Potassium channel tetramerization domain containing 1

Overview
NamePotassium channel tetramerization domain containing 1
Smed IDSMED30024416
Length (bp)1035
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Potassium channel tetramerization domain containing 1 (SMED30024416) t-SNE clustered cells

Violin plots show distribution of expression levels for Potassium channel tetramerization domain containing 1 (SMED30024416) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Potassium channel tetramerization domain containing 1 (SMED30024416) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Potassium channel tetramerization domain containing 1 (SMED30024416) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024416

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30024416SMESG000067417.1 dd_Smed_v4_3793_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30024416SMESG000067417.1 dd_Smed_v4_3793_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30024416SMESG000067417.1 dd_Smed_v4_3793_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30024416SMESG000067417.1 dd_Smed_v4_3793_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30024416SMESG000067417.1 dd_Smed_v4_3793_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30024416SMESG000067417.1 dd_Smed_v4_3793_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Potassium channel tetramerization domain containing 1 vs. Ensembl Human
Match: CRKL (CRK like proto-oncogene, adaptor protein [Source:HGNC Symbol;Acc:HGNC:2363])

HSP 1 Score: 75.485 bits (184), Expect = 7.601e-15
Identity = 70/284 (24.65%), Postives = 118/284 (41.55%), Query Frame = 2
Query:  203 WYFGNLSRDEAQNSIFMEADGTYLIRDCNQILGGYVLLVKEKTQTNKYIISPYKD-GWKIGNTEFDSIESLLSHFSKVIIRQSTLTNPAPK---------------------PFYRVLQTYHPKSDIE-LAVNECQFVRFVLKYDEKILCEHQLTKAIGWLPV----NILKQSSNDK-----------TSLQQMVFKMQSRVPFKTL----------------------AIKDRYPNVFDKSQLSVKVGDSLMVIDVLENGMLQTKNQFGKDGLVPFNIVNIND 874
            WY G +SR EAQ  +  +  G +L+RD +   G YVL V E ++ + YII+   +  +KIG+ EFD + +LL  +    +  +TL  PAP+                      + R L  + P +D E L   + + +  + K +E+          +G +PV     +++ S + K                   + Q+  P   +                      AI+ R P  +DK+ L+++VGD + V  +  NG  + +   G+ GL PF  V I D
Sbjct:   14 WYMGPVSRQEAQTRLQGQRHGMFLVRDSSTCPGDYVLSVSENSRVSHYIINSLPNRRFKIGDQEFDHLPALLEFYKIHYLDTTTLIEPAPRYPSPPMGSVSAPNLPTAEDNLEYVRTLYDF-PGNDAEDLPFKKGEILVIIEKPEEQWWSARNKDGRVGMIPVPYVEKLVRSSPHGKHGNRNSNSYGIPEPAHAYAQPQTTTPLPAVSGSPGAAITPLPSTQNGPVFAKAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVN-GRKGLFPFTHVKIFD 295          
BLAST of Potassium channel tetramerization domain containing 1 vs. Ensembl Human
Match: CRKL (CRK like proto-oncogene, adaptor protein [Source:HGNC Symbol;Acc:HGNC:2363])

HSP 1 Score: 75.485 bits (184), Expect = 7.601e-15
Identity = 70/284 (24.65%), Postives = 118/284 (41.55%), Query Frame = 2
Query:  203 WYFGNLSRDEAQNSIFMEADGTYLIRDCNQILGGYVLLVKEKTQTNKYIISPYKD-GWKIGNTEFDSIESLLSHFSKVIIRQSTLTNPAPK---------------------PFYRVLQTYHPKSDIE-LAVNECQFVRFVLKYDEKILCEHQLTKAIGWLPV----NILKQSSNDK-----------TSLQQMVFKMQSRVPFKTL----------------------AIKDRYPNVFDKSQLSVKVGDSLMVIDVLENGMLQTKNQFGKDGLVPFNIVNIND 874
            WY G +SR EAQ  +  +  G +L+RD +   G YVL V E ++ + YII+   +  +KIG+ EFD + +LL  +    +  +TL  PAP+                      + R L  + P +D E L   + + +  + K +E+          +G +PV     +++ S + K                   + Q+  P   +                      AI+ R P  +DK+ L+++VGD + V  +  NG  + +   G+ GL PF  V I D
Sbjct:   14 WYMGPVSRQEAQTRLQGQRHGMFLVRDSSTCPGDYVLSVSENSRVSHYIINSLPNRRFKIGDQEFDHLPALLEFYKIHYLDTTTLIEPAPRYPSPPMGSVSAPNLPTAEDNLEYVRTLYDF-PGNDAEDLPFKKGEILVIIEKPEEQWWSARNKDGRVGMIPVPYVEKLVRSSPHGKHGNRNSNSYGIPEPAHAYAQPQTTTPLPAVSGSPGAAITPLPSTQNGPVFAKAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVN-GRKGLFPFTHVKIFD 295          
BLAST of Potassium channel tetramerization domain containing 1 vs. Ensembl Human
Match: CRK (CRK proto-oncogene, adaptor protein [Source:HGNC Symbol;Acc:HGNC:2362])

HSP 1 Score: 64.6994 bits (156), Expect = 3.427e-11
Identity = 64/286 (22.38%), Postives = 111/286 (38.81%), Query Frame = 2
Query:  203 WYFGNLSRDEAQNSIFMEADGTYLIRDCNQILGGYVLLVKEKTQTNKYII--------------------SPYKDGWKIGNTEFDSIESLLSHFSKVIIRQSTLTNPAPKP--------------FYRVLQTYHPKSDIELAVNECQFVRFVLKYDEKILCEHQLTKAIGWLPVNILKQSSNDKTSLQQMVFKMQS----------------------------RVPFKTLAIKDRYPNVFDKSQLSVKVGDSLMVIDVLENGMLQTKNQFGKDGLVPFNIVNIND 874
            WY+G LSR EA   +  +  G +L+RD +   G YVL V E ++ + YII                    SP +   +IG+ EFDS+ +LL  +    +  +TL  P  +               + R L  ++   + +L   +   +R   K +E+           G +PV  +++      S+  ++   Q                               P     I+ R PN +DK+ L+++VG+ + V  +  +G  + +   GK G  PF  V + D
Sbjct:   13 WYWGRLSRQEAVALLQGQRHGVFLVRDSSTSPGDYVLSVSENSRVSHYIINSSGPRPPVPPSPAQPPPGVSPSR--LRIGDQEFDSLPALLEFYKIHYLDTTTLIEPVSRSRQGSGVILRQEEAEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKYRPASASVSALIGGNQEGSHPQPLGGPEPGPYAQPSVNTPLPNLQNGPIYARVIQKRVPNAYDKTALALEVGELVKVTKINVSGQWEGECN-GKRGHFPFTHVRLLD 295          
BLAST of Potassium channel tetramerization domain containing 1 vs. Ensembl Human
Match: CRK (CRK proto-oncogene, adaptor protein [Source:HGNC Symbol;Acc:HGNC:2362])

HSP 1 Score: 53.9138 bits (128), Expect = 6.876e-8
Identity = 40/151 (26.49%), Postives = 64/151 (42.38%), Query Frame = 2
Query:  176 NLMQNHVKDWYFGNLSRDEAQNSIFMEADGTYLIRDCNQILGGYVLLVKEKTQTNKYII--------------------SPYKDGWKIGNTEFDSIESLLSHFSKVIIRQSTLTNPAPKPFYRVLQTYHPKSDIELAVNECQFVRFVLKYD 568
            N        WY+G LSR EA   +  +  G +L+RD +   G YVL V E ++ + YII                    SP +   +IG+ EFDS+ +LL  +    +  +TL  P  +            S + L   E ++VR +  ++
Sbjct:    4 NFDSEERSSWYWGRLSRQEAVALLQGQRHGVFLVRDSSTSPGDYVLSVSENSRVSHYIINSSGPRPPVPPSPAQPPPGVSPSR--LRIGDQEFDSLPALLEFYKIHYLDTTTLIEPVSRS--------RQGSGVILRQEEAEYVRALFDFN 144          
BLAST of Potassium channel tetramerization domain containing 1 vs. Ensembl Human
Match: CRK (CRK proto-oncogene, adaptor protein [Source:HGNC Symbol;Acc:HGNC:2362])

HSP 1 Score: 52.7582 bits (125), Expect = 2.161e-7
Identity = 34/110 (30.91%), Postives = 52/110 (47.27%), Query Frame = 2
Query:  203 WYFGNLSRDEAQNSIFMEADGTYLIRDCNQILGGYVLLVKEKTQTNKYII--------------------SPYKDGWKIGNTEFDSIESLLSHFSKVIIRQSTLTNPAPK 472
            WY+G LSR EA   +  +  G +L+RD +   G YVL V E ++ + YII                    SP +   +IG+ EFDS+ +LL  +    +  +TL  P  +
Sbjct:   13 WYWGRLSRQEAVALLQGQRHGVFLVRDSSTSPGDYVLSVSENSRVSHYIINSSGPRPPVPPSPAQPPPGVSPSR--LRIGDQEFDSLPALLEFYKIHYLDTTTLIEPVSR 120          
BLAST of Potassium channel tetramerization domain containing 1 vs. Ensembl Celegans
Match: ced-2 (Cell death abnormality protein 2 [Source:UniProtKB/Swiss-Prot;Acc:Q9NHC3])

HSP 1 Score: 73.1738 bits (178), Expect = 1.552e-14
Identity = 67/260 (25.77%), Postives = 116/260 (44.62%), Query Frame = 2
Query:  197 KDWYFGNLSRDEAQNSIFMEAD---GTYLIRDCNQILGGYVLLVKEKTQTNK---YIIS---PYKDGW-----KIGNTEFDSIESLLSHFSKVIIRQSTLTNPAPKPFYRVLQ---TYHPKSDIELAVNECQFVRFVLKYDEKILCEHQLTKAIGWLPVNILK---QSSNDKTSLQQMV----------------------FKMQSRVPFKTLAIKDRYPNVFDKSQLSVKVGDSLMVIDVLENGMLQTKNQFGKDGLVP 850
            + +YF  +SR+EA + +  E     GT+L+RD ++  G Y L V+E  + N    Y+I    P +DG      KI N  F  I +LL+HF   ++ +++L     KP   V+     +  + + +L   + + +  + K ++            G +P N ++   +  ND+TS                            ++Q R+P K     DR PN +D +QL VK G +++V   + NGM + +   G+ G VP
Sbjct:   12 RSFYFPGMSREEA-HKLLGEPQVSIGTFLMRDSSRP-GEYSLTVREADEGNAVCHYLIERGEPKEDGTAAAGVKIANQSFPDIPALLNHFKMRVLTEASLLAAYKKPIIEVVVGTFKFTGERETDLPFEQGERLEILSKTNQDWWEARNALGTTGLVPANYVQIQMEFHNDRTSKGASQSSIGSSGGGAERFSSASTSSDNIELQPRLPAKAKVTFDRVPNAYDPTQLRVKKGQTVLVTQKMSNGMYKAELD-GQIGSVP 268          
BLAST of Potassium channel tetramerization domain containing 1 vs. Ensembl Celegans
Match: nck-1 (NCK (Non-Catalytic region of tyrosine Kinase) adaptor protein family [Source:UniProtKB/TrEMBL;Acc:Q95PX0])

HSP 1 Score: 46.9802 bits (110), Expect = 8.235e-6
Identity = 30/96 (31.25%), Postives = 49/96 (51.04%), Query Frame = 2
Query:  203 WYFGNLSRDEAQNSIFMEADGTYLIRDCNQILGGYVLLVKEKTQTNKYIISPYKDG-WKIGNTEFDSIESLLSHFSKVIIRQST-----LTNPAPK 472
            WYFG +SR+ A++ +    +G +L+RD     G   + ++   + NK+      DG  KIGN  F  + +L++H++   I  S      LT P PK
Sbjct:  192 WYFGRISRERAEDLLLHGREGEFLVRDSESNPGDLSISMR-GIERNKHFKVQNVDGLLKIGNRTFVDMNALINHYTTSPIFSSPTEKLFLTGPLPK 286          
BLAST of Potassium channel tetramerization domain containing 1 vs. Ensembl Celegans
Match: nck-1 (NCK (Non-Catalytic region of tyrosine Kinase) adaptor protein family [Source:UniProtKB/TrEMBL;Acc:Q95PX0])

HSP 1 Score: 46.9802 bits (110), Expect = 8.235e-6
Identity = 30/96 (31.25%), Postives = 49/96 (51.04%), Query Frame = 2
Query:  203 WYFGNLSRDEAQNSIFMEADGTYLIRDCNQILGGYVLLVKEKTQTNKYIISPYKDG-WKIGNTEFDSIESLLSHFSKVIIRQST-----LTNPAPK 472
            WYFG +SR+ A++ +    +G +L+RD     G   + ++   + NK+      DG  KIGN  F  + +L++H++   I  S      LT P PK
Sbjct:  192 WYFGRISRERAEDLLLHGREGEFLVRDSESNPGDLSISMR-GIERNKHFKVQNVDGLLKIGNRTFVDMNALINHYTTSPIFSSPTEKLFLTGPLPK 286          
BLAST of Potassium channel tetramerization domain containing 1 vs. Ensembl Celegans
Match: nck-1 (NCK (Non-Catalytic region of tyrosine Kinase) adaptor protein family [Source:UniProtKB/TrEMBL;Acc:Q95PX0])

HSP 1 Score: 46.9802 bits (110), Expect = 8.235e-6
Identity = 30/96 (31.25%), Postives = 49/96 (51.04%), Query Frame = 2
Query:  203 WYFGNLSRDEAQNSIFMEADGTYLIRDCNQILGGYVLLVKEKTQTNKYIISPYKDG-WKIGNTEFDSIESLLSHFSKVIIRQST-----LTNPAPK 472
            WYFG +SR+ A++ +    +G +L+RD     G   + ++   + NK+      DG  KIGN  F  + +L++H++   I  S      LT P PK
Sbjct:  192 WYFGRISRERAEDLLLHGREGEFLVRDSESNPGDLSISMR-GIERNKHFKVQNVDGLLKIGNRTFVDMNALINHYTTSPIFSSPTEKLFLTGPLPK 286          
BLAST of Potassium channel tetramerization domain containing 1 vs. Ensembl Fly
Match: Crk (gene:FBgn0024811 transcript:FBtr0089113)

HSP 1 Score: 83.5741 bits (205), Expect = 3.476e-18
Identity = 66/249 (26.51%), Postives = 116/249 (46.59%), Query Frame = 2
Query:  203 WYFGNLSRDEAQNSIFMEAD-GTYLIRDCNQILGGYVLLVKEKTQTNKYIISPYKDG----WKIGNTEFDSIESLLSHFSKVIIRQSTLTNPAPKPFYRVLQTYH--PKSDIELAVNECQFVRFVLKYDEKILCEHQLTKAIGWLPVNILKQSSN-------DKT----SLQQMVFK-------MQSRVPFKTLAIKDRYPNVFDKSQLSVKVGDSLMVIDVLENGMLQTKNQFGKDGLVPFNIVNIND 874
            WYFG +SR +A   +  E + G +L+RD N I G YVL V+E T+ + YII+  +      ++IG+  FD++  LL+ ++   +  + L  PA +   +V+  +        +L     + +  V K +++       +  IG +PV  ++Q  +       DK     S    VF+       +  ++P      + R PN +DK+ L +++GD + V     NG  + +   GK+G  PF  V   D
Sbjct:   12 WYFGPMSRQDATEVLMNERERGVFLVRDSNSIAGDYVLCVREDTKVSNYIINKVQQQDQIVYRIGDQSFDNLPKLLTFYTLHYLDTTPLKRPACRRVEKVIGKFDFVGSDQDDLPFQRGEVLTIVRKDEDQWWTARNSSGKIGQIPVPYIQQYDDYMDEDAIDKNEPSISGSSNVFESTLKRTDLNRKLPAYARVKQSRVPNAYDKTALKLEIGDIIKVTKTNINGQWEGELN-GKNGHFPFTHVEFVD 259          
BLAST of Potassium channel tetramerization domain containing 1 vs. Ensembl Fly
Match: Crk (gene:FBgn0024811 transcript:FBtr0089112)

HSP 1 Score: 83.5741 bits (205), Expect = 3.476e-18
Identity = 66/249 (26.51%), Postives = 116/249 (46.59%), Query Frame = 2
Query:  203 WYFGNLSRDEAQNSIFMEAD-GTYLIRDCNQILGGYVLLVKEKTQTNKYIISPYKDG----WKIGNTEFDSIESLLSHFSKVIIRQSTLTNPAPKPFYRVLQTYH--PKSDIELAVNECQFVRFVLKYDEKILCEHQLTKAIGWLPVNILKQSSN-------DKT----SLQQMVFK-------MQSRVPFKTLAIKDRYPNVFDKSQLSVKVGDSLMVIDVLENGMLQTKNQFGKDGLVPFNIVNIND 874
            WYFG +SR +A   +  E + G +L+RD N I G YVL V+E T+ + YII+  +      ++IG+  FD++  LL+ ++   +  + L  PA +   +V+  +        +L     + +  V K +++       +  IG +PV  ++Q  +       DK     S    VF+       +  ++P      + R PN +DK+ L +++GD + V     NG  + +   GK+G  PF  V   D
Sbjct:   12 WYFGPMSRQDATEVLMNERERGVFLVRDSNSIAGDYVLCVREDTKVSNYIINKVQQQDQIVYRIGDQSFDNLPKLLTFYTLHYLDTTPLKRPACRRVEKVIGKFDFVGSDQDDLPFQRGEVLTIVRKDEDQWWTARNSSGKIGQIPVPYIQQYDDYMDEDAIDKNEPSISGSSNVFESTLKRTDLNRKLPAYARVKQSRVPNAYDKTALKLEIGDIIKVTKTNINGQWEGELN-GKNGHFPFTHVEFVD 259          
BLAST of Potassium channel tetramerization domain containing 1 vs. Ensembl Fly
Match: Crk (gene:FBgn0024811 transcript:FBtr0304871)

HSP 1 Score: 68.9366 bits (167), Expect = 1.450e-13
Identity = 43/153 (28.10%), Postives = 78/153 (50.98%), Query Frame = 2
Query:  203 WYFGNLSRDEAQNSIFMEAD-GTYLIRDCNQILGGYVLLVKEKTQTNKYIISPYKDG----WKIGNTEFDSIESLLSHFSKVIIRQSTLTNPAPKPFYRVLQTYH--PKSDIELAVNECQFVRFVLKYDEKILCEHQLTKAIGWLPVNILKQS 640
            WYFG +SR +A   +  E + G +L+RD N I G YVL V+E T+ + YII+  +      ++IG+  FD++  LL+ ++   +  + L  PA +   +V+  +        +L     + +  V K +++       +  IG +PV  ++QS
Sbjct:   12 WYFGPMSRQDATEVLMNERERGVFLVRDSNSIAGDYVLCVREDTKVSNYIINKVQQQDQIVYRIGDQSFDNLPKLLTFYTLHYLDTTPLKRPACRRVEKVIGKFDFVGSDQDDLPFQRGEVLTIVRKDEDQWWTARNSSGKIGQIPVPYIQQS 164          
BLAST of Potassium channel tetramerization domain containing 1 vs. Ensembl Fly
Match: Crk (gene:FBgn0024811 transcript:FBtr0308256)

HSP 1 Score: 69.707 bits (169), Expect = 2.133e-13
Identity = 61/243 (25.10%), Postives = 111/243 (45.68%), Query Frame = 2
Query:  221 SRDEAQNSIFMEAD-GTYLIRDCNQILGGYVLLVKEKTQTNKYIISPYKDG----WKIGNTEFDSIESLLSHFSKVIIRQSTLTNPAPKPFYRVLQTYH--PKSDIELAVNECQFVRFVLKYDEKILCEHQLTKAIGWLPVNILKQSSN-------DKT----SLQQMVFK-------MQSRVPFKTLAIKDRYPNVFDKSQLSVKVGDSLMVIDVLENGMLQTKNQFGKDGLVPFNIVNIND 874
            +R +A   +  E + G +L+RD N I G YVL V+E T+ + YII+  +      ++IG+  FD++  LL+ ++   +  + L  PA +   +V+  +        +L     + +  V K +++       +  IG +PV  ++Q  +       DK     S    VF+       +  ++P      + R PN +DK+ L +++GD + V     NG  + +   GK+G  PF  V   D
Sbjct:   10 NRQDATEVLMNERERGVFLVRDSNSIAGDYVLCVREDTKVSNYIINKVQQQDQIVYRIGDQSFDNLPKLLTFYTLHYLDTTPLKRPACRRVEKVIGKFDFVGSDQDDLPFQRGEVLTIVRKDEDQWWTARNSSGKIGQIPVPYIQQYDDYMDEDAIDKNEPSISGSSNVFESTLKRTDLNRKLPAYARVKQSRVPNAYDKTALKLEIGDIIKVTKTNINGQWEGELN-GKNGHFPFTHVEFVD 251          
BLAST of Potassium channel tetramerization domain containing 1 vs. Ensembl Fly
Match: Crk (gene:FBgn0024811 transcript:FBtr0089114)

HSP 1 Score: 67.3958 bits (163), Expect = 1.225e-12
Identity = 61/245 (24.90%), Postives = 108/245 (44.08%), Query Frame = 2
Query:  203 WYFGNLSRDEAQNSIFMEAD-GTYLIRDCNQILGGYVLLVKEKTQTNKYIISPYKDGWKIGNTEFDSIESLLSHFSKVIIRQSTLTNPAPKPFYRVLQTYH--PKSDIELAVNECQFVRFVLKYDEKILCEHQLTKAIGWLPVNILKQSSN-------DKT----SLQQMVFK-------MQSRVPFKTLAIKDRYPNVFDKSQLSVKVGDSLMVIDVLENGMLQTKNQFGKDGLVPFNIVNIND 874
            WYFG +SR +A   +  E + G +L+RD N I G YVL  +        I+      ++IG+  FD++  LL+ ++   +  + L  PA +   +V+  +        +L     + +  V K +++       +  IG +PV  ++Q  +       DK     S    VF+       +  ++P      + R PN +DK+ L +++GD + V     NG  + +   GK+G  PF  V   D
Sbjct:   12 WYFGPMSRQDATEVLMNERERGVFLVRDSNSIAGDYVLCDQ--------IV------YRIGDQSFDNLPKLLTFYTLHYLDTTPLKRPACRRVEKVIGKFDFVGSDQDDLPFQRGEVLTIVRKDEDQWWTARNSSGKIGQIPVPYIQQYDDYMDEDAIDKNEPSISGSSNVFESTLKRTDLNRKLPAYARVKQSRVPNAYDKTALKLEIGDIIKVTKTNINGQWEGELN-GKNGHFPFTHVEFVD 241          
BLAST of Potassium channel tetramerization domain containing 1 vs. Ensembl Zebrafish
Match: crk (v-crk avian sarcoma virus CT10 oncogene homolog [Source:ZFIN;Acc:ZDB-GENE-040801-148])

HSP 1 Score: 71.2478 bits (173), Expect = 1.506e-13
Identity = 71/291 (24.40%), Postives = 119/291 (40.89%), Query Frame = 2
Query:  203 WYFGNLSRDEAQNSIFMEADGTYLIRDCNQILGGYVLLVKEKTQTNKYII----SPYKDG-------WKIGNTEFDSIESLLSHFSKVIIRQSTLTNP------------------AP----KPFYRVLQTYHPKSDIELAVNECQFVRFVLKYDEKILCEHQLTKAIGWLPVNILKQ---------------------SSNDKTSLQQMVFKMQS-------------RVPFKTLAIKDRYPNVFDKSQLSVKVGDSLMVIDVLENGMLQTKNQFGKDGLVPFNIVNIND 874
            WY+G LSR EA + +  +  G +L+RD   I G YVL V E ++ + YII    S  + G       ++IG+ EFD++ +LL  +    +  +TL  P                  AP    + + R L  +    D +L   +   +R + K +E+          +G +PV  +++                      ++D  S Q      +                P    AI+ R PN +DK+ L+++VGD + V  +  NG  + + + GK G  PF  V + D
Sbjct:   13 WYWGRLSRQEAVSLLQGQRHGVFLVRDSITIPGDYVLSVSENSKVSHYIINSISSNRQSGPGLAPPRFRIGDQEFDALPALLEFYKIHYLDTTTLIEPISKSKHSSFISVNAGTGGAPPRLEEEYVRALFDFPGNDDEDLPFRKGDVLRVLEKPEEQWWNAQNSEGRVGMIPVPYVEKYRPASPTSGAPGVSVSGSGAHGNSDGHSTQSPPLLGEPGQYAQPTSLPNLQNGPVYARAIQKRVPNAYDKTALALEVGDMVKVTKINVNGQWEGECK-GKHGHFPFTHVRLLD 302          
BLAST of Potassium channel tetramerization domain containing 1 vs. Ensembl Zebrafish
Match: crk (v-crk avian sarcoma virus CT10 oncogene homolog [Source:ZFIN;Acc:ZDB-GENE-040801-148])

HSP 1 Score: 71.2478 bits (173), Expect = 1.506e-13
Identity = 71/291 (24.40%), Postives = 119/291 (40.89%), Query Frame = 2
Query:  203 WYFGNLSRDEAQNSIFMEADGTYLIRDCNQILGGYVLLVKEKTQTNKYII----SPYKDG-------WKIGNTEFDSIESLLSHFSKVIIRQSTLTNP------------------AP----KPFYRVLQTYHPKSDIELAVNECQFVRFVLKYDEKILCEHQLTKAIGWLPVNILKQ---------------------SSNDKTSLQQMVFKMQS-------------RVPFKTLAIKDRYPNVFDKSQLSVKVGDSLMVIDVLENGMLQTKNQFGKDGLVPFNIVNIND 874
            WY+G LSR EA + +  +  G +L+RD   I G YVL V E ++ + YII    S  + G       ++IG+ EFD++ +LL  +    +  +TL  P                  AP    + + R L  +    D +L   +   +R + K +E+          +G +PV  +++                      ++D  S Q      +                P    AI+ R PN +DK+ L+++VGD + V  +  NG  + + + GK G  PF  V + D
Sbjct:   13 WYWGRLSRQEAVSLLQGQRHGVFLVRDSITIPGDYVLSVSENSKVSHYIINSISSNRQSGPGLAPPRFRIGDQEFDALPALLEFYKIHYLDTTTLIEPISKSKHSSFISVNAGTGGAPPRLEEEYVRALFDFPGNDDEDLPFRKGDVLRVLEKPEEQWWNAQNSEGRVGMIPVPYVEKYRPASPTSGAPGVSVSGSGAHGNSDGHSTQSPPLLGEPGQYAQPTSLPNLQNGPVYARAIQKRVPNAYDKTALALEVGDMVKVTKINVNGQWEGECK-GKHGHFPFTHVRLLD 302          
BLAST of Potassium channel tetramerization domain containing 1 vs. Ensembl Zebrafish
Match: crk (v-crk avian sarcoma virus CT10 oncogene homolog [Source:ZFIN;Acc:ZDB-GENE-040801-148])

HSP 1 Score: 71.2478 bits (173), Expect = 1.506e-13
Identity = 71/291 (24.40%), Postives = 119/291 (40.89%), Query Frame = 2
Query:  203 WYFGNLSRDEAQNSIFMEADGTYLIRDCNQILGGYVLLVKEKTQTNKYII----SPYKDG-------WKIGNTEFDSIESLLSHFSKVIIRQSTLTNP------------------AP----KPFYRVLQTYHPKSDIELAVNECQFVRFVLKYDEKILCEHQLTKAIGWLPVNILKQ---------------------SSNDKTSLQQMVFKMQS-------------RVPFKTLAIKDRYPNVFDKSQLSVKVGDSLMVIDVLENGMLQTKNQFGKDGLVPFNIVNIND 874
            WY+G LSR EA + +  +  G +L+RD   I G YVL V E ++ + YII    S  + G       ++IG+ EFD++ +LL  +    +  +TL  P                  AP    + + R L  +    D +L   +   +R + K +E+          +G +PV  +++                      ++D  S Q      +                P    AI+ R PN +DK+ L+++VGD + V  +  NG  + + + GK G  PF  V + D
Sbjct:   13 WYWGRLSRQEAVSLLQGQRHGVFLVRDSITIPGDYVLSVSENSKVSHYIINSISSNRQSGPGLAPPRFRIGDQEFDALPALLEFYKIHYLDTTTLIEPISKSKHSSFISVNAGTGGAPPRLEEEYVRALFDFPGNDDEDLPFRKGDVLRVLEKPEEQWWNAQNSEGRVGMIPVPYVEKYRPASPTSGAPGVSVSGSGAHGNSDGHSTQSPPLLGEPGQYAQPTSLPNLQNGPVYARAIQKRVPNAYDKTALALEVGDMVKVTKINVNGQWEGECK-GKHGHFPFTHVRLLD 302          
BLAST of Potassium channel tetramerization domain containing 1 vs. Ensembl Zebrafish
Match: crkl (v-crk avian sarcoma virus CT10 oncogene homolog-like [Source:ZFIN;Acc:ZDB-GENE-040426-2951])

HSP 1 Score: 71.2478 bits (173), Expect = 1.571e-13
Identity = 38/92 (41.30%), Postives = 56/92 (60.87%), Query Frame = 2
Query:  203 WYFGNLSRDEAQNSIFMEADGTYLIRDCNQILGGYVLLVKEKTQTNKYIIS--PYKDGWKIGNTEFDSIESLLSHFSKVIIRQSTLTNPAPK 472
            WYFG +SR EAQN +  +  G +L+RD +   G YVL V E ++ + YII+  P K  +KIG+ EFD++  LL  +    +  +TL  PAP+
Sbjct:   14 WYFGPVSRQEAQNRLQGQRHGMFLVRDSSTCPGDYVLSVSENSKVSHYIINSLPSKR-FKIGDQEFDNLPGLLEFYKIHYLDTTTLIEPAPR 104          
BLAST of Potassium channel tetramerization domain containing 1 vs. Ensembl Zebrafish
Match: pik3r1 (phosphoinositide-3-kinase, regulatory subunit 1 (alpha) [Source:ZFIN;Acc:ZDB-GENE-030131-1280])

HSP 1 Score: 50.8322 bits (120), Expect = 1.408e-6
Identity = 31/94 (32.98%), Postives = 51/94 (54.26%), Query Frame = 2
Query:  200 DWYFGNLSRDEAQNSIFMEADGTYLIRDCNQILGGYVLLVKEKTQTNKYIISPYKDGWKIGNTE---FDSIESLLSHFSKVIIRQSTLTNPAPK 472
            +WY+G++SR+E    +   ADGT+L+RD +  + G   L   K   NK I   ++DG K G ++   F+S+  L++H+     R  +L    PK
Sbjct:   55 EWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKLIKIFHRDG-KYGFSDPLTFNSVVELINHY-----RTESLAQYNPK 142          
BLAST of Potassium channel tetramerization domain containing 1 vs. Ensembl Xenopus
Match: kctd1 (potassium channel tetramerization domain containing 1 [Source:Xenbase;Acc:XB-GENE-6076050])

HSP 1 Score: 77.7962 bits (190), Expect = 1.015e-15
Identity = 74/284 (26.06%), Postives = 125/284 (44.01%), Query Frame = 2
Query:  203 WYFGNLSRDEAQNSIFMEADGTYLIRDCNQILGGYVLLVKEKTQTNKYIIS--PYKDGWKIGNTEFDSIESLLSHFSKVIIRQSTLTNPAPK---------------------PFYRVLQTYHPKSDIE-LAVNECQFVRFVLKYDEKILCEHQLTKAIGWLPVNILK-------------QSSND---------------------KTSLQQMVFKMQS--RVPFKTLAIKDRYPNVFDKSQLSVKVGDSLMVIDVLENGMLQTKNQFGKDGLVPFNIVNIND 874
            WYFG +SR EAQ+ +  +  G +L+RD +   G +VL V E ++ + YII+  P +  +KIG+ EFD++ +LL  +    +  +TL  PAP+                      + R L  + P +D E L   + + +  V K +E+          IG +PV  ++             ++SN                       ++   ++  +QS    P    AI+ R P  +DK+ L+++VGD + V  +  NG  + +   G+ GL PF  V I D
Sbjct:   14 WYFGPVSRQEAQSRLQGQRHGVFLVRDSSTCPGDHVLSVSENSRVSHYIINSLPGRR-YKIGDQEFDNLPALLDFYKIHYLDTTTLIEPAPRYPSPPVGTGTAPSVPVPEENLEYVRTLYDF-PGNDAEDLPFKKGEILVIVEKPEEQWWSARNKDGRIGMIPVPYVEKLSRLSLHGKMGNRNSNSYGIPEPAHAYAQPQTPSPLPASSTPPAVINPLQSTQNGPVYAKAIQKRVPCAYDKTALALEVGDLVKVTRMNINGQWEGEVN-GRKGLFPFTHVKIID 294          
BLAST of Potassium channel tetramerization domain containing 1 vs. Ensembl Xenopus
Match: mvb12b (multivesicular body subunit 12B [Source:Xenbase;Acc:XB-GENE-945521])

HSP 1 Score: 73.1738 bits (178), Expect = 3.845e-14
Identity = 66/276 (23.91%), Postives = 112/276 (40.58%), Query Frame = 2
Query:  203 WYFGNLSRDEAQNSIFMEADGTYLIRDCNQILGGYVLLVKEKTQTNKYIISPYKDG-----------WKIGNTEFDSIESLLSHFSKVIIRQSTLTNPAPKP-------------FYRVLQTYHPKSDIELAVNECQFVRFVLKYDEKILCEHQLTKAIGWLPVNILKQSSNDKTSLQQMVFKMQSRV----------------------------PFKTLAIKDRYPNVFDKSQLSVKVGDSLMVIDVLENGMLQTKNQFGKDGLVPFNIVNIND 874
            WY+G L+R EA N +  +  G +L+RD   I G YVL V E ++ + YII+   +            ++IG+ EFDS+ SLL  +    +  +TL  P  K              + R L  ++   D +L   +   +R   K +E+           G +PV  +++     ++   ++   Q                               P     I+ R PN +DK+ L+++VGD + V  +  +G  + +   GK G  PF  V + D
Sbjct:   13 WYWGKLNRQEAVNLLQGQRHGVFLVRDSTTIPGDYVLSVSENSKVSHYIINSVSNNRQSGTGMIQSRFRIGDQEFDSLPSLLEFYKIHYLDTTTLIEPVSKSKQSGVIQRQEEVEYVRALFDFNGNDDEDLPFKKGDILRIRDKPEEQWWNAEDNDGRRGMIPVPYVEKYRPPSSAGSALIGGNQENSHPQPLGGPEPGPYAQPSVNTPLPNLQNGPIFARVIQKRVPNAYDKTALALEVGDLVKVTKINVSGQWEGECN-GKYGHFPFTHVRLLD 287          
BLAST of Potassium channel tetramerization domain containing 1 vs. Ensembl Xenopus
Match: mvb12b (multivesicular body subunit 12B [Source:Xenbase;Acc:XB-GENE-945521])

HSP 1 Score: 72.7886 bits (177), Expect = 6.070e-14
Identity = 69/277 (24.91%), Postives = 114/277 (41.16%), Query Frame = 2
Query:  203 WYFGNLSRDEAQNSIFMEADGTYLIRDCNQILGGYVLLVKEKTQTNKYIISPYKDG------------WKIGNTEFDSIESLLSHFSKVIIRQSTLTNPAPKP-------------FYRVLQTYHPKSDIELAVNECQFVRFVLKYDEKILCEHQLTKAIGWLPVNILKQ------------SSNDKTSLQQMVFKMQS--------RVPFKTL--------AIKDRYPNVFDKSQLSVKVGDSLMVIDVLENGMLQTKNQFGKDGLVPFNIVNIND 874
            WY+G L+R EA N +  +  G +L+RD   I G YVL V E ++ + YII+   +             ++IG+ EFDS+ SLL  +    +  +TL  P  K              + R L  ++   D +L   +   +R   K +E+           G +PV  +++              N + S  Q +   +           P   L         I+ R PN +DK+ L+++VGD + V  +  +G  + +   GK G  PF  V + D
Sbjct:   13 WYWGKLNRQEAVNLLQGQRHGVFLVRDSTTIPGDYVLSVSENSKVSHYIINSVSNNRQSGTEPAPSSRFRIGDQEFDSLPSLLEFYKIHYLDTTTLIEPVSKSKQSGVIQRQEEVEYVRALFDFNGNDDEDLPFKKGDILRIRDKPEEQWWNAEDNDGRRGMIPVPYVEKYRPPSSAGSALIGGNQENSHPQPLGGPEPGPYAQPSVNTPLPNLQNGPIFARVIQKRVPNAYDKTALALEVGDLVKVTKINVSGQWEGECN-GKYGHFPFTHVRLLD 288          
BLAST of Potassium channel tetramerization domain containing 1 vs. Ensembl Xenopus
Match: PIK3R1 (phosphoinositide-3-kinase regulatory subunit 1 [Source:NCBI gene;Acc:100486835])

HSP 1 Score: 53.5286 bits (127), Expect = 2.761e-7
Identity = 35/115 (30.43%), Postives = 59/115 (51.30%), Query Frame = 2
Query:  152 PKEYSILRNLMQNHV-----KDWYFGNLSRDEAQNSIFMEADGTYLIRDCNQILGGYVLLVKEKTQTNKYIISPYKDGWKIGNTE---FDSIESLLSHFSKVIIRQSTLTNPAPK 472
            P + + + N   NH+      +WY+G++SR+E    +    DGT+L+RD + I+ G   L   K   NK I   ++DG K G ++   F+S+  L++H+     R  +L    PK
Sbjct:   51 PPKSTAVTNNGTNHIMSLQDAEWYWGDISREEVNEKLRDTTDGTFLVRDASTIMHGDYTLTLRKGGNNKLIKIFHRDG-KYGFSDPLTFNSVVELITHY-----RNESLAQYNPK 159          
BLAST of Potassium channel tetramerization domain containing 1 vs. Ensembl Xenopus
Match: PIK3R1 (phosphoinositide-3-kinase regulatory subunit 1 [Source:NCBI gene;Acc:100486835])

HSP 1 Score: 53.1434 bits (126), Expect = 3.139e-7
Identity = 35/115 (30.43%), Postives = 59/115 (51.30%), Query Frame = 2
Query:  152 PKEYSILRNLMQNHV-----KDWYFGNLSRDEAQNSIFMEADGTYLIRDCNQILGGYVLLVKEKTQTNKYIISPYKDGWKIGNTE---FDSIESLLSHFSKVIIRQSTLTNPAPK 472
            P + + + N   NH+      +WY+G++SR+E    +    DGT+L+RD + I+ G   L   K   NK I   ++DG K G ++   F+S+  L++H+     R  +L    PK
Sbjct:   41 PPKSTAVTNNGTNHIMSLQDAEWYWGDISREEVNEKLRDTTDGTFLVRDASTIMHGDYTLTLRKGGNNKLIKIFHRDG-KYGFSDPLTFNSVVELITHY-----RNESLAQYNPK 149          
BLAST of Potassium channel tetramerization domain containing 1 vs. Ensembl Mouse
Match: Crkl (v-crk avian sarcoma virus CT10 oncogene homolog-like [Source:MGI Symbol;Acc:MGI:104686])

HSP 1 Score: 76.6406 bits (187), Expect = 2.550e-15
Identity = 70/284 (24.65%), Postives = 119/284 (41.90%), Query Frame = 2
Query:  203 WYFGNLSRDEAQNSIFMEADGTYLIRDCNQILGGYVLLVKEKTQTNKYIISPYKD-GWKIGNTEFDSIESLLSHFSKVIIRQSTLTNPAPK---------------------PFYRVLQTYHPKSDIE-LAVNECQFVRFVLKYDEKILCEHQLTKAIGWLPV----NILKQSSNDK-----------TSLQQMVFKMQSRVPFKTL----------------------AIKDRYPNVFDKSQLSVKVGDSLMVIDVLENGMLQTKNQFGKDGLVPFNIVNIND 874
            WY G ++R EAQ  +  +  G +L+RD +   G YVL V E ++ + YII+   +  +KIG+ EFD + +LL  +    +  +TL  PAP+                      + R L  + P +D E L   + + +  + K +E+          +G +PV     +++ S + K                   + Q+  P  T+                      AI+ R P  +DK+ L+++VGD + V  +  NG  + +   G+ GL PF  V I D
Sbjct:   14 WYMGPVTRQEAQTRLQGQRHGMFLVRDSSTCPGDYVLSVSENSRVSHYIINSLPNRRFKIGDQEFDHLPALLEFYKIHYLDTTTLIEPAPRYPSPPVGSVSAPNLPTAEENLEYVRTLYDF-PGNDAEDLPFKKGELLVIIEKPEEQWWSARNKDGRVGMIPVPYVEKLVRSSPHGKHGNRNSNSYGIPEPAHAYAQPQTTTPLPTVASTPGAAINPLPSTQNGPVFAKAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVN-GRKGLFPFTHVKIFD 295          
BLAST of Potassium channel tetramerization domain containing 1 vs. Ensembl Mouse
Match: Crkl (v-crk avian sarcoma virus CT10 oncogene homolog-like [Source:MGI Symbol;Acc:MGI:104686])

HSP 1 Score: 65.0846 bits (157), Expect = 7.863e-13
Identity = 33/91 (36.26%), Postives = 53/91 (58.24%), Query Frame = 2
Query:  203 WYFGNLSRDEAQNSIFMEADGTYLIRDCNQILGGYVLLVKEKTQTNKYIISPYKD-GWKIGNTEFDSIESLLSHFSKVIIRQSTLTNPAPK 472
            WY G ++R EAQ  +  +  G +L+RD +   G YVL V E ++ + YII+   +  +KIG+ EFD + +LL  +    +  +TL  PAP+
Sbjct:   14 WYMGPVTRQEAQTRLQGQRHGMFLVRDSSTCPGDYVLSVSENSRVSHYIINSLPNRRFKIGDQEFDHLPALLEFYKIHYLDTTTLIEPAPR 104          
BLAST of Potassium channel tetramerization domain containing 1 vs. Ensembl Mouse
Match: Crkl (v-crk avian sarcoma virus CT10 oncogene homolog-like [Source:MGI Symbol;Acc:MGI:104686])

HSP 1 Score: 65.855 bits (159), Expect = 1.314e-12
Identity = 33/91 (36.26%), Postives = 53/91 (58.24%), Query Frame = 2
Query:  203 WYFGNLSRDEAQNSIFMEADGTYLIRDCNQILGGYVLLVKEKTQTNKYIISPYKD-GWKIGNTEFDSIESLLSHFSKVIIRQSTLTNPAPK 472
            WY G ++R EAQ  +  +  G +L+RD +   G YVL V E ++ + YII+   +  +KIG+ EFD + +LL  +    +  +TL  PAP+
Sbjct:   14 WYMGPVTRQEAQTRLQGQRHGMFLVRDSSTCPGDYVLSVSENSRVSHYIINSLPNRRFKIGDQEFDHLPALLEFYKIHYLDTTTLIEPAPR 104          
BLAST of Potassium channel tetramerization domain containing 1 vs. Ensembl Mouse
Match: Crk (v-crk avian sarcoma virus CT10 oncogene homolog [Source:MGI Symbol;Acc:MGI:88508])

HSP 1 Score: 65.0846 bits (157), Expect = 2.028e-11
Identity = 64/286 (22.38%), Postives = 111/286 (38.81%), Query Frame = 2
Query:  203 WYFGNLSRDEAQNSIFMEADGTYLIRDCNQILGGYVLLVKEKTQTNKYII--------------------SPYKDGWKIGNTEFDSIESLLSHFSKVIIRQSTLTNPAPKP--------------FYRVLQTYHPKSDIELAVNECQFVRFVLKYDEKILCEHQLTKAIGWLPVNILKQSSNDKTSLQQMVFKMQS----------------------------RVPFKTLAIKDRYPNVFDKSQLSVKVGDSLMVIDVLENGMLQTKNQFGKDGLVPFNIVNIND 874
            WY+G LSR EA   +  +  G +L+RD +   G YVL V E ++ + YII                    SP +   +IG+ EFDS+ +LL  +    +  +TL  P  +               + R L  ++   + +L   +   +R   K +E+           G +PV  +++      S+  ++   Q                               P     I+ R PN +DK+ L+++VG+ + V  +  +G  + +   GK G  PF  V + D
Sbjct:   13 WYWGRLSRQEAVALLQGQRHGVFLVRDSSTSPGDYVLSVSENSRVSHYIINSSGPRPPVPPSPAQPPPGVSPSR--LRIGDQEFDSLPALLEFYKIHYLDTTTLIEPVARSRQGSGVILRQEEAEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKYRPASASVSALIGGNQEGSHPQPLGGPEPGPYAQPSVNTPLPNLQNGPIYARVIQKRVPNAYDKTALALEVGELVKVTKINVSGQWEGECN-GKRGHFPFTHVRLLD 295          
BLAST of Potassium channel tetramerization domain containing 1 vs. Ensembl Mouse
Match: Crk (v-crk avian sarcoma virus CT10 oncogene homolog [Source:MGI Symbol;Acc:MGI:88508])

HSP 1 Score: 53.9138 bits (128), Expect = 3.984e-8
Identity = 40/151 (26.49%), Postives = 64/151 (42.38%), Query Frame = 2
Query:  176 NLMQNHVKDWYFGNLSRDEAQNSIFMEADGTYLIRDCNQILGGYVLLVKEKTQTNKYII--------------------SPYKDGWKIGNTEFDSIESLLSHFSKVIIRQSTLTNPAPKPFYRVLQTYHPKSDIELAVNECQFVRFVLKYD 568
            N        WY+G LSR EA   +  +  G +L+RD +   G YVL V E ++ + YII                    SP +   +IG+ EFDS+ +LL  +    +  +TL  P  +            S + L   E ++VR +  ++
Sbjct:    4 NFDSEERSSWYWGRLSRQEAVALLQGQRHGVFLVRDSSTSPGDYVLSVSENSRVSHYIINSSGPRPPVPPSPAQPPPGVSPSR--LRIGDQEFDSLPALLEFYKIHYLDTTTLIEPVARS--------RQGSGVILRQEEAEYVRALFDFN 144          
BLAST of Potassium channel tetramerization domain containing 1 vs. UniProt/SwissProt
Match: sp|Q9XYM0|CRK_DROME (Adapter molecule Crk OS=Drosophila melanogaster OX=7227 GN=Crk PE=1 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 3.485e-17
Identity = 66/249 (26.51%), Postives = 116/249 (46.59%), Query Frame = 2
Query:  203 WYFGNLSRDEAQNSIFMEAD-GTYLIRDCNQILGGYVLLVKEKTQTNKYIISPYKDG----WKIGNTEFDSIESLLSHFSKVIIRQSTLTNPAPKPFYRVLQTYH--PKSDIELAVNECQFVRFVLKYDEKILCEHQLTKAIGWLPVNILKQSSN-------DKT----SLQQMVFK-------MQSRVPFKTLAIKDRYPNVFDKSQLSVKVGDSLMVIDVLENGMLQTKNQFGKDGLVPFNIVNIND 874
            WYFG +SR +A   +  E + G +L+RD N I G YVL V+E T+ + YII+  +      ++IG+  FD++  LL+ ++   +  + L  PA +   +V+  +        +L     + +  V K +++       +  IG +PV  ++Q  +       DK     S    VF+       +  ++P      + R PN +DK+ L +++GD + V     NG  + +   GK+G  PF  V   D
Sbjct:   12 WYFGPMSRQDATEVLMNERERGVFLVRDSNSIAGDYVLCVREDTKVSNYIINKVQQQDQIVYRIGDQSFDNLPKLLTFYTLHYLDTTPLKRPACRRVEKVIGKFDFVGSDQDDLPFQRGEVLTIVRKDEDQWWTARNSSGKIGQIPVPYIQQYDDYMDEDAIDKNEPSISGSSNVFESTLKRTDLNRKLPAYARVKQSRVPNAYDKTALKLEIGDIIKVTKTNINGQWEGELN-GKNGHFPFTHVEFVD 259          
BLAST of Potassium channel tetramerization domain containing 1 vs. UniProt/SwissProt
Match: sp|Q5U2U2|CRKL_RAT (Crk-like protein OS=Rattus norvegicus OX=10116 GN=Crkl PE=1 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 6.588e-15
Identity = 71/284 (25.00%), Postives = 119/284 (41.90%), Query Frame = 2
Query:  203 WYFGNLSRDEAQNSIFMEADGTYLIRDCNQILGGYVLLVKEKTQTNKYIISPYKD-GWKIGNTEFDSIESLLSHFSKVIIRQSTLTNPAPK---------------------PFYRVLQTYHPKSDIE-LAVNECQFVRFVLKYDEKILCEHQLTKAIGWLPV----NILKQSSNDK-----------TSLQQMVFKMQSRVPFKTL----------------------AIKDRYPNVFDKSQLSVKVGDSLMVIDVLENGMLQTKNQFGKDGLVPFNIVNIND 874
            WY G +SR EAQ  +  +  G +L+RD +   G YVL V E ++ + YII+   +  +KIG+ EFD + +LL  +    +  +TL  PAP+                      + R L  + P +D E L   + + +  + K +E+          +G +PV     +++ S + K                   + Q+  P  T+                      AI+ R P  +DK+ L+++VGD + V  +  NG  + +   G+ GL PF  V I D
Sbjct:   14 WYMGPVSRQEAQTRLQGQRHGMFLVRDSSTCPGDYVLSVSENSRVSHYIINSLPNRRFKIGDQEFDHLPALLEFYKIHYLDTTTLIEPAPRYPNPPMGSVSAPNLSTAEENLEYVRTLYDF-PGNDAEDLPFKKGELLVIIEKPEEQWWSARNKDGRVGMIPVPYVEKLVRSSPHGKHGNRNSNSYGIPEPAHAYAQPQTTTPLPTVASTPGAAINPLPSTQNGPVFAKAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVN-GRKGLFPFTHVKIFD 295          
BLAST of Potassium channel tetramerization domain containing 1 vs. UniProt/SwissProt
Match: sp|P47941|CRKL_MOUSE (Crk-like protein OS=Mus musculus OX=10090 GN=Crkl PE=1 SV=2)

HSP 1 Score: 76.6406 bits (187), Expect = 1.783e-14
Identity = 70/284 (24.65%), Postives = 119/284 (41.90%), Query Frame = 2
Query:  203 WYFGNLSRDEAQNSIFMEADGTYLIRDCNQILGGYVLLVKEKTQTNKYIISPYKD-GWKIGNTEFDSIESLLSHFSKVIIRQSTLTNPAPK---------------------PFYRVLQTYHPKSDIE-LAVNECQFVRFVLKYDEKILCEHQLTKAIGWLPV----NILKQSSNDK-----------TSLQQMVFKMQSRVPFKTL----------------------AIKDRYPNVFDKSQLSVKVGDSLMVIDVLENGMLQTKNQFGKDGLVPFNIVNIND 874
            WY G ++R EAQ  +  +  G +L+RD +   G YVL V E ++ + YII+   +  +KIG+ EFD + +LL  +    +  +TL  PAP+                      + R L  + P +D E L   + + +  + K +E+          +G +PV     +++ S + K                   + Q+  P  T+                      AI+ R P  +DK+ L+++VGD + V  +  NG  + +   G+ GL PF  V I D
Sbjct:   14 WYMGPVTRQEAQTRLQGQRHGMFLVRDSSTCPGDYVLSVSENSRVSHYIINSLPNRRFKIGDQEFDHLPALLEFYKIHYLDTTTLIEPAPRYPSPPVGSVSAPNLPTAEENLEYVRTLYDF-PGNDAEDLPFKKGELLVIIEKPEEQWWSARNKDGRVGMIPVPYVEKLVRSSPHGKHGNRNSNSYGIPEPAHAYAQPQTTTPLPTVASTPGAAINPLPSTQNGPVFAKAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVN-GRKGLFPFTHVKIFD 295          
BLAST of Potassium channel tetramerization domain containing 1 vs. UniProt/SwissProt
Match: sp|P46109|CRKL_HUMAN (Crk-like protein OS=Homo sapiens OX=9606 GN=CRKL PE=1 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 3.650e-14
Identity = 70/284 (24.65%), Postives = 118/284 (41.55%), Query Frame = 2
Query:  203 WYFGNLSRDEAQNSIFMEADGTYLIRDCNQILGGYVLLVKEKTQTNKYIISPYKD-GWKIGNTEFDSIESLLSHFSKVIIRQSTLTNPAPK---------------------PFYRVLQTYHPKSDIE-LAVNECQFVRFVLKYDEKILCEHQLTKAIGWLPV----NILKQSSNDK-----------TSLQQMVFKMQSRVPFKTL----------------------AIKDRYPNVFDKSQLSVKVGDSLMVIDVLENGMLQTKNQFGKDGLVPFNIVNIND 874
            WY G +SR EAQ  +  +  G +L+RD +   G YVL V E ++ + YII+   +  +KIG+ EFD + +LL  +    +  +TL  PAP+                      + R L  + P +D E L   + + +  + K +E+          +G +PV     +++ S + K                   + Q+  P   +                      AI+ R P  +DK+ L+++VGD + V  +  NG  + +   G+ GL PF  V I D
Sbjct:   14 WYMGPVSRQEAQTRLQGQRHGMFLVRDSSTCPGDYVLSVSENSRVSHYIINSLPNRRFKIGDQEFDHLPALLEFYKIHYLDTTTLIEPAPRYPSPPMGSVSAPNLPTAEDNLEYVRTLYDF-PGNDAEDLPFKKGEILVIIEKPEEQWWSARNKDGRVGMIPVPYVEKLVRSSPHGKHGNRNSNSYGIPEPAHAYAQPQTTTPLPAVSGSPGAAITPLPSTQNGPVFAKAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVN-GRKGLFPFTHVKIFD 295          
BLAST of Potassium channel tetramerization domain containing 1 vs. UniProt/SwissProt
Match: sp|Q9NHC3|CED2_CAEEL (Cell death abnormality protein 2 OS=Caenorhabditis elegans OX=6239 GN=ced-2 PE=1 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 1.974e-13
Identity = 67/260 (25.77%), Postives = 116/260 (44.62%), Query Frame = 2
Query:  197 KDWYFGNLSRDEAQNSIFMEAD---GTYLIRDCNQILGGYVLLVKEKTQTNK---YIIS---PYKDGW-----KIGNTEFDSIESLLSHFSKVIIRQSTLTNPAPKPFYRVLQ---TYHPKSDIELAVNECQFVRFVLKYDEKILCEHQLTKAIGWLPVNILK---QSSNDKTSLQQMV----------------------FKMQSRVPFKTLAIKDRYPNVFDKSQLSVKVGDSLMVIDVLENGMLQTKNQFGKDGLVP 850
            + +YF  +SR+EA + +  E     GT+L+RD ++  G Y L V+E  + N    Y+I    P +DG      KI N  F  I +LL+HF   ++ +++L     KP   V+     +  + + +L   + + +  + K ++            G +P N ++   +  ND+TS                            ++Q R+P K     DR PN +D +QL VK G +++V   + NGM + +   G+ G VP
Sbjct:   12 RSFYFPGMSREEA-HKLLGEPQVSIGTFLMRDSSRP-GEYSLTVREADEGNAVCHYLIERGEPKEDGTAAAGVKIANQSFPDIPALLNHFKMRVLTEASLLAAYKKPIIEVVVGTFKFTGERETDLPFEQGERLEILSKTNQDWWEARNALGTTGLVPANYVQIQMEFHNDRTSKGASQSSIGSSGGGAERFSSASTSSDNIELQPRLPAKAKVTFDRVPNAYDPTQLRVKKGQTVLVTQKMSNGMYKAELD-GQIGSVP 268          
BLAST of Potassium channel tetramerization domain containing 1 vs. TrEMBL
Match: A0A267E300 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig006820g3 PE=4 SV=1)

HSP 1 Score: 117.087 bits (292), Expect = 1.454e-26
Identity = 88/245 (35.92%), Postives = 127/245 (51.84%), Query Frame = 2
Query:  194 VKDWYFGNLSRDEAQNSIFMEADGTYLIRDCNQILGGYVLLVKEKTQTNKY--IISPYK--DGWK--IGNTEFDSIESLLSHFSKVIIRQSTLTNPAPKPFYRVLQTYHPKSD---IELAVNEC-QFVRFVLKYDEKILCE--HQL---TKAIGWLPVNILKQSSNDKTSLQQMVFKMQSRVPFKTLAIKDRYPNVFDKSQLSVKVGDSLMVIDVLENGM-------LQTKNQFGKDGLVPFNIV 862
             +DWYFG+++R++A   +     G YL+R      G +VL V++  QTN Y  ++ P K  DG+K  IG TEF  I+ +L+++ K  +  STLT PAP+P YRV   Y P SD   I L  NEC  F+    K D     E  H L   T  +G +P + L+Q SN      +    +Q  +PF    ++ R PN+FD SQL ++ GD + V  +  N         L+TK     +G+ PFN V
Sbjct:   13 TEDWYFGSINREQANEILLSGQVGMYLVRASKTERGSFVLSVRDTQQTNHYKIVVLPRKNSDGFKFRIGPTEFLFIQDILNYYKKNKLVDSTLTVPAPRPVYRVKIDYRPDSDASAIGLRRNECVLFLDVATKPDGAEDAEWWHVLKKNTGEVGCVPKSCLRQ-SNPGGEDGKFAVLLQLNLPFDVEVVRPRNPNIFDPSQLRMEPGDHIRVKKMDPNSPELWYGVNLRTK----AEGVFPFNYV 252          
BLAST of Potassium channel tetramerization domain containing 1 vs. TrEMBL
Match: A0A267FM75 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig028588g1 PE=4 SV=1)

HSP 1 Score: 116.701 bits (291), Expect = 1.611e-26
Identity = 88/245 (35.92%), Postives = 127/245 (51.84%), Query Frame = 2
Query:  194 VKDWYFGNLSRDEAQNSIFMEADGTYLIRDCNQILGGYVLLVKEKTQTNKY--IISPYK--DGWK--IGNTEFDSIESLLSHFSKVIIRQSTLTNPAPKPFYRVLQTYHPKSD---IELAVNEC-QFVRFVLKYDEKILCE--HQL---TKAIGWLPVNILKQSSNDKTSLQQMVFKMQSRVPFKTLAIKDRYPNVFDKSQLSVKVGDSLMVIDVLENGM-------LQTKNQFGKDGLVPFNIV 862
             +DWYFG+++R++A   +     G YL+R      G +VL V++  QTN Y  ++ P K  DG+K  IG TEF  I+ +L+++ K  +  STLT PAP+P YRV   Y P SD   I L  NEC  F+    K D     E  H L   T  +G +P + L+Q SN      +    +Q  +PF    ++ R PN+FD SQL ++ GD + V  +  N         L+TK     +G+ PFN V
Sbjct:   13 TEDWYFGSINREQANEILLSGQVGMYLVRASKTERGSFVLSVRDTQQTNHYKIVVLPRKNSDGFKFRIGPTEFLFIQDILNYYKKNKLVDSTLTVPAPRPVYRVKIDYRPDSDASAIGLRRNECVLFLDVATKPDGAEDAEWWHVLKKNTGEVGCVPKSCLRQ-SNPGGEDGKFAVLLQLNLPFDVEVVRPRNPNIFDTSQLRMEPGDHIRVKKMDPNSPELWYGVNLRTK----AEGVFPFNYV 252          
BLAST of Potassium channel tetramerization domain containing 1 vs. TrEMBL
Match: A0A504Z2Q1 (Adapter molecule Crk OS=Fasciola gigantica OX=46835 GN=FGIG_03137 PE=4 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 1.403e-25
Identity = 66/236 (27.97%), Postives = 117/236 (49.58%), Query Frame = 2
Query:  203 WYFGNLSRDEAQNSIFMEADGTYLIRDCNQILGGYVLLVKEKTQTNKYIIS--PYKDGWKIGNTEFDSIESLLSHFSKVIIRQSTLTNPAPKPFYRVLQTYHPKSDIELAVNECQFVRFVLKYDEKILCEHQLTKAIGWLPVNILK----------QSSNDKTSLQQMVFKMQSRVPFKTLAIKDRYPNVFDKSQLSVKVGDSLMVIDVLENGMLQT-KNQFGKDGLVPFNIVNIN 871
            WYFG +SR++    +  +  GT+L+RD +    GY L VKE     +Y+IS  P+   ++ G++ +DS + L+  +++       L  PAPK  Y  L  Y  + + +L+ N    + F+ +  + + C+ + T  +GW+P+N L           +   D+ SL         ++P     I+DR P++F    L V+VGD + +  +L +G  +  + Q    GLVP N + I+
Sbjct:   11 WYFGEISREKTNEILVDQPVGTFLVRD-STTKSGYALAVKEANGVKRYLISYIPHSKKFRFGDSLYDSFDDLIRQYTETKTSACRLKQPAPKAVYIGLHNYISQEESDLSFNRGDILHFIRQKKDWVFCKSE-TDRVGWVPLNYLVPFTPELASRLRGHTDQASLSHCRKADFVKLPAPGKVIRDRNPSIFLNGHLKVQVGDEVKINKILSDGFCEVLREQDHLSGLVPINCLEIH 244          
BLAST of Potassium channel tetramerization domain containing 1 vs. TrEMBL
Match: A0A4E0RD41 (Adapter molecule Crk OS=Fasciola hepatica OX=6192 GN=D915_003771 PE=4 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 1.403e-25
Identity = 66/236 (27.97%), Postives = 117/236 (49.58%), Query Frame = 2
Query:  203 WYFGNLSRDEAQNSIFMEADGTYLIRDCNQILGGYVLLVKEKTQTNKYIIS--PYKDGWKIGNTEFDSIESLLSHFSKVIIRQSTLTNPAPKPFYRVLQTYHPKSDIELAVNECQFVRFVLKYDEKILCEHQLTKAIGWLPVNILK----------QSSNDKTSLQQMVFKMQSRVPFKTLAIKDRYPNVFDKSQLSVKVGDSLMVIDVLENGMLQT-KNQFGKDGLVPFNIVNIN 871
            WYFG +SR++    +  +  GT+L+RD +    GY L VKE     +Y+IS  P+   ++ G++ +DS + L+  +++       L  PAPK  Y  L  Y  + + +L+ N    + F+ +  + + C+ + T  +GW+P+N L           +   D+ SL         ++P     I+DR P++F    L V+VGD + +  +L +G  +  + Q    GLVP N + I+
Sbjct:   11 WYFGEISREKTNEILVDQPVGTFLVRD-STTKSGYALAVKEANGVKRYLISYIPHSKKFRFGDSLYDSFDDLIRQYTETKTSACRLKQPAPKAVYIGLHNYISQEESDLSFNRGDILHFIRQKKDWVFCKSE-TDRVGWVPLNYLVPFTPELASRLRGHTDQASLSHCRKADFVKLPAPGKVIRDRNPSIFLNGHLKVQVGDEVKINKILSDGFCEVLREQDHLSGLVPINCLEIH 244          
BLAST of Potassium channel tetramerization domain containing 1 vs. TrEMBL
Match: A0A1S8WWL6 (SH2 domain protein (Fragment) OS=Opisthorchis viverrini OX=6198 GN=X801_05231 PE=4 SV=1)

HSP 1 Score: 109.768 bits (273), Expect = 1.834e-24
Identity = 70/242 (28.93%), Postives = 123/242 (50.83%), Query Frame = 2
Query:  203 WYFGNLSRDEAQNSIFMEADGTYLIRDCNQILGGYVLLVKEKTQTNKYIIS--PYKDGWKIGNTEFDSIESLLSHF--SKVIIRQSTLTNPAPKPFYRVLQTYHPKSDIELAVNECQFVRFVLKYDEKILCEHQLTKAIGWLPVNILKQ-------------SSNDKTSLQQMVFKMQS-RVPFKTLAIKDRYPNVFDKSQLSVKVGDSLMVIDVLENGMLQTKNQFGKDGLVPFNIVNIND 874
            WYFG LSR++    +  +  GT+L+RD +    G+VL VKE     +++I   P    ++ G + +DS++ L+ H+  SK  +R   LT PAPK  Y  L  +  K D E++ +  + + F+ +  + +LC+ + +  IGW+PVN +++               ND+  +     K +   +P     I+ R P+ F +  L ++VG+ L V  VL++G  +   +    GLVP N + + D
Sbjct:    1 WYFGELSREKTNELLLDQPVGTFLVRD-STTHSGFVLTVKESDGVKRFLIPFMPMSQKFRFGESLYDSLDDLIRHYMNSKSAMR---LTQPAPKDVYLGLYNFQAKDDTEVSFSRAERLYFIRQKGQWMLCKAESSGQIGWVPVNYVQEVGPFSPELHARLSGQNDQACVVSDCRKGKFLSLPKTGKVIRARNPSAFLEGHLKIQVGELLRVYKVLQDGFCEVWREDQVSGLVPINYLELLD 238          
BLAST of Potassium channel tetramerization domain containing 1 vs. Ensembl Cavefish
Match: crk (CRK proto-oncogene, adaptor protein [Source:NCBI gene;Acc:103035530])

HSP 1 Score: 71.633 bits (174), Expect = 1.081e-13
Identity = 71/287 (24.74%), Postives = 118/287 (41.11%), Query Frame = 2
Query:  203 WYFGNLSRDEAQNSIFMEADGTYLIRDCNQILGGYVLLVKEKTQTNKYII----SPYKDG-------WKIGNTEFDSIESLLSHFSKVIIRQSTLTNP----------------APK----PFYRVLQTYHPKSDIELAVNECQFVRFVLKYDEKILCEHQLTKAIGWLPVNILKQ--------------------SSNDKTS------------LQQMVFKMQSRVPFKTLAIKDRYPNVFDKSQLSVKVGDSLMVIDVLENGMLQTKNQFGKDGLVPFNIVNIND 874
            WY+G LSR EA + +  +  G +L+RD     G YVL V E ++ + YII    S  + G       ++IG+ EFD++ +LL  +    +  +TL  P                AP+     + R L  +    D +L   +   +R + K +E+          +G +PV  +++                    +S+   S             Q          P    AI+ R PN +DK+ L+++VGD +MV  +  NG  + + + GK G  PF  V + D
Sbjct:   13 WYWGRLSRQEAVSLLQGQRHGVFLVRDSITSPGDYVLSVSENSKVSHYIINSISSNRQSGPGLTTSRFRIGDQEFDALPALLEFYKIHYLDTTTLIEPINKAKHSSVINISAGGAPQRLEEEYVRALFDFPGNDDEDLPFRKGDVLRVLEKPEEQWWNAQNSEGRVGMIPVPYVEKFRPASPGSGTLGSGGTGTVGNSDGHNSQSPPLLGEPGQYAQPTSLPNLQNGPVLARAIQKRVPNAYDKTALALEVGDLVMVTKINVNGQWEGECK-GKRGHFPFTHVRLLD 298          
BLAST of Potassium channel tetramerization domain containing 1 vs. Ensembl Cavefish
Match: crkl (v-crk avian sarcoma virus CT10 oncogene homolog-like [Source:ZFIN;Acc:ZDB-GENE-040426-2951])

HSP 1 Score: 67.781 bits (164), Expect = 2.159e-12
Identity = 36/92 (39.13%), Postives = 56/92 (60.87%), Query Frame = 2
Query:  203 WYFGNLSRDEAQNSIFMEADGTYLIRDCNQILGGYVLLVKEKTQTNKYIIS--PYKDGWKIGNTEFDSIESLLSHFSKVIIRQSTLTNPAPK 472
            WYFG+LSR E Q+ +  +  G +L+RD +   G YVL V E ++ + YII+  P K  +KIG+ EF+ + +LL  +    +  +TL  PAP+
Sbjct:   21 WYFGSLSRQETQSRLQGQRHGMFLVRDSSTCPGDYVLSVSENSKVSHYIINSLPSKR-FKIGDQEFEHLPALLEFYKIHYLDTTTLIEPAPR 111          
BLAST of Potassium channel tetramerization domain containing 1 vs. Ensembl Cavefish
Match: CRK (adapter molecule crk-like [Source:NCBI gene;Acc:103038949])

HSP 1 Score: 65.855 bits (159), Expect = 1.019e-11
Identity = 67/294 (22.79%), Postives = 114/294 (38.78%), Query Frame = 2
Query:  203 WYFGNLSRDEAQNSIFMEADGTYLIRDCNQILGGYVLLVKEKTQTNKYIISPYKDG-----------WKIGNTEFDSIESLLSHFSKVIIRQSTLTNP-----------------APK-----PFYRVLQTYHPKSDIELAVNECQFVRFVLKYDEKILCEH--------------------QLTKAIGWLPVNILKQSSNDKTSLQQMVFKMQSRV-----------------PFKTLAIKDRYPNVFDKSQLSVKVGDSLMVIDVLENGMLQTKNQFGKDGLVPFNIVNIND 874
            WY+G ++R EA   +  +  G +L+RD   I G YVL V E ++ + YII+   +            ++IG+ EFD++  LL  +    +  +TL  P                 AP+      + R L  +    D +L   +   +R + K +E+                           T  +G  PV      +    SL      + +++                 P    AI+ R PN +DK+ L+++VGD + V  +  NG  + + + GK G  PF  V + D
Sbjct:   13 WYWGKINRKEAVTLLQGQRHGVFLVRDSTTIRGDYVLSVSENSKVSHYIINSISNNRQSGSGLMSSRFRIGDQEFDTLPGLLEFYKIHYLDTTTLIEPINRSKHASFISTAAPAGAPQRSEDAEYVRALFDFPGNDDEDLPFRKGDVLRVLEKPEEQWWNAQNSEGRSGMIPVPYVEKYRPSSPTSQLGGAPVGQTGLGTPSVGSLDGNGGPVPTKLDYAQPVVNTPLPNLQNGPVYARAIQKRVPNAYDKTALALEVGDMVTVTKINVNGQWEGECK-GKKGHFPFTHVRLLD 305          
BLAST of Potassium channel tetramerization domain containing 1 vs. Ensembl Cavefish
Match: CRK (adapter molecule crk-like [Source:NCBI gene;Acc:103038949])

HSP 1 Score: 65.0846 bits (157), Expect = 1.611e-11
Identity = 67/296 (22.64%), Postives = 114/296 (38.51%), Query Frame = 2
Query:  203 WYFGNLSRDEAQNSIFMEADGTYLIRDCNQILGGYVLLVKEKTQTNKYIISPYKDG-------------WKIGNTEFDSIESLLSHFSKVIIRQSTLTNP-----------------APK-----PFYRVLQTYHPKSDIELAVNECQFVRFVLKYDEKILCEH--------------------QLTKAIGWLPVNILKQSSNDKTSLQQMVFKMQSRV-----------------PFKTLAIKDRYPNVFDKSQLSVKVGDSLMVIDVLENGMLQTKNQFGKDGLVPFNIVNIND 874
            WY+G ++R EA   +  +  G +L+RD   I G YVL V E ++ + YII+   +              ++IG+ EFD++  LL  +    +  +TL  P                 AP+      + R L  +    D +L   +   +R + K +E+                           T  +G  PV      +    SL      + +++                 P    AI+ R PN +DK+ L+++VGD + V  +  NG  + + + GK G  PF  V + D
Sbjct:   13 WYWGKINRKEAVTLLQGQRHGVFLVRDSTTIRGDYVLSVSENSKVSHYIINSISNNRPCTFCPSLMSSRFRIGDQEFDTLPGLLEFYKIHYLDTTTLIEPINRSKHASFISTAAPAGAPQRSEDAEYVRALFDFPGNDDEDLPFRKGDVLRVLEKPEEQWWNAQNSEGRSGMIPVPYVEKYRPSSPTSQLGGAPVGQTGLGTPSVGSLDGNGGPVPTKLDYAQPVVNTPLPNLQNGPVYARAIQKRVPNAYDKTALALEVGDMVTVTKINVNGQWEGECK-GKKGHFPFTHVRLLD 307          
BLAST of Potassium channel tetramerization domain containing 1 vs. Ensembl Cavefish
Match: pik3r1 (phosphoinositide-3-kinase regulatory subunit 1 [Source:NCBI gene;Acc:103046618])

HSP 1 Score: 54.299 bits (129), Expect = 1.069e-7
Identity = 36/121 (29.75%), Postives = 60/121 (49.59%), Query Frame = 2
Query:  170 LRNLMQNHVKDWYFGNLSRDEAQNSIFMEADGTYLIRDCNQILGGYVLLVKEKTQTNKYIISPYKDGWKIGNTE---FDSIESLLSHFSKVIIRQSTLTNPAPKPFYRVLQTYHPKSDIEL 523
            + N M  H  +WY+G++SR+E    +   ADGT+L+RD +  + G   L   K   NK I   ++DG K G ++   F+S+  L++H+                  +  L  Y+PK D++L
Sbjct:  324 MNNNMALHDAEWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKLIKIFHRDG-KYGFSDPLTFNSVVELINHYR-----------------HESLAQYNPKLDVKL 426          
BLAST of Potassium channel tetramerization domain containing 1 vs. Ensembl Sea Lamprey
Match: crkl (v-crk avian sarcoma virus CT10 oncogene homolog-like [Source:ZFIN;Acc:ZDB-GENE-040426-2951])

HSP 1 Score: 79.337 bits (194), Expect = 4.077e-17
Identity = 69/287 (24.04%), Postives = 117/287 (40.77%), Query Frame = 2
Query:  191 HVKD-WYFGNLSRDEAQNSIFMEADGTYLIRDCNQILGGYVLLVKEKTQTNKYIISPYKDGWKIGNTEFDSIESLLSHFSKVIIRQSTLTNPA---PKP--------------------------FYRVLQTYHPKSDIELAVNECQFVRFVLKYDEKILCEHQLTKAIGWLPVNILKQSSNDKT-----------------------------SLQQMVFKMQSRVPFKTLAIKDRYPNVFDKSQLSVKVGDSLMVIDVLENGMLQTKNQFGKDGLVPFNIVNIND 874
            H +D WYFG LSR E Q  +  +  GT+++RD     G YVL V E ++ + YI++   D +KIG+ EF  + +LL  +    +  +TL  PA   P P                          F R L  +    + +L     + +  V K +E+           G +PV  ++++S   +                             ++ Q +  +Q+  P     I+ R PN +DK+ L++ +G+ + V  +  NG  + +   G+ G  PF  V I D
Sbjct:    9 HDRDSWYFGPLSRVETQRRLQGQRHGTFVVRDSTTCPGDYVLSVSENSKVSHYIVNNLADRFKIGDQEFRDLPALLEFYRIHYLDTTTLIEPAGQSPSPPASKKHQQGGGGGGGSGGGGVDESVEFVRALFDFPGNDEEDLPFKRGEILTIVAKPEEQWWSARNKEGRTGMVPVPYVEKASRPLSYAASSMAPGNRNSYGSGQGGDQGPYAHPLAIGQQLPNLQNG-PVLATVIQKRVPNAYDKTALALDIGEVVTVTKMHVNGQWEGEVN-GRRGHFPFTHVRIID 293          
BLAST of Potassium channel tetramerization domain containing 1 vs. Ensembl Sea Lamprey
Match: pik3r1 (phosphoinositide-3-kinase, regulatory subunit 1 (alpha) [Source:ZFIN;Acc:ZDB-GENE-030131-1280])

HSP 1 Score: 49.6766 bits (117), Expect = 5.100e-7
Identity = 31/94 (32.98%), Postives = 49/94 (52.13%), Query Frame = 2
Query:  200 DWYFGNLSRDEAQNSIFMEADGTYLIRDCNQILGGYVLLVKEKTQTNKYIISPYKDGWKIGNTE---FDSIESLLSHFSKVIIRQSTLTNPAPK 472
            +WY+G++SR+E    +    DGTYL+RD +  + G   L   K   NK I   ++D  K G +E   F+S+  L++H+     R  +L    PK
Sbjct:   68 EWYWGDISREEVNEKLRNTPDGTYLVRDASTKMQGDYTLTLRKGGNNKLIKIFHRDS-KYGFSEPLTFNSVVELITHY-----RHESLAQYNPK 155          
BLAST of Potassium channel tetramerization domain containing 1 vs. Ensembl Nematostella
Match: EDO38500 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCW1])

HSP 1 Score: 51.6026 bits (122), Expect = 1.459e-7
Identity = 28/89 (31.46%), Postives = 44/89 (49.44%), Query Frame = 2
Query:  203 WYFGNLSRDEAQNSIFMEADGTYLIRDCNQILGGYVLLVKEKTQTNKYIISPYKDGWKIGNTEFDSIESLLSHFSKVIIRQSTLTNPAP 469
            WY G L R E +  +  +  G +L+RD   I G YVL V E  + + YII+     + IG+  F  + S++  + K  +  +TL    P
Sbjct:    9 WYHGVLKRVETEGILNGKPPGVWLVRDSTTIPGDYVLSVSESGKVSHYIINNKGTMYTIGDQTFPDLPSIIEFYKKHFLDTTTLKEHVP 97          
BLAST of Potassium channel tetramerization domain containing 1 vs. Ensembl Medaka
Match: crkl (CRK like proto-oncogene, adaptor protein [Source:NCBI gene;Acc:101164077])

HSP 1 Score: 66.6254 bits (161), Expect = 4.702e-12
Identity = 36/90 (40.00%), Postives = 55/90 (61.11%), Query Frame = 2
Query:  203 WYFGNLSRDEAQNSIFMEADGTYLIRDCNQILGGYVLLVKEKTQTNKYIIS--PYKDGWKIGNTEFDSIESLLSHFSKVIIRQSTLTNPA 466
            WYFG +SR EAQN +  +  G +L+RD +   G YVL V E ++ + YII+  P K  +KIG+ EF+++ +LL  +    +  +TL  PA
Sbjct:   14 WYFGPVSRQEAQNRLQGQRHGMFLVRDSSTCPGDYVLSVSENSKVSHYIINSLPSKR-FKIGDQEFENLPALLEFYKIHYLDTTTLIEPA 102          
BLAST of Potassium channel tetramerization domain containing 1 vs. Ensembl Medaka
Match: crk (CRK proto-oncogene, adaptor protein [Source:NCBI gene;Acc:101157634])

HSP 1 Score: 66.2402 bits (160), Expect = 6.334e-12
Identity = 69/295 (23.39%), Postives = 117/295 (39.66%), Query Frame = 2
Query:  203 WYFGNLSRDEAQNSIFMEADGTYLIRDCNQILGGYVLLVKEKTQTNKYIISPYKDG-----------WKIGNTEFDSIESLLSHFSKVIIRQSTLTNP-----------------APK----PFYRVLQTYHPKSDIELAVNECQFVRFVLKYDEKILCEHQLTKAIGWLPVNILKQ-------------------------SSNDKTSLQQMV------FKMQSRVPFKTL--------AIKDRYPNVFDKSQLSVKVGDSLMVIDVLENGMLQTKNQFGKDGLVPFNIVNIND 874
            WY+G LSR EA + +  +  G +L+RD     G YVL V E ++ + YII+   +            ++IG+ EFD++ +LL  +    +  +TL  P                 AP      F R L  +    + +L   +   +R + K +E+           G +PV  +++                          ++D +  Q  V       +     P   L        AI+ R PN +DK+ L+++VGD + V  +  NG  + + + GK G  PF  V + D
Sbjct:   13 WYWGRLSRQEAVSLLQGQRHGVFLVRDSITSPGDYVLSVSENSKVSHYIINSISNNRQSGPGLSHPRFRIGDQEFDALPALLEFYKIHYLDTTTLIEPINKSKHPSGMSVAHGGGAPPRLEDEFVRALFDFPGNDEEDLPFRKGDILRVLEKPEEQWWNAQNSEGRTGMIPVPYVEKYRPSSPSSAAGPGMAGGAPGVLPLHGNSDGSGAQPGVPLLGDPSQYAQPTPLPNLQNGPVYARAIQKRVPNAYDKTALALEVGDMVKVTKINVNGQWEGECK-GKRGHFPFTHVKLLD 306          
BLAST of Potassium channel tetramerization domain containing 1 vs. Ensembl Medaka
Match: ENSORLT00000045629.1 (adapter molecule crk [Source:NCBI gene;Acc:110016423])

HSP 1 Score: 64.6994 bits (156), Expect = 2.086e-11
Identity = 67/292 (22.95%), Postives = 113/292 (38.70%), Query Frame = 2
Query:  203 WYFGNLSRDEAQNSIFMEADGTYLIRDCNQILGGYVLLVKEKTQTNKYIISPYKDG-----------WKIGNTEFDSIESLLSHFSKVIIRQSTL-------------TNPAPKP------FYRVLQTYHPKSDIELAVNECQFVRFVLKYDEKILCEHQLTKAIGWLPV------------------------------------NILKQSSNDKTSLQQMVFKMQ----SRVPFKTLAIKDRYPNVFDKSQLSVKVGDSLMVIDVLENGMLQTKNQFGKDGLVPFNIVNI 868
            WY+G LSR +A + +  +  G +L+RD     G YVL V E ++ + YII+   +            ++IG+ EF+++ +LL  +    +  +TL             + PA  P      F R L  +    + +L   +   +R + K +E+          IG +PV                                    + L     +     Q V   Q       P    AI+ R PN +DK+ L+++VGD + V  +  NG  + + + GK G  PF  V +
Sbjct:   13 WYWGRLSRQDAVSFLQGQRHGVFLVRDSITSPGDYVLSVSENSKVSHYIINSVSNNRQSGPVLAPSRFRIGDQEFEALPALLEFYKIHYLDTTTLIEPVSKARNANSNSTPAGAPQQVEEEFVRALFDFPGNDEEDLPFRKGDILRVLEKPEEQWWNAANQEGQIGMIPVPYVEKYRPGSPTTACPGTPGATPGQGGPAGGTDGIGSPLGNPLGEPGPYAQPVVSAQLPNLQNGPVYARAIQKRVPNAYDKTALALEVGDMVKVTKINVNGQWEGECK-GKQGHFPFTHVRL 303          
BLAST of Potassium channel tetramerization domain containing 1 vs. Ensembl Medaka
Match: pik3r3b (phosphoinositide-3-kinase regulatory subunit 3 [Source:NCBI gene;Acc:101170665])

HSP 1 Score: 50.8322 bits (120), Expect = 1.276e-6
Identity = 29/85 (34.12%), Postives = 48/85 (56.47%), Query Frame = 2
Query:  200 DWYFGNLSRDEAQNSIFMEADGTYLIRDCNQILGGYVLLVKEKTQTNKYIISPYKDGWKIGNTE---FDSIESLLSHFSKVIIRQ 445
            +WY+G++SR+E  + +    DGT+L+RD +  + G   L   K   NK I   ++DG K G +E   F+S+  L+SH+    + Q
Sbjct:  296 EWYWGDISREEVNDKLRDMPDGTFLVRDASTKMQGDYTLTLRKGGNNKLIKIYHRDG-KYGFSEPLTFNSVVDLISHYRHESLAQ 379          
BLAST of Potassium channel tetramerization domain containing 1 vs. Ensembl Medaka
Match: pik3r1 (phosphoinositide-3-kinase regulatory subunit 1 [Source:NCBI gene;Acc:101171597])

HSP 1 Score: 50.447 bits (119), Expect = 1.307e-6
Identity = 34/109 (31.19%), Postives = 56/109 (51.38%), Query Frame = 2
Query:  167 ILRNLMQNHVK----DWYFGNLSRDEAQNSIFMEADGTYLIRDCNQILGGYVLLVKEKTQTNKYIISPYKDGWKIGNTE---FDSIESLLSHFSKVIIRQSTLTNPAPK 472
            ++ N M N++     +WY+G +SR+E    +   ADGT+L+RD +  + G   L   K   NK I   ++DG K G ++   F S+  L++H+     R  +L    PK
Sbjct:   27 VINNGMNNNMALQDAEWYWGEISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKLIKIFHRDG-KYGFSDPLTFSSVVELINHY-----RNESLAQYNPK 129          
BLAST of Potassium channel tetramerization domain containing 1 vs. Planmine SMEST
Match: SMESG000067417.1 (SMESG000067417.1)

HSP 1 Score: 506.138 bits (1302), Expect = 0.000e+0
Identity = 244/246 (99.19%), Postives = 245/246 (99.59%), Query Frame = 2
Query:  146 MNPKEYSILRNLMQNHVKDWYFGNLSRDEAQNSIFMEADGTYLIRDCNQILGGYVLLVKEKTQTNKYIISPYKDGWKIGNTEFDSIESLLSHFSKVIIRQSTLTNPAPKPFYRVLQTYHPKSDIELAVNECQFVRFVLKYDEKILCEHQLTKAIGWLPVNILKQSSNDKTSLQQMVFKMQSRVPFKTLAIKDRYPNVFDKSQLSVKVGDSLMVIDVLENGMLQTKNQFGKDGLVPFNIVNINDLEV 883
            MNPKEYSILRNLMQNHVKDWYFGNLSRDEAQNSIFME DGTYLIRDCNQILGGYVLLVKEKTQTNKYIISPYKDGWKIGN+EFDSIESLLSHFSKVIIRQSTLTNPAPKPFYRVLQTYHPKSDIELAVNECQFVRFVLKYDEKILCEHQLTKAIGWLPVNILKQSSNDKTSLQQMVFKMQSRVPFKTLAIKDRYPNVFDKSQLSVKVGDSLMVIDVLENGMLQTKNQFGKDGLVPFNIVNINDLEV
Sbjct:    1 MNPKEYSILRNLMQNHVKDWYFGNLSRDEAQNSIFMEGDGTYLIRDCNQILGGYVLLVKEKTQTNKYIISPYKDGWKIGNSEFDSIESLLSHFSKVIIRQSTLTNPAPKPFYRVLQTYHPKSDIELAVNECQFVRFVLKYDEKILCEHQLTKAIGWLPVNILKQSSNDKTSLQQMVFKMQSRVPFKTLAIKDRYPNVFDKSQLSVKVGDSLMVIDVLENGMLQTKNQFGKDGLVPFNIVNINDLEV 246          
The following BLAST results are available for this feature:
BLAST of Potassium channel tetramerization domain containing 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CRKL7.601e-1524.65CRK like proto-oncogene, adaptor protein [Source:H... [more]
CRKL7.601e-1524.65CRK like proto-oncogene, adaptor protein [Source:H... [more]
CRK3.427e-1122.38CRK proto-oncogene, adaptor protein [Source:HGNC S... [more]
CRK6.876e-826.49CRK proto-oncogene, adaptor protein [Source:HGNC S... [more]
CRK2.161e-730.91CRK proto-oncogene, adaptor protein [Source:HGNC S... [more]
back to top
BLAST of Potassium channel tetramerization domain containing 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ced-21.552e-1425.77Cell death abnormality protein 2 [Source:UniProtK... [more]
nck-18.235e-631.25NCK (Non-Catalytic region of tyrosine Kinase) adap... [more]
nck-18.235e-631.25NCK (Non-Catalytic region of tyrosine Kinase) adap... [more]
nck-18.235e-631.25NCK (Non-Catalytic region of tyrosine Kinase) adap... [more]
back to top
BLAST of Potassium channel tetramerization domain containing 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Crk3.476e-1826.51gene:FBgn0024811 transcript:FBtr0089113[more]
Crk3.476e-1826.51gene:FBgn0024811 transcript:FBtr0089112[more]
Crk1.450e-1328.10gene:FBgn0024811 transcript:FBtr0304871[more]
Crk2.133e-1325.10gene:FBgn0024811 transcript:FBtr0308256[more]
Crk1.225e-1224.90gene:FBgn0024811 transcript:FBtr0089114[more]
back to top
BLAST of Potassium channel tetramerization domain containing 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
crk1.506e-1324.40v-crk avian sarcoma virus CT10 oncogene homolog [S... [more]
crk1.506e-1324.40v-crk avian sarcoma virus CT10 oncogene homolog [S... [more]
crk1.506e-1324.40v-crk avian sarcoma virus CT10 oncogene homolog [S... [more]
crkl1.571e-1341.30v-crk avian sarcoma virus CT10 oncogene homolog-li... [more]
pik3r11.408e-632.98phosphoinositide-3-kinase, regulatory subunit 1 (a... [more]
back to top
BLAST of Potassium channel tetramerization domain containing 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kctd11.015e-1526.06potassium channel tetramerization domain containin... [more]
mvb12b3.845e-1423.91multivesicular body subunit 12B [Source:Xenbase;Ac... [more]
mvb12b6.070e-1424.91multivesicular body subunit 12B [Source:Xenbase;Ac... [more]
PIK3R12.761e-730.43phosphoinositide-3-kinase regulatory subunit 1 [So... [more]
PIK3R13.139e-730.43phosphoinositide-3-kinase regulatory subunit 1 [So... [more]
back to top
BLAST of Potassium channel tetramerization domain containing 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Crkl2.550e-1524.65v-crk avian sarcoma virus CT10 oncogene homolog-li... [more]
Crkl7.863e-1336.26v-crk avian sarcoma virus CT10 oncogene homolog-li... [more]
Crkl1.314e-1236.26v-crk avian sarcoma virus CT10 oncogene homolog-li... [more]
Crk2.028e-1122.38v-crk avian sarcoma virus CT10 oncogene homolog [S... [more]
Crk3.984e-826.49v-crk avian sarcoma virus CT10 oncogene homolog [S... [more]
back to top
BLAST of Potassium channel tetramerization domain containing 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9XYM0|CRK_DROME3.485e-1726.51Adapter molecule Crk OS=Drosophila melanogaster OX... [more]
sp|Q5U2U2|CRKL_RAT6.588e-1525.00Crk-like protein OS=Rattus norvegicus OX=10116 GN=... [more]
sp|P47941|CRKL_MOUSE1.783e-1424.65Crk-like protein OS=Mus musculus OX=10090 GN=Crkl ... [more]
sp|P46109|CRKL_HUMAN3.650e-1424.65Crk-like protein OS=Homo sapiens OX=9606 GN=CRKL P... [more]
sp|Q9NHC3|CED2_CAEEL1.974e-1325.77Cell death abnormality protein 2 OS=Caenorhabditis... [more]
back to top
BLAST of Potassium channel tetramerization domain containing 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267E3001.454e-2635.92Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267FM751.611e-2635.92Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A504Z2Q11.403e-2527.97Adapter molecule Crk OS=Fasciola gigantica OX=4683... [more]
A0A4E0RD411.403e-2527.97Adapter molecule Crk OS=Fasciola hepatica OX=6192 ... [more]
A0A1S8WWL61.834e-2428.93SH2 domain protein (Fragment) OS=Opisthorchis vive... [more]
back to top
BLAST of Potassium channel tetramerization domain containing 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
crk1.081e-1324.74CRK proto-oncogene, adaptor protein [Source:NCBI g... [more]
crkl2.159e-1239.13v-crk avian sarcoma virus CT10 oncogene homolog-li... [more]
CRK1.019e-1122.79adapter molecule crk-like [Source:NCBI gene;Acc:10... [more]
CRK1.611e-1122.64adapter molecule crk-like [Source:NCBI gene;Acc:10... [more]
pik3r11.069e-729.75phosphoinositide-3-kinase regulatory subunit 1 [So... [more]
back to top
BLAST of Potassium channel tetramerization domain containing 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
crkl4.077e-1724.04v-crk avian sarcoma virus CT10 oncogene homolog-li... [more]
pik3r15.100e-732.98phosphoinositide-3-kinase, regulatory subunit 1 (a... [more]
back to top
BLAST of Potassium channel tetramerization domain containing 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Potassium channel tetramerization domain containing 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO385001.459e-731.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Potassium channel tetramerization domain containing 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
crkl4.702e-1240.00CRK like proto-oncogene, adaptor protein [Source:N... [more]
crk6.334e-1223.39CRK proto-oncogene, adaptor protein [Source:NCBI g... [more]
ENSORLT00000045629.12.086e-1122.95adapter molecule crk [Source:NCBI gene;Acc:1100164... [more]
pik3r3b1.276e-634.12phosphoinositide-3-kinase regulatory subunit 3 [So... [more]
pik3r11.307e-631.19phosphoinositide-3-kinase regulatory subunit 1 [So... [more]
back to top
BLAST of Potassium channel tetramerization domain containing 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000067417.10.000e+099.19SMESG000067417.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024416 ID=SMED30024416|Name=Potassium channel tetramerization domain containing 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1035bp
GATTGTTTAAATAAATCAATCACAAAACATTCTCGTTACGCTTTCAATAT
TTTAATTAACATAATTTCATTTTCCGAAAGAAAATTTATTATAAATTTTA
TCATATACAGGCTATACTATTTTTTTTAAATCTAGAAGATAAATAATGAA
TCCTAAAGAATATTCAATTCTTCGTAATTTAATGCAAAATCACGTAAAGG
ATTGGTATTTTGGTAATTTATCACGCGATGAAGCACAAAATTCAATTTTT
ATGGAGGCTGACGGAACGTACTTAATTAGAGATTGTAACCAAATACTGGG
AGGTTACGTTTTATTAGTTAAAGAAAAAACTCAAACAAATAAATATATTA
TTTCACCGTACAAAGATGGTTGGAAAATCGGCAATACAGAATTTGATTCG
ATTGAAAGTCTTTTGTCGCATTTTTCCAAAGTCATTATTCGTCAAAGTAC
GCTCACTAATCCAGCTCCAAAGCCATTTTATAGAGTTTTGCAAACTTACC
ATCCTAAAAGTGATATAGAGTTAGCAGTCAATGAATGCCAATTTGTGAGA
TTTGTGTTAAAATATGACGAAAAGATTTTATGTGAACATCAGTTGACTAA
GGCAATTGGCTGGCTGCCTGTTAATATTTTGAAACAGTCGTCCAACGACA
AAACATCGCTCCAGCAAATGGTTTTCAAAATGCAGAGTCGTGTACCGTTT
AAAACTTTGGCAATCAAAGATCGATATCCGAATGTGTTTGATAAATCCCA
ACTATCGGTGAAAGTAGGAGATTCTTTGATGGTTATAGATGTACTGGAAA
ATGGCATGTTACAGACAAAAAATCAATTTGGTAAAGATGGGCTTGTTCCA
TTTAATATTGTTAACATAAATGATTTGGAAGTATAATAATGTTGGGAGGA
GAGCTGTTTGCGATGTGAAGAATATGATCTGATTTATTTTATACCAAATG
TACTTTGTGATATAATATTTAATATGACCTTGAAATTAATTGCACTTTGG
CACAGCTTGTAAGATAATTAATTAAAATAGATCGG
back to top

protein sequence of SMED30024416-orf-1

>SMED30024416-orf-1 ID=SMED30024416-orf-1|Name=SMED30024416-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=247bp
MNPKEYSILRNLMQNHVKDWYFGNLSRDEAQNSIFMEADGTYLIRDCNQI
LGGYVLLVKEKTQTNKYIISPYKDGWKIGNTEFDSIESLLSHFSKVIIRQ
STLTNPAPKPFYRVLQTYHPKSDIELAVNECQFVRFVLKYDEKILCEHQL
TKAIGWLPVNILKQSSNDKTSLQQMVFKMQSRVPFKTLAIKDRYPNVFDK
SQLSVKVGDSLMVIDVLENGMLQTKNQFGKDGLVPFNIVNINDLEV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0007520myoblast fusion
GO:0072114pronephros morphogenesis
GO:0001678cellular glucose homeostasis
GO:0001878response to yeast
GO:0001934positive regulation of protein phosphorylation
GO:0006006glucose metabolic process
GO:0006810transport
GO:0007165signal transduction
GO:0007568aging
GO:0007584response to nutrient
GO:0008286insulin receptor signaling pathway
GO:0009750response to fructose
GO:0010040response to iron(II) ion
GO:0010459negative regulation of heart rate
GO:0010628positive regulation of gene expression
GO:0010656negative regulation of muscle cell apoptotic process
GO:0015031protein transport
GO:0022408negative regulation of cell-cell adhesion
GO:0030335positive regulation of cell migration
GO:0032355response to estradiol
GO:0032570response to progesterone
GO:0032868response to insulin
GO:0032869cellular response to insulin stimulus
GO:0033120positive regulation of RNA splicing
GO:0033574response to testosterone
GO:0034976response to endoplasmic reticulum stress
GO:0036092phosphatidylinositol-3-phosphate biosynthetic process
GO:0042493response to drug
GO:0042993positive regulation of transcription factor import into nucleus
GO:0043066negative regulation of apoptotic process
GO:0043200response to amino acid
GO:0043551regulation of phosphatidylinositol 3-kinase activity
GO:0045471response to ethanol
GO:0045663positive regulation of myoblast differentiation
GO:0045776negative regulation of blood pressure
GO:0045861negative regulation of proteolysis
GO:0045944positive regulation of transcription from RNA polymerase II promoter
GO:0046854phosphatidylinositol phosphorylation
GO:0048009insulin-like growth factor receptor signaling pathway
GO:0048662negative regulation of smooth muscle cell proliferation
GO:0050821protein stabilization
GO:0051384response to glucocorticoid
GO:0051591response to cAMP
GO:0070542response to fatty acid
GO:0070848response to growth factor
GO:0071398cellular response to fatty acid
GO:0071548response to dexamethasone
GO:1900103positive regulation of endoplasmic reticulum unfolded protein response
GO:2001275positive regulation of glucose import in response to insulin stimulus
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036860SH2_dom_sf
IPR036028SH3-like_dom_sf
IPR000980SH2
IPR001452SH3_domain
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005102signaling receptor binding
GO:0005158insulin receptor binding
GO:0005159insulin-like growth factor receptor binding
GO:0005161platelet-derived growth factor receptor binding
GO:0005516calmodulin binding
GO:0008022protein C-terminus binding
GO:00163031-phosphatidylinositol-3-kinase activity
GO:0019901protein kinase binding
GO:0019904protein domain specific binding
GO:0030331estrogen receptor binding
GO:0030971receptor tyrosine kinase binding
GO:0031625ubiquitin protein ligase binding
GO:0035014phosphatidylinositol 3-kinase regulator activity
GO:0043125ErbB-3 class receptor binding
GO:0043560insulin receptor substrate binding
GO:00469351-phosphatidylinositol-3-kinase regulator activity
GO:0051117ATPase binding
GO:0051219phosphoprotein binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005829cytosol
GO:0005886plasma membrane
GO:0005942phosphatidylinositol 3-kinase complex
GO:0005943phosphatidylinositol 3-kinase complex, class IA
GO:0016020membrane
GO:0043005neuron projection
GO:0043234protein complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000980SH2 domainPRINTSPR00401SH2DOMAINcoord: 51..62
score: 29.84
coord: 82..96
score: 28.81
coord: 20..34
score: 37.78
coord: 39..49
score: 36.81
IPR000980SH2 domainSMARTSM00252SH2_5coord: 18..99
e-value: 3.1E-13
score: 60.0
IPR000980SH2 domainPFAMPF00017SH2coord: 20..93
e-value: 1.4E-12
score: 47.5
IPR000980SH2 domainPROSITEPS50001SH2coord: 20..107
score: 14.053
IPR036860SH2 domain superfamilyGENE3DG3DSA:3.30.505.10coord: 4..109
e-value: 4.6E-21
score: 76.4
IPR036860SH2 domain superfamilySUPERFAMILYSSF55550SH2 domaincoord: 15..131
NoneNo IPR availableGENE3DG3DSA:2.30.30.40coord: 169..243
e-value: 3.4E-8
score: 35.2
NoneNo IPR availablePANTHERPTHR19969SH2-SH3 ADAPTOR PROTEIN-RELATEDcoord: 10..236
IPR036028SH3-like domain superfamilySUPERFAMILYSSF50044SH3-domaincoord: 169..240