ P    K ++ KVP   G P+RAWSAF FF  EHR  VK  NP+++VA+++KELGRMWE C D+ KYE LA  D++RYE DMA +  G
Sbjct:   14 MSAYACFVQVIREEHKKKHPGEQIVFSDFSKKCAERWKLMTSKEKKRFEDLAALDKERFNREMSEYVPPEGMKKGKKRKVPRDPGLPRRAWSAFFFFCDEHRGKVKENNPEYKVADVAKELGRMWETCQDKAKYELLAQQDKQRYEEDMAKYHAG 168          
BLAST of High mobility group protein vs. TrEMBL
Match: A0A075AJ75 (HMG box (Fragment) OS=Opisthorchis viverrini OX=6198 GN=T265_12733 PE=4 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 4.825e-35
Identity = 72/155 (46.45%), Postives = 106/155 (68.39%), Query Frame = 3
Query:   99 IAGYKYFIKLIRDEHQRMYPEKKLMLNSFATICAENWKAMSPVKRKWFEKLAE-DDEDF-RKM--YLKP---IKKRQNKVP---GQPKRAWSAFLFFLAEHRMYVKTKNPKWRVAEISKELGRMWEACTDRDKYEKLAVMDRKRYETDMAAFKTG 533
            ++ Y  F+++IR+EH++ +P ++++ + F+  CAE WK M+P ++K FE LA  D E F R+M  Y+ P    K ++ KVP   G P+RAWSAF FF  EHR  VK  NP+++VA+++KELGR WEAC D+ KYE LA  D++RYE DM  ++ G
Sbjct:   72 MSAYACFVQVIREEHKKKHPGEQIVFSDFSKKCAERWKLMTPKEKKRFEDLAALDKERFNREMSDYVPPEGMKKGKKRKVPRDPGLPRRAWSAFFFFCDEHRGKVKENNPEFKVADVAKELGRQWEACQDKAKYELLAQQDKQRYEEDMVKYRAG 226          
BLAST of High mobility group protein vs. TrEMBL
Match: A0A1I8IAE5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 140.969 bits (354), Expect = 2.937e-33
Identity = 70/175 (40.00%), Postives = 106/175 (60.57%), Query Frame = 3
Query:   99 IAGYKYFIKLIRDEHQRMYPEKKLMLNSFATICAENWKAMSPVKRKWFEKLAEDDEDF--RKM--YL-----KPIKKRQNKVPGQPKRAWSAFLFFLAEHRMYVKTKNPKWRVAEISKELGRMWEACTDRDKYEKLAVMDRKRYETDMAAFKTGKVFSGEPNRPKVLEEDETGMN 596
            +  Y  F+++IR+EH++ +P++ ++ + F+  CAE WK M+P ++K FE +A  D++   R+M  Y+     K  K+++ K P  PKR  SAF FF  E R  V+  NP WRV+E++KELGR WEAC +R +YE+ A  D+ RYE DM  +K G   +      K  + D TG N
Sbjct:  895 MTAYACFVQVIREEHRKKHPDETVVFSEFSKKCAEKWKTMNPKEKKRFEDMAARDKERHNREMEDYVPADGSKGRKRKRVKDPNMPKRPLSAFFFFCEEERPKVRASNPDWRVSEVAKELGRRWEACKNRPRYEQQAARDKLRYEEDMKQYKAGTFVAS-----KRAKADATGDN 1064          
BLAST of High mobility group protein vs. TrEMBL
Match: A0A1I8IJA4 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig030660g2 PE=4 SV=1)

HSP 1 Score: 130.568 bits (327), Expect = 4.932e-33
Identity = 68/164 (41.46%), Postives = 106/164 (64.63%), Query Frame = 3
Query:   99 IAGYKYFIKLIRDEHQRMYPEKKLMLNSFATICAENWKAMSPVKRKWFEKLAEDDEDF--RKM--YLKP-----IKKRQNKVPGQPKRAWSAFLFFLAEHRMYVKTKNPKWRVAEISKELGRMWEACTDRDKYEKLAVMDRKRYETDMAAFKTGKVFSGEPNRP 563
            ++ Y  F+++IR+EH++ +PE+ ++   F+  CAE WK M+P ++K FE +A  D++   R+M  Y+        K+++ K P  PKRA +AF  F  EHR  ++ ++P WRV+E++KELGRMWEACTDR KYE  AV D++RYE +M  ++ G     +  RP
Sbjct:   12 MSAYACFVQVIREEHKKKHPEESVVFAEFSKKCAEKWKTMNPKEKKRFEDMASRDKERYNREMDDYVPADGSKGKKRKKPKDPNMPKRALTAFFLFSDEHRQKIRDEHPDWRVSEVAKELGRMWEACTDRPKYEAAAVRDKQRYEDEMNQYRQGTFVPTKRPRP 175          
BLAST of High mobility group protein vs. Ensembl Cavefish
Match: ENSAMXT00000044228.1 (high mobility group protein B2-like [Source:NCBI gene;Acc:103034313])

HSP 1 Score: 102.449 bits (254), Expect = 1.267e-25
Identity = 58/167 (34.73%), Postives = 96/167 (57.49%), Query Frame = 3
Query:   96 KIAGYKYFIKLIRDEHQRMYPEKKLMLNSFATICAENWKAMSPVKRKWFEKLAEDD----EDFRKMYLKPIK----KRQNKVPGQPKRAWSAFLFFLAEHRMYVKTKNPKWRVAEISKELGRMWE--ACTDRDKYEKLAVMDRKRYETDMAAFKT-GKVFSGEPNRP 563
            + + Y +F+   RDE ++  P   +    F+  C+E+WKA++P ++K FE LA+ D    ++  K Y+ P       R+ K P  PKR  SAF  F +EHR  VK+++P   + EI+K+LG  W   +  DR  +++ AV+ R++YE ++AA+++ G V    P RP
Sbjct:   11 RTSAYAFFVLSSRDELKKKSPGTSVNFGKFSKKCSEDWKALTPSEKKKFEDLAKADKARYDEEMKSYVPPKGMGKMGRKKKDPNAPKRPPSAFFIFCSEHRPAVKSEHPNLTIGEIAKKLGEKWSKLSTKDRSPFDQKAVLLREKYEKEVAAYRSGGSVAKRGPGRP 177          
BLAST of High mobility group protein vs. Ensembl Cavefish
Match: hmgb2a (high mobility group box 2 [Source:NCBI gene;Acc:111195933])

HSP 1 Score: 100.523 bits (249), Expect = 8.309e-25
Identity = 58/170 (34.12%), Postives = 96/170 (56.47%), Query Frame = 3
Query:   96 KIAGYKYFIKLIRDEHQRMYPEKKLMLNSFATICAENWKAMSPVKRKWFEKLAEDD----EDFRKMYLKPIKKRQNKV---PGQPKRAWSAFLFFLAEHRMYVKTKNPKWRVAEISKELGRMWEACTDRDK--YEKLAVMDRKRYETDMAAFKTGKVFS-----GEPNRP 563
            K + Y +F++  R+EH++ +P   +    F+  CAE WK MSP ++  FE LA++D    +   K Y+ P   ++ K    P  PKR  SAF  F ++HR  VK+++P   + +I+K+LG MW   + +DK  YE+ A+  +++YE D+AA++     +     G P RP
Sbjct:   11 KTSSYAFFVQTCREEHKKKHPGTSVNFAEFSKKCAERWKTMSPKEKTKFEDLAKNDKVRYDREMKTYIPPKGAKKGKKKKDPNAPKRPPSAFFVFCSDHRPKVKSEHPGISIGDIAKKLGEMWSKQSPKDKAPYEQKAMKLKEKYEKDVAAYRAKGAKADVAKKGGPGRP 180          
BLAST of High mobility group protein vs. Ensembl Cavefish
Match: hmgb1a (high mobility group-T protein-like [Source:NCBI gene;Acc:103039534])

HSP 1 Score: 98.9821 bits (245), Expect = 2.184e-24
Identity = 61/167 (36.53%), Postives = 98/167 (58.68%), Query Frame = 3
Query:   96 KIAGYKYFIKLIRDEHQRMYPEKKLMLNSFATICAENWKAMSPVKRKWFEKLAEDD----EDFRKMYLKPI--KKRQNKVPGQPKRAWSAFLFFLAEHRMYVKTKNPKWRVAEISKELGRMWEACTDRDK--YEKLAVMDRKRYETDMAAFKTGKVFSG---EPNRP 563
            K++ Y YF++  R+EH++ +P+  +  + F+  C+E WK MS  ++  FE++A  D    E   K Y+ P   KK++ K P  PKR  SAF  F AE+R  VK + P   + +++K+LG MW   +  +K  YEK A   +++YE D+AA++ GKV  G    P++P
Sbjct:   11 KMSSYAYFVQTCREEHKKKHPDTSVNFSEFSKKCSERWKTMSAKEKGKFEEMARLDKARYEREMKNYVPPRGEKKKRFKDPNAPKRPPSAFFIFCAEYRPKVKEETPGLSIGDVAKKLGEMWNKTSAEEKQPYEKKAAKLKEKYEKDIAAYRKGKVVGGAAKAPSKP 177          
BLAST of High mobility group protein vs. Ensembl Cavefish
Match: hmgb1b (high mobility group protein B1-like [Source:NCBI gene;Acc:103041093])

HSP 1 Score: 96.2857 bits (238), Expect = 2.095e-23
Identity = 55/156 (35.26%), Postives = 92/156 (58.97%), Query Frame = 3
Query:   96 KIAGYKYFIKLIRDEHQRMYPEKKLMLNSFATICAENWKAMSPVKRKWFEKLAEDD----EDFRKMYLKPI--KKRQNKVPGQPKRAWSAFLFFLAEHRMYVKTKNPKWRVAEISKELGRMWEACTD--RDKYEKLAVMDRKRYETDMAAFKTGKV 539
            K++ Y YF++  R+EH++ +PE  +  + F+  C+E WK MSP ++  FE +A+ D    E   K Y+ P   KK++ K P  PKR  SAF  F  ++R  +K +NP   + +I+K+LG MW + +   +  YEK A   +++Y+ D+A ++T  V
Sbjct:   11 KMSSYAYFVQTCREEHKKKHPEASVNFSEFSKKCSERWKTMSPKEKSKFEDMAKQDKVRYEREMKNYIPPKGEKKKRFKDPNAPKRPPSAFFIFCGDYRPKIKGENPGLSIGDIAKKLGEMWNSSSPEVKQPYEKKAAKLKEKYDKDIAVYRTKGV 166          
BLAST of High mobility group protein vs. Ensembl Cavefish
Match: ENSAMXT00000038024.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001237.1:225138:230441:1 gene:ENSAMXG00000041311.1 transcript:ENSAMXT00000038024.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 90.5077 bits (223), Expect = 2.750e-20
Identity = 51/149 (34.23%), Postives = 86/149 (57.72%), Query Frame = 3
Query:   96 KIAGYKYFIKLIRDEHQRMYPEKKLMLNSFATICAENWKAMSPVKRKWFEKLAEDD----EDFRKMYLKPIKKRQNKVPG----QPKRAWSAFLFFLAEHRMYVKTKNPKWRVAEISKELGRMWE--ACTDRDKYEKLAVMDRKRYETD 512
            + + Y YF+   RDE +R  P+ ++ L+  +  C+E WKA+SP ++K FE +A+ D    ++  K Y+ PI   + K+      +PKR  SAF  F A+HR  VK++ P   +AEI+K+L  MW   +  +R  +E+ A++ R++   D
Sbjct:  128 RTSAYAYFVLSCRDELKRKSPDTQVNLSMLSKKCSEEWKALSPDEKKKFEDMAKADKARYDEEVKNYIPPIGSEERKIKKEGSIEPKRPLSAFFIFCAKHRNTVKSEFPNLSIAEIAKKLVEMWSNLSAKERSAFEQKAILLREKQAKD 276          
BLAST of High mobility group protein vs. Ensembl Sea Lamprey
Match: hmgb2a (high mobility group box 2a [Source:ZFIN;Acc:ZDB-GENE-051120-126])

HSP 1 Score: 103.605 bits (257), Expect = 7.152e-27
Identity = 60/150 (40.00%), Postives = 90/150 (60.00%), Query Frame = 3
Query:   96 KIAGYKYFIKLIRDEHQRMYPEKKLMLNSFATICAENWKAMSPVKRKWFEKLAEDDEDF--RKM--YLKPIKKRQNKVPGQPKRAWSAFLFFLAEHRMYVKTKNPKWRVAEISKELGRMWEACTDRDK--YEKLAVMDRKRYETDMAAFK 527
            K++ Y YF++  R+EH++ +PE  +    F+  C+E WK MSP ++  FE++A+ D+    R+M  Y+ P  KR+ K P  PKR  SAF  F +EHR  VK  +P   + EI+K LG MW   T   K  YEK A   +++YE D+AA++
Sbjct:   12 KMSSYAYFVQTCREEHKKKHPEASVNFAEFSKKCSERWKTMSPKEKARFEEMAKADKARFDREMKNYVPPKGKRKTKDPNAPKRPPSAFFVFCSEHRPKVKADHPGLGIGEIAKRLGEMWGLLTPETKSPYEKKAAKLKEKYEKDVAAYR 161          
BLAST of High mobility group protein vs. Ensembl Sea Lamprey
Match: hmgb2b (high mobility group box 2b [Source:ZFIN;Acc:ZDB-GENE-040912-122])

HSP 1 Score: 90.8929 bits (224), Expect = 5.645e-22
Identity = 53/157 (33.76%), Postives = 88/157 (56.05%), Query Frame = 3
Query:   99 IAGYKYFIKLIRDEHQRMYPEKKLMLNSFATICAENWKAMSPVKRKWFEKLAEDD----EDFRKMYLKPIKK---RQNKVPGQPKRAWSAFLFFLAEHRMYVKTKNPKWRVAEISKELGRMWEACTDRDK--YEKLAVMDRKRYETDMAAFKT-GKV 539
            ++ Y YF++  R+EH++  PE  +    F+  C+E WK MS  ++  FE +A+ D    +   K Y+ P  +   R+ K P  PKR  SAF  + AE+R  V+ +NP   +  I+K+LG MW      +K  YE+     +++Y+ DMA++++ GKV
Sbjct:   13 MSSYAYFVQTCREEHKKKNPEASVNFAEFSKKCSERWKTMSEKEKTRFEDMAKVDKVRYDREMKTYVPPKGERGSRKKKDPNAPKRPPSAFFIYCAEYRSKVRAENPGLTIGSIAKKLGEMWNNAPADEKSIYERKTAKLKEKYDKDMASYRSKGKV 169          
BLAST of High mobility group protein vs. Ensembl Yeast
Match: NHP6A (High-mobility group (HMG) protein; binds to and remodels nucleosomes; involved in recruiting FACT and other chromatin remodelling complexes to chromosomes; functionally redundant with Nhp6Bp; required for transcriptional initiation fidelity of some tRNA genes; homologous to mammalian HMGB1 and HMGB2; NHP6A has a paralog, NHP6B, that arose from the whole genome duplication; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000006256])

HSP 1 Score: 58.9214 bits (141), Expect = 7.775e-12
Identity = 29/67 (43.28%), Postives = 43/67 (64.18%), Query Frame = 3
Query:  318 PGQPKRAWSAFLFFLAEHRMYVKTKNPKWRVAEISKELGRMWEACTDRDK--YEKLAVMDRKRYETD 512
            P  PKRA SA++FF  E+R  V+++NP     ++ K+LG  W+A T  +K  YE  A  D+KRYE++
Sbjct:   18 PNAPKRALSAYMFFANENRDIVRSENPDITFGQVGKKLGEKWKALTPEEKQPYEAKAQADKKRYESE 84          
BLAST of High mobility group protein vs. Ensembl Yeast
Match: NHP6B (High-mobility group (HMG) protein; binds to and remodels nucleosomes; involved in recruiting FACT and other chromatin remodelling complexes to the chromosomes; functionally redundant with Nhp6Ap; required for transcriptional initiation fidelity of some tRNA genes; homologous to mammalian HMGB1 and HMGB2; NHP6B has a paralog, NHP6A, that arose from the whole genome duplication [Source:SGD;Acc:S000002157])

HSP 1 Score: 57.3806 bits (137), Expect = 3.482e-11
Identity = 29/72 (40.28%), Postives = 44/72 (61.11%), Query Frame = 3
Query:  303 RQNKVPGQPKRAWSAFLFFLAEHRMYVKTKNPKWRVAEISKELGRMWEACTDRDK--YEKLAVMDRKRYETD 512
            R+ K P  PKR  SA++FF  E+R  V+++NP     ++ + LG  W+A T  +K  YE  A  D+KRYE++
Sbjct:   19 RRKKDPNAPKRGLSAYMFFANENRDIVRSENPDVTFGQVGRILGERWKALTAEEKQPYESKAQADKKRYESE 90          
BLAST of High mobility group protein vs. Ensembl Nematostella
Match: EDO36028 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJW6])

HSP 1 Score: 87.0409 bits (214), Expect = 1.290e-20
Identity = 63/175 (36.00%), Postives = 92/175 (52.57%), Query Frame = 3
Query:  102 AGYKYFIKLIRDEHQRMYPEKKLMLNSFATICAENWKAMSPVKRKWF-EKLAEDDEDFR---KMYLKPIKKRQNKV--------PGQPKRAWSAFLFFLAEHRMYVKTKNPKWRVAEISKELGRMWEACTDRDK--YEKLAVMDRKRYETDMAAFKTGKVFSGEPNRPKVLEEDE 584
            + Y +F++  R++ QR   E K  L  F+ + AE WK MS  +++ F +K  +D E F+   + Y  P  +   K         P +PKR  SA+  F+   R  VK  NP      +SK LG MW   TD DK  Y+ +A  D+ RYE++M AFK GK+   + N+ K +EEDE
Sbjct:    8 SAYNFFLQDQREKLQR--EEGKFSLADFSKVSAEKWKNMSEEEKETFVQKAGKDKERFKEEMQSYTPPPSEESGKKKRKKQTKDPNKPKRCLSAYFHFINLKRDDVKKDNPNASGGALSKVLGEMWSKMTDDDKTQYQDMAKKDKVRYESEMKAFKDGKL-PAKQNKTKEVEEDE 179          
BLAST of High mobility group protein vs. Ensembl Nematostella
Match: EDO39305 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAG5])

HSP 1 Score: 55.8398 bits (133), Expect = 1.319e-10
Identity = 26/66 (39.39%), Postives = 42/66 (63.64%), Query Frame = 3
Query:  327 PKRAWSAFLFFLAEHRMYVKTKNPKWRVAEISKELGRMWEACTDRDKYEKLAVMDRKRYETDMAAF 524
            PKRA SA++ +L + R  +K KNP   V E+SK  G MW+  TD+ K+E+ A +++++Y   M  +
Sbjct:    1 PKRAMSAYMLWLNDTRQEIKDKNPGISVTEVSKVAGEMWKNLTDKSKWEEKAAIEKQKYVQRMKEY 66          
BLAST of High mobility group protein vs. Ensembl Medaka
Match: hmgb1b (high mobility group protein B1 [Source:NCBI gene;Acc:101156596])

HSP 1 Score: 93.9745 bits (232), Expect = 1.438e-22
Identity = 56/157 (35.67%), Postives = 95/157 (60.51%), Query Frame = 3
Query:   96 KIAGYKYFIKLIRDEHQRMYPEKKLMLNSFATICAENWKAMSPVKRKWFEKLAEDD----EDFRKMYLKP--IKKRQNKVPGQPKRAWSAFLFFLAEHRMYVKTKNPKWRVAEISKELGRMWEACTDRDK--YEKLAVMDRKRYETDMAAFKT-GKV 539
            K++ Y YF++  R+EH++ +P+  +  + F+  C+E WK MSP ++  FE +A+ D    E   K Y+ P   KK++ K P  PKR  SAF  F A+ R  +K+++P   + + +K+LG MW + +  +K  YEK A   +++Y+ D+ A++T GKV
Sbjct:   11 KMSSYAYFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSPKEKGKFEDMAKQDKVRYEREMKNYVPPKGQKKKRFKDPNAPKRPPSAFFLFCADFRPKIKSESPGLSIGDTAKKLGEMWNSSSAEEKQPYEKKAAKLKEKYDKDIVAYRTKGKV 167          
BLAST of High mobility group protein vs. Ensembl Medaka
Match: hmgb2a (high mobility group protein B2 [Source:NCBI gene;Acc:101157589])

HSP 1 Score: 93.2041 bits (230), Expect = 3.928e-22
Identity = 57/172 (33.14%), Postives = 94/172 (54.65%), Query Frame = 3
Query:   96 KIAGYKYFIKLIRDEHQRMYPEKKLMLNSFATICAENWKAMSPVKRKWFEKLAEDD----EDFRKMYLKPIKKRQNKV---PGQPKRAWSAFLFFLAEHRMYVKTKNPKWRVAEISKELGRMWEACTDRDK--YEKLAVMDRKRYETDMAAFK----TGKVFSGE---PNRP 563
            K + Y YF+   R+EH++ +P   +    F+  C+E WK MS  ++  F++LA+ D    +   K Y+ P   ++ K    P  PKR  SAF  F ++HR  +K  NP   + +I+K+LG +W   + +DK  YE  A   +++YE D+AA++    +GK  +G+   P RP
Sbjct:   11 KTSAYAYFVATCREEHKKKHPGTSVNFAEFSKKCSERWKTMSSKEKVKFDELAKTDKARYDREMKTYVPPKGAKKVKKKKDPNAPKRPPSAFFVFCSDHRPKIKEDNPGISIGDIAKKLGELWATQSAKDKAPYEAKAAKLKEKYEKDVAAYRAKGGSGKSDAGKKSGPGRP 182          
BLAST of High mobility group protein vs. Ensembl Medaka
Match: hmgb1a (high mobility group-T protein [Source:NCBI gene;Acc:101165167])

HSP 1 Score: 90.1225 bits (222), Expect = 4.189e-21
Identity = 56/164 (34.15%), Postives = 89/164 (54.27%), Query Frame = 3
Query:   96 KIAGYKYFIKLIRDEHQRMYPEKKLMLNSFATICAENWKAMSPVKRKWFEKLAEDDE---DFRKMYLKPIKKRQNKV---PGQPKRAWSAFLFFLAEHRMYVKTKNPKWRVAEISKELGRMWEACTDRDK--YEKLAVMDRKRYETDMAAFKT-GKVFSGEPNR 560
            K++ Y YF++  R+EH++ +P+  +    F+  C+E WK MS  ++  FE +A  D+   D   M   P K  + K    P  PKR  SAF  F +E R  VK ++P   + +++K LG MW + +  DK  YEK A   +++Y  D+AA++  GK   G P +
Sbjct:   11 KMSSYAYFVQTCREEHKKKHPDASVNFAEFSKKCSERWKTMSAKEKGKFEDMARQDKVRYDREMMSYVPAKGAKTKKFKDPNAPKRPPSAFFIFCSEFRPKVKGESPGLTIGDVAKRLGEMWNSTSAEDKQPYEKKAAKLKEKYGKDIAAYRAKGKTGGGAPAK 174          
BLAST of High mobility group protein vs. Planmine SMEST
Match: SMESG000034017.1 (SMESG000034017.1)

HSP 1 Score: 167.933 bits (424), Expect = 9.739e-51
Identity = 80/160 (50.00%), Postives = 114/160 (71.25%), Query Frame = 3
Query:   93 IKIAGYKYFIKLIRDEHQRMYPEKKLMLNSFATICAENWKAMSPVKRKWFEKLAEDDEDFRK-MYLKPIKKRQNKVPGQPKRAWSAFLFFLAEHRMYVKTKNPKWRVAEISKELGRMWEACTDRDKYEKLAVMDRKRYETDMAAFKTGKVFSGEPNRPKV 569
            + +  Y YF+KLIRDEH++ +PE++     F+  CAE WK+M P +RK FE+LA ++ D +     K  +KRQ K PGQPKRAWSAF +F  E R  V+ ++P WRVAE+++ELGR+WEAC+DRD+YEK+A +D++RYE +M  F+ G   +GE  RPK+
Sbjct:   11 LAMTAYTYFVKLIRDEHRKKHPEEQFDFTEFSAKCAEKWKSMKPEERKRFEELASEENDKKPPGRKKRTRKRQKKAPGQPKRAWSAFFYFCDERRPKVRKEHPDWRVAEVARELGRLWEACSDRDRYEKMATLDKERYEKEMEQFRAGNFVAGETKRPKL 170          
BLAST of High mobility group protein vs. Planmine SMEST
Match: SMESG000052032.1 (SMESG000052032.1)

HSP 1 Score: 145.206 bits (365), Expect = 5.583e-41
Identity = 69/157 (43.95%), Postives = 106/157 (67.52%), Query Frame = 3
Query:   99 IAGYKYFIKLIRDEHQRMYPEKKLMLNSFATICAENWKAMSPVKRKWFEKLAEDDED--FRKMY-LKPIKKRQN--------KVPGQPKRAWSAFLFFLAEHRMYVKTKNPKWRVAEISKELGRMWEACTDRDKYEKLAVMDRKRYETDMAAFKTGK 536
            ++ Y YF+++IR+EH+R +P ++++ + F+  CAE WK M+P ++K FE++A  D+D   R+M   +P  +           K PGQPKRAWSAF FF  E+R  V+  +P WRV  I+KELGR+WE+CTD++KYEK +  D++RYE  M+ F+ G+
Sbjct:   15 MSAYAYFVQVIREEHKRKHPGEQVVFSEFSKKCAEKWKLMTPKEKKRFEEMAASDKDRFNREMNNYQPTGEGGRRRRKRRRIKEPGQPKRAWSAFFFFCDEYRPKVREAHPDWRVGNIAKELGRLWESCTDKEKYEKKSEADKQRYEEQMSQFRAGQ 171          
BLAST of High mobility group protein vs. Planmine SMEST
Match: SMESG000068286.1 (SMESG000068286.1)

HSP 1 Score: 122.865 bits (307), Expect = 1.062e-33
Identity = 58/156 (37.18%), Postives = 101/156 (64.74%), Query Frame = 3
Query:  108 YKYFIKLIRDEHQRMYPEKKLMLNSFATICAENWKAMSPVKRKWFEKLAEDDEDFRKMYLKPI----------KKRQNKVPGQPKRAWSAFLFFLAEHRMYVKTKNPKWRVAEISKELGRMWEACTDRDKYEKLAVMDRKRYETDMAAFKTGKVFS 545
            Y  F++++R+EH++ +P+++++ + F+  C+E WK MSP +++ F  +A  D   ++ YLK +           KR+ K P +PK AW+AF FF  EHR  +K +NP+++V +++K LG+MWEAC D+ KYE+ A  D++RY  ++  +K+G   S
Sbjct:   13 YACFVQVVREEHKKKHPDEQIVFSEFSKRCSEKWKEMSPKEKQRFMDIAAKD---KERYLKEMDNYQPPAGTKNKRKIKDPNKPKGAWTAFFFFSDEHRKKIKEENPEYKVGDVAKVLGKMWEACKDKSKYEEQAKRDKERYNKELEEYKSGTPVS 165          
BLAST of High mobility group protein vs. Planmine SMEST
Match: SMESG000023365.1 (SMESG000023365.1)

HSP 1 Score: 109.768 bits (273), Expect = 1.099e-28
Identity = 55/154 (35.71%), Postives = 97/154 (62.99%), Query Frame = 3
Query:   99 IAGYKYFIKLIRDEHQRMYPEKKLMLNSFATICAENWKAMSPVKRKWFEKLA---------EDDEDFRKMYLKPIKKRQNKVPGQPKRAWSAFLFFLAEHRMYVKTKNPKWRVAEISKELGRMWEACTDRDKYEKLAVMDRKRYETDMAAFKTG 533
            ++ Y  F+++IR++++  +P++ ++ + F+  CAE W+ + P ++K FE +A         E +E      +KP K++Q + P QPKR  SAF  +  E R  +K ++P WRV +I+KELG+ WE C D+ KYE+LA  +++R+E +M  +K+G
Sbjct:   14 MSAYACFVQVIREKYKNKHPDEAVVFSEFSKKCAEKWRQLGPKEKKQFEDMAAVDKARYIKEMNEYVPPGGVKPNKRKQPRDPAQPKRGLSAFFLYSQEFRGQIKDEHPDWRVGDIAKELGKRWETCADKGKYEELARREKERFEREMDEYKSG 167          
BLAST of High mobility group protein vs. Planmine SMEST
Match: SMESG000020771.1 (SMESG000020771.1)

HSP 1 Score: 91.6633 bits (226), Expect = 6.168e-22
Identity = 50/159 (31.45%), Postives = 87/159 (54.72%), Query Frame = 3
Query:  102 AGYKYFIKLIRDEHQRMYPEKKLMLNSFATICAENWKAMSPVKRKWFEKLAEDDEDFRKMYLKPIK---------------KRQNKVPGQPKRAWSAFLFFLAEHRMYVKTKNPKWRVAEISKELGRMWEACTDRDKYEKLAVMDRKRYETDMAAFKTG 533
            + Y  + + +R+E+++  P+ K+     + I +E WK +S  +++ +  LA+ D   +K Y K ++               KR+ K P +PK   +AF FF  EHR  VK KNP+++V +I+K LG+MW  C D+ KYE++    +++Y   M  +K G
Sbjct:   11 SAYIIYTQAVREEYKKKNPDGKVNFTEISKIASEKWKNISDKEKEKYNVLAQAD---KKRYTKEMEGYEPETDNRKPSKKAKREAKDPNKPKAPLTAFFFFSNEHRQTVKEKNPEFKVGDIAKVLGKMWSECKDKSKYEEMNKEAKEKYNLAMLEYKNG 166          
The following BLAST results are available for this feature:
BLAST of High mobility group protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HMGB22.216e-2132.35high mobility group box 2 [Source:HGNC Symbol;Acc:... [more]
HMGB22.216e-2132.35high mobility group box 2 [Source:HGNC Symbol;Acc:... [more]
HMGB22.216e-2132.35high mobility group box 2 [Source:HGNC Symbol;Acc:... [more]
HMGB17.280e-2133.99high mobility group box 1 [Source:HGNC Symbol;Acc:... [more]
HMGB17.280e-2133.99high mobility group box 1 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of High mobility group protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hmg-1.23.816e-2130.32High mobility group protein 1.2 [Source:UniProtKB... [more]
hmg-1.23.816e-2130.32High mobility group protein 1.2 [Source:UniProtKB... [more]
hmg-1.27.740e-2129.94High mobility group protein 1.2 [Source:UniProtKB... [more]
hmg-1.27.740e-2129.94High mobility group protein 1.2 [Source:UniProtKB... [more]
hmg-1.27.746e-2129.94High mobility group protein 1.2 [Source:UniProtKB... [more]
back to top
BLAST of High mobility group protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dsp12.497e-2435.50gene:FBgn0278608 transcript:FBtr0089259[more]
Dsp12.497e-2435.50gene:FBgn0278608 transcript:FBtr0089260[more]
Dsp12.497e-2435.50gene:FBgn0278608 transcript:FBtr0089261[more]
Dsp12.525e-2435.50gene:FBgn0278608 transcript:FBtr0089262[more]
Dsp12.525e-2435.50gene:FBgn0278608 transcript:FBtr0339766[more]
back to top
BLAST of High mobility group protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hmgb3b2.330e-2435.10high mobility group box 3b [Source:ZFIN;Acc:ZDB-GE... [more]
hmgb3b2.330e-2435.10high mobility group box 3b [Source:ZFIN;Acc:ZDB-GE... [more]
hmgb3a2.361e-2333.33high mobility group box 3a [Source:ZFIN;Acc:ZDB-GE... [more]
hmgb2b2.649e-2334.13high mobility group box 2b [Source:ZFIN;Acc:ZDB-GE... [more]
hmgb2b2.649e-2334.13high mobility group box 2b [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of High mobility group protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
hmgb28.628e-2635.71high mobility group box 2 [Source:NCBI gene;Acc:39... [more]
cep170b3.168e-2234.64centrosomal protein 170B [Source:Xenbase;Acc:XB-GE... [more]
hmgb31.733e-1932.52high mobility group box 3 [Source:NCBI gene;Acc:44... [more]
hmgb31.485e-1633.10high mobility group box 3 [Source:NCBI gene;Acc:44... [more]
back to top
BLAST of High mobility group protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hmgb13.180e-2133.99high mobility group box 1 [Source:MGI Symbol;Acc:M... [more]
Hmgb14.998e-2133.99high mobility group box 1 [Source:MGI Symbol;Acc:M... [more]
Hmgb14.998e-2133.99high mobility group box 1 [Source:MGI Symbol;Acc:M... [more]
Hmgb14.998e-2133.99high mobility group box 1 [Source:MGI Symbol;Acc:M... [more]
Hmgb22.505e-2032.35high mobility group box 2 [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of High mobility group protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q24537|HMG2_DROME2.681e-2335.50High mobility group protein DSP1 OS=Drosophila mel... [more]
sp|P07746|HMGT_ONCMY7.067e-2236.94High mobility group-T protein OS=Oncorhynchus myki... [more]
sp|P26584|HMGB2_CHICK1.429e-2132.93High mobility group protein B2 OS=Gallus gallus OX... [more]
sp|P26583|HMGB2_HUMAN1.064e-2032.35High mobility group protein B2 OS=Homo sapiens OX=... [more]
sp|P40673|HMGB2_BOVIN1.064e-2032.35High mobility group protein B2 OS=Bos taurus OX=99... [more]
back to top
BLAST of High mobility group protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2M7M89.046e-3646.45Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A5J4NYU22.971e-3546.45Uncharacterized protein OS=Paragonimus westermani ... [more]
A0A075AJ754.825e-3546.45HMG box (Fragment) OS=Opisthorchis viverrini OX=61... [more]
A0A1I8IAE52.937e-3340.00Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8IJA44.932e-3341.46Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of High mobility group protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000044228.11.267e-2534.73high mobility group protein B2-like [Source:NCBI g... [more]
hmgb2a8.309e-2534.12high mobility group box 2 [Source:NCBI gene;Acc:11... [more]
hmgb1a2.184e-2436.53high mobility group-T protein-like [Source:NCBI ge... [more]
hmgb1b2.095e-2335.26high mobility group protein B1-like [Source:NCBI g... [more]
ENSAMXT00000038024.12.750e-2034.23pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of High mobility group protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
hmgb2a7.152e-2740.00high mobility group box 2a [Source:ZFIN;Acc:ZDB-GE... [more]
hmgb2b5.645e-2233.76high mobility group box 2b [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of High mobility group protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
NHP6A7.775e-1243.28High-mobility group (HMG) protein; binds to and re... [more]
NHP6B3.482e-1140.28High-mobility group (HMG) protein; binds to and re... [more]
back to top
BLAST of High mobility group protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO360281.290e-2036.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO393051.319e-1039.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of High mobility group protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
hmgb1b1.438e-2235.67high mobility group protein B1 [Source:NCBI gene;A... [more]
hmgb2a3.928e-2233.14high mobility group protein B2 [Source:NCBI gene;A... [more]
hmgb1a4.189e-2134.15high mobility group-T protein [Source:NCBI gene;Ac... [more]
back to top
BLAST of High mobility group protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000034017.19.739e-5150.00SMESG000034017.1[more]
SMESG000052032.15.583e-4143.95SMESG000052032.1[more]
SMESG000068286.11.062e-3337.18SMESG000068286.1[more]
SMESG000023365.11.099e-2835.71SMESG000023365.1[more]
SMESG000020771.16.168e-2231.45SMESG000020771.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024417 ID=SMED30024417|Name=High mobility group protein|organism=Schmidtea mediterranea sexual|type=transcript|length=983bp
AAATACTTTAAATATCAACTAATAAAAAATTTTACTGATAAAATATAATT
ATTACTATTTTTTTTGTAATGTTAAATCACTCCAATGAAAATATTAAAAT
TGCTGGTTATAAGTATTTTATTAAATTGATTAGAGATGAGCATCAAAGAA
TGTACCCTGAAAAAAAGCTTATGTTAAATTCTTTTGCTACAATATGTGCC
GAGAATTGGAAGGCCATGTCGCCAGTTAAGCGTAAATGGTTTGAAAAACT
TGCTGAGGATGATGAAGACTTTCGAAAAATGTATTTAAAACCTATTAAAA
AACGCCAGAATAAAGTTCCAGGACAGCCTAAAAGAGCTTGGTCTGCGTTT
TTATTTTTTCTTGCTGAACATCGAATGTATGTTAAAACTAAAAATCCAAA
ATGGCGAGTAGCTGAAATATCGAAAGAACTGGGACGGATGTGGGAAGCTT
GTACCGACAGAGATAAGTATGAAAAACTTGCAGTTATGGATAGAAAACGC
TATGAAACGGATATGGCGGCATTTAAAACAGGAAAAGTTTTCAGCGGTGA
ACCTAATCGACCAAAAGTACTAGAAGAAGATGAAACTGGCATGAATATTG
AAGAATATGAAGAGGAGGAAGAAGATGAAGAAAATGAAGAAATCGATCAC
AGTGAAGTTGAATATTACGAAGAATCTCAGGATGCAAATGCTTTAACAAA
TTTTGAAATTGATTCTAGTAATTCTGTCGTTCAGTCTGAAGAAAACGTTT
TATGGTAGTTTTCAAAATGAAATATAAATATGAAATTTCTTTTGTTGAAT
GTATGTACTATTACAGTCATTTTAATGTAAATGTTCTTTTCGTGTATATT
CAATTTTGACATGAGTTAGTTATTGCTATGTATCTTTTTATTCAACATTT
TCTACGCAAACGGCTATAATCCATATCCTCATGGTCAGCGAATTTCAATG
AAACCATTAAAAATACATTTTATTCTGTCTCAG
back to top

protein sequence of SMED30024417-orf-1

>SMED30024417-orf-1 ID=SMED30024417-orf-1|Name=SMED30024417-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=230bp
MLNHSNENIKIAGYKYFIKLIRDEHQRMYPEKKLMLNSFATICAENWKAM
SPVKRKWFEKLAEDDEDFRKMYLKPIKKRQNKVPGQPKRAWSAFLFFLAE
HRMYVKTKNPKWRVAEISKELGRMWEACTDRDKYEKLAVMDRKRYETDMA
AFKTGKVFSGEPNRPKVLEEDETGMNIEEYEEEEEDEENEEIDHSEVEYY
EESQDANALTNFEIDSSNSVVQSEENVLW*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR009071HMG_box_dom
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus