Protein kinase domain-containing protein

Overview
NameProtein kinase domain-containing protein
Smed IDSMED30024411
Length (bp)2284
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein kinase domain-containing protein (SMED30024411) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein kinase domain-containing protein (SMED30024411) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein kinase domain-containing protein (SMED30024411) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein kinase domain-containing protein (SMED30024411) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024411

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30024411SMESG000028899.1 Contig1093GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30024411SMESG000028899.1 Contig1093GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30024411SMESG000028899.1 Contig1093GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30024411SMESG000071997.1 Contig1093GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30024411SMESG000071997.1 Contig1093GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30024411SMESG000071997.1 Contig1093GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30024411SMESG000024532.1 dd_Smed_v4_2822_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30024411SMESG000024532.1 dd_Smed_v4_2822_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30024411SMESG000024532.1 dd_Smed_v4_2822_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30024411SMESG000024532.1 dd_Smed_v4_2822_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30024411SMESG000024532.1 dd_Smed_v4_2822_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: NEK5 (NIMA related kinase 5 [Source:HGNC Symbol;Acc:HGNC:7748])

HSP 1 Score: 111.309 bits (277), Expect = 2.438e-26
Identity = 80/258 (31.01%), Postives = 128/258 (49.61%), Query Frame = 3
Query: 1311 MEHFEFLQEKGRGAFGTVDLYQERISGNKFIVKKLNDVKCSLY------RDAFIGAKLSQSNLLRYSEVIKGQHSAHLAMPYMPGGTLSKHIYKGRCQ--NEEDIFKISYQILAQINKLHKLEIIHRDIKPDNIVLDEGGN-PKLIDFGLSRYTARLTNEDLSDKLAAYFPGTINYMAPELIRVRPYSNKIDIWSFGMVLVEMVTRKPPFHWAADGRITIELKKMQKFKFKPIMP-ISDGLHQFINSCLTVDPSERPS 2054
            M+ ++ ++  G+GAFG   L + +      ++K++N  K  +       ++  +  K+   N++ +    +      + M Y  GG L K I + R    +E+ I     QI   +  +H  +I+HRDIK  NI L + G   KL DFG+    AR+ N  +  +LA    GT  Y++PE+ + +PY+NK DIWS G VL E+ T K PF      ++ +   K+ +  F PI P  S  LH  I+    V P +RPS
Sbjct:    1 MDKYDVIKAIGQGAFGKAYLAKGKSDSKHCVIKEINFEKMPIQEKEASKKEVILLEKMKHPNIVAFFNSFQENGRLFIVMEYCDGGDLMKRINRQRGVLFSEDQILGWFVQISLGLKHIHDRKILHRDIKAQNIFLSKNGMVAKLGDFGI----ARVLNNSM--ELARTCIGTPYYLSPEICQNKPYNNKTDIWSLGCVLYELCTLKHPFEGNNLQQLVL---KICQAHFAPISPGFSRELHSLISQLFQVSPRDRPS 249          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: AURKC (aurora kinase C [Source:HGNC Symbol;Acc:HGNC:11391])

HSP 1 Score: 111.694 bits (278), Expect = 2.696e-26
Identity = 88/326 (26.99%), Postives = 144/326 (44.17%), Query Frame = 3
Query: 1152 FSNPRTIAE------AKEAIAVANKTSEQDLYVIDGQNHDEPSERDRFSQGIIIEMMRGMEHFEFLQEKGRGAFGTVDLYQERISGNKFIVK---------KLNDVKCSLYRDAFIGAKLSQSNLLRYSEVIKGQHSAHLAMPYMPGGTLSKHIYKGRCQNEEDIFKISYQILAQINKLHKLEIIHRDIKPDNIVLDEGGNPKLIDFGLSRYTARLTNEDLSDKLAAYFPGTINYMAPELIRVRPYSNKIDIWSFGMVLVEMVTRKPPFHWAADGRITIELKKMQKFKFKPIMPISDGLHQFINSCLTVDPSERPSGEHLIGSQWI 2084
             S+PR + +      A E +A AN+T++Q            P+ R R +          ++ FE  +  G+G FG V  Y  R+  + FIV          +   ++  L R+  I A L   N+LR           +L + Y P G L K + K    +E+    I  ++   +   H  ++IHRDIKP+N++L   G  K+ DFG S +T  L  + +         GT++Y+ PE+I  R Y  K+D+W  G++  E++   PPF  A+       + K+   +F   MP+  G    I+  L   P ER     ++   W+
Sbjct:    1 MSSPRAVVQLGKAQPAGEELATANQTAQQP---------SSPAMR-RLT----------VDDFEIGRPLGKGKFGNV--YLARLKESHFIVALKVLFKSQIEKEGLEHQLRREIEIQAHLQHPNILRLYNYFHDARRVYLILEYAPRGELYKELQKSEKLDEQRTATIIEELADALTYCHDKKVIHRDIKPENLLLGFRGEVKIADFGWSVHTPSLRRKTMC--------GTLDYLPPEMIEGRTYDEKVDLWCIGVLCYELLVGYPPFESASHSETYRRILKVD-VRFPLSMPL--GARDLISRLLRYQPLERLPLAQILKHPWV 293          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: CAMK1D (calcium/calmodulin dependent protein kinase ID [Source:HGNC Symbol;Acc:HGNC:19341])

HSP 1 Score: 112.464 bits (280), Expect = 3.237e-26
Identity = 75/272 (27.57%), Postives = 132/272 (48.53%), Query Frame = 3
Query: 1320 FEFLQEKGRGAFGTVDLYQERISGNKFIVK-----KLNDVKCSLYRDAFIGAKLSQSNLLRYSEVIKGQHSAHLAMPYMPGGTLSKHIYKGRCQNEEDIFKISYQILAQINKLHKLEIIHRDIKPDNIVL---DEGGNPKLIDFGLSRYTARLTNEDLSDKLAAYFPGTINYMAPELIRVRPYSNKIDIWSFGMVLVEMVTRKPPFHWAADGRITIELKKMQ-KFKFKPIMPISDGLHQFINSCLTVDPSERPSGEHLIGSQWIIDNLHMCK 2108
            FEF +  G GAF  V L +E+ +G  F VK      L   + S+  +  +  K+   N++   ++ +  +  +L M  + GG L   I +     E+D   +  Q+L  +  LH++ I+HRD+KP+N++    DE     + DFGLS+   +         + +   GT  Y+APE++  +PYS  +D WS G++   ++   PPF+   D ++  ++ K + +F       ISD    FI + +  DP++R + E      WI  +  + K
Sbjct:   23 FEFKETLGTGAFSEVVLAEEKATGKLFAVKCIPKKALKGKESSIENEIAVLRKIKHENIVALEDIYESPNHLYLVMQLVSGGELFDRIVEKGFYTEKDASTLIRQVLDAVYYLHRMGIVHRDLKPENLLYYSQDEESKIMISDFGLSKMEGK-------GDVMSTACGTPGYVAPEVLAQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDSKLFEQILKAEYEFDSPYWDDISDSAKDFIRNLMEKDPNKRYTCEQAARHPWIAGDTALNK 287          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: CAMK2G (calcium/calmodulin dependent protein kinase II gamma [Source:HGNC Symbol;Acc:HGNC:1463])

HSP 1 Score: 114.775 bits (286), Expect = 3.862e-26
Identity = 79/275 (28.73%), Postives = 135/275 (49.09%), Query Frame = 3
Query: 1305 RGMEHFEFLQEKGRGAFGTVDLYQERISGNKFIVKKLNDVKCS------LYRDAFIGAKLSQSNLLRYSEVIKGQHSAHLAMPYMPGGTLSKHIYKGRCQNEEDIFKISYQILAQINKLHKLEIIHRDIKPDNIVLD---EGGNPKLIDFGLSRYTARLTNEDLSDKLAAY-FPGTINYMAPELIRVRPYSNKIDIWSFGMVLVEMVTRKPPFHWAADGRITIELKKMQKFKFK-----PIMPISDGLHQFINSCLTVDPSERPSGEHLIGSQWI 2084
            R  + ++  +E G+GAF  V    ++ S  ++  K +N  K S      L R+A I   L   N++R  + I  +   +L    + GG L + I      +E D     +QIL  +N +H+ +I+HRD+KP+N++L    +G   KL DFGL+        E   ++ A + F GT  Y++PE++R  PY   +DIW+ G++L  ++   PPF W  D     +  K   + F       + P +  L   IN  LT++P++R + +  +   W+
Sbjct:    9 RFTDDYQLFEELGKGAFSVVRRCVKKTSTQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIHQILESVNHIHQHDIVHRDLKPENLLLASKCKGAAVKLADFGLAI-------EVQGEQQAWFGFAGTPGYLSPEVLRKDPYGKPVDIWACGVILYILLVGYPPF-WDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAKNL---INQMLTINPAKRITADQALKHPWV 272          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: CAMK2A (calcium/calmodulin dependent protein kinase II alpha [Source:HGNC Symbol;Acc:HGNC:1460])

HSP 1 Score: 112.079 bits (279), Expect = 4.970e-26
Identity = 80/289 (27.68%), Postives = 135/289 (46.71%), Query Frame = 3
Query: 1293 IEMMRGMEHFEFLQEKGRGAFGTVDLYQERISGNKFIVKKLNDVKCS------LYRDAFIGAKLSQSNLLRYSEVIKGQHSAHLAMPYMPGGTLSKHIYKGRCQNEEDIFKISYQILAQINKLHKLEIIHRDIKPDNIVLD---EGGNPKLIDFGLSRYTARLTNEDLSDKLAAY--FPGTINYMAPELIRVRPYSNKIDIWSFGMVLVEMVTRKPPFHWAADGRITIELKKMQKFKFK-----PIMPISDGLHQFINSCLTVDPSERPSGEHLIGSQWIIDNLHMCKC 2111
            I   R  E ++  +E G+GAF  V    + ++G ++  K +N  K S      L R+A I   L   N++R  + I  +   +L    + GG L + I      +E D      QIL  +   H++ ++HRD+KP+N++L    +G   KL DFGL+         ++  +  A+  F GT  Y++PE++R  PY   +D+W+ G++L  ++   PPF W  D     +  K   + F       + P +  L   IN  LT++PS+R +    +   WI     +  C
Sbjct:    4 ITCTRFTEEYQLFEELGKGAFSVVRRCVKVLAGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGHHYLIFDLVTGGELFEDIVAREYYSEADASHCIQQILEAVLHCHQMGVVHRDLKPENLLLASKLKGAAVKLADFGLAI--------EVEGEQQAWFGFAGTPGYLSPEVLRKDPYGKPVDLWACGVILYILLVGYPPF-WDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDL---INKMLTINPSKRITAAEALKHPWISHRSTVASC 280          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: unc-43 (Calcium/calmodulin-dependent protein kinase type II [Source:UniProtKB/Swiss-Prot;Acc:O62305])

HSP 1 Score: 112.079 bits (279), Expect = 6.065e-27
Identity = 82/274 (29.93%), Postives = 138/274 (50.36%), Query Frame = 3
Query: 1314 EHFEFLQEKGRGAFGTVDLYQERISGNKFIVKKLNDVKCS------LYRDAFIGAKLSQSNLLRYSEVIKGQHSAHLAMPYMPGGTLSKHIYKGRCQNEEDIFKISYQILAQINKLHKLEIIHRDIKPDNIVL---DEGGNPKLIDFGLSRYTARLTNEDLSDKLAAY-FPGTINYMAPELIRVRPYSNKIDIWSFGMVLVEMVTRKPPFHWAADG-RITIELKK----MQKFKFKPIMPISDGLHQFINSCLTVDPSERPSGEHLIGSQWIID 2090
            ++++  +E G+GAF  V     + +G +F  K +N  K S      L R+A I  KL   N++R  + I+ +   +L    + GG L + I      +E D      QIL  I   H   I+HRD+KP+N++L    +G   KL DFGL+         +++D  A + F GT  Y++PE+++  PYS  +DIW+ G++L  ++   PPF W  D  R+  ++K         ++  + P +  L   I+S LTV+P +R + +  +   WI +
Sbjct:   10 DNYDVKEELGKGAFSVVRRCVHKTTGLEFAAKIINTKKLSARDFQKLEREARICRKLQHPNIVRLHDSIQEESFHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESIAYCHSNGIVHRDLKPENLLLASKAKGAAVKLADFGLAI--------EVNDSEAWHGFAGTPGYLSPEVLKKDPYSKPVDIWACGVILYILLVGYPPF-WDEDQHRLYAQIKAGAYDYPSPEWDTVTPEAKSL---IDSMLTVNPKKRITADQALKVPWICN 271          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: unc-43 (Calcium/calmodulin-dependent protein kinase type II [Source:UniProtKB/Swiss-Prot;Acc:O62305])

HSP 1 Score: 112.079 bits (279), Expect = 6.065e-27
Identity = 82/274 (29.93%), Postives = 138/274 (50.36%), Query Frame = 3
Query: 1314 EHFEFLQEKGRGAFGTVDLYQERISGNKFIVKKLNDVKCS------LYRDAFIGAKLSQSNLLRYSEVIKGQHSAHLAMPYMPGGTLSKHIYKGRCQNEEDIFKISYQILAQINKLHKLEIIHRDIKPDNIVL---DEGGNPKLIDFGLSRYTARLTNEDLSDKLAAY-FPGTINYMAPELIRVRPYSNKIDIWSFGMVLVEMVTRKPPFHWAADG-RITIELKK----MQKFKFKPIMPISDGLHQFINSCLTVDPSERPSGEHLIGSQWIID 2090
            ++++  +E G+GAF  V     + +G +F  K +N  K S      L R+A I  KL   N++R  + I+ +   +L    + GG L + I      +E D      QIL  I   H   I+HRD+KP+N++L    +G   KL DFGL+         +++D  A + F GT  Y++PE+++  PYS  +DIW+ G++L  ++   PPF W  D  R+  ++K         ++  + P +  L   I+S LTV+P +R + +  +   WI +
Sbjct:   10 DNYDVKEELGKGAFSVVRRCVHKTTGLEFAAKIINTKKLSARDFQKLEREARICRKLQHPNIVRLHDSIQEESFHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESIAYCHSNGIVHRDLKPENLLLASKAKGAAVKLADFGLAI--------EVNDSEAWHGFAGTPGYLSPEVLKKDPYSKPVDIWACGVILYILLVGYPPF-WDEDQHRLYAQIKAGAYDYPSPEWDTVTPEAKSL---IDSMLTVNPKKRITADQALKVPWICN 271          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: unc-43 (Calcium/calmodulin-dependent protein kinase type II [Source:UniProtKB/Swiss-Prot;Acc:O62305])

HSP 1 Score: 112.079 bits (279), Expect = 6.065e-27
Identity = 82/274 (29.93%), Postives = 138/274 (50.36%), Query Frame = 3
Query: 1314 EHFEFLQEKGRGAFGTVDLYQERISGNKFIVKKLNDVKCS------LYRDAFIGAKLSQSNLLRYSEVIKGQHSAHLAMPYMPGGTLSKHIYKGRCQNEEDIFKISYQILAQINKLHKLEIIHRDIKPDNIVL---DEGGNPKLIDFGLSRYTARLTNEDLSDKLAAY-FPGTINYMAPELIRVRPYSNKIDIWSFGMVLVEMVTRKPPFHWAADG-RITIELKK----MQKFKFKPIMPISDGLHQFINSCLTVDPSERPSGEHLIGSQWIID 2090
            ++++  +E G+GAF  V     + +G +F  K +N  K S      L R+A I  KL   N++R  + I+ +   +L    + GG L + I      +E D      QIL  I   H   I+HRD+KP+N++L    +G   KL DFGL+         +++D  A + F GT  Y++PE+++  PYS  +DIW+ G++L  ++   PPF W  D  R+  ++K         ++  + P +  L   I+S LTV+P +R + +  +   WI +
Sbjct:   10 DNYDVKEELGKGAFSVVRRCVHKTTGLEFAAKIINTKKLSARDFQKLEREARICRKLQHPNIVRLHDSIQEESFHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESIAYCHSNGIVHRDLKPENLLLASKAKGAAVKLADFGLAI--------EVNDSEAWHGFAGTPGYLSPEVLKKDPYSKPVDIWACGVILYILLVGYPPF-WDEDQHRLYAQIKAGAYDYPSPEWDTVTPEAKSL---IDSMLTVNPKKRITADQALKVPWICN 271          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: unc-43 (Calcium/calmodulin-dependent protein kinase type II [Source:UniProtKB/Swiss-Prot;Acc:O62305])

HSP 1 Score: 112.079 bits (279), Expect = 6.181e-27
Identity = 82/274 (29.93%), Postives = 138/274 (50.36%), Query Frame = 3
Query: 1314 EHFEFLQEKGRGAFGTVDLYQERISGNKFIVKKLNDVKCS------LYRDAFIGAKLSQSNLLRYSEVIKGQHSAHLAMPYMPGGTLSKHIYKGRCQNEEDIFKISYQILAQINKLHKLEIIHRDIKPDNIVL---DEGGNPKLIDFGLSRYTARLTNEDLSDKLAAY-FPGTINYMAPELIRVRPYSNKIDIWSFGMVLVEMVTRKPPFHWAADG-RITIELKK----MQKFKFKPIMPISDGLHQFINSCLTVDPSERPSGEHLIGSQWIID 2090
            ++++  +E G+GAF  V     + +G +F  K +N  K S      L R+A I  KL   N++R  + I+ +   +L    + GG L + I      +E D      QIL  I   H   I+HRD+KP+N++L    +G   KL DFGL+         +++D  A + F GT  Y++PE+++  PYS  +DIW+ G++L  ++   PPF W  D  R+  ++K         ++  + P +  L   I+S LTV+P +R + +  +   WI +
Sbjct:   10 DNYDVKEELGKGAFSVVRRCVHKTTGLEFAAKIINTKKLSARDFQKLEREARICRKLQHPNIVRLHDSIQEESFHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESIAYCHSNGIVHRDLKPENLLLASKAKGAAVKLADFGLAI--------EVNDSEAWHGFAGTPGYLSPEVLKKDPYSKPVDIWACGVILYILLVGYPPF-WDEDQHRLYAQIKAGAYDYPSPEWDTVTPEAKSL---IDSMLTVNPKKRITADQALKVPWICN 271          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: unc-43 (Calcium/calmodulin-dependent protein kinase type II [Source:UniProtKB/Swiss-Prot;Acc:O62305])

HSP 1 Score: 112.079 bits (279), Expect = 6.181e-27
Identity = 82/274 (29.93%), Postives = 138/274 (50.36%), Query Frame = 3
Query: 1314 EHFEFLQEKGRGAFGTVDLYQERISGNKFIVKKLNDVKCS------LYRDAFIGAKLSQSNLLRYSEVIKGQHSAHLAMPYMPGGTLSKHIYKGRCQNEEDIFKISYQILAQINKLHKLEIIHRDIKPDNIVL---DEGGNPKLIDFGLSRYTARLTNEDLSDKLAAY-FPGTINYMAPELIRVRPYSNKIDIWSFGMVLVEMVTRKPPFHWAADG-RITIELKK----MQKFKFKPIMPISDGLHQFINSCLTVDPSERPSGEHLIGSQWIID 2090
            ++++  +E G+GAF  V     + +G +F  K +N  K S      L R+A I  KL   N++R  + I+ +   +L    + GG L + I      +E D      QIL  I   H   I+HRD+KP+N++L    +G   KL DFGL+         +++D  A + F GT  Y++PE+++  PYS  +DIW+ G++L  ++   PPF W  D  R+  ++K         ++  + P +  L   I+S LTV+P +R + +  +   WI +
Sbjct:   10 DNYDVKEELGKGAFSVVRRCVHKTTGLEFAAKIINTKKLSARDFQKLEREARICRKLQHPNIVRLHDSIQEESFHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESIAYCHSNGIVHRDLKPENLLLASKAKGAAVKLADFGLAI--------EVNDSEAWHGFAGTPGYLSPEVLKKDPYSKPVDIWACGVILYILLVGYPPF-WDEDQHRLYAQIKAGAYDYPSPEWDTVTPEAKSL---IDSMLTVNPKKRITADQALKVPWICN 271          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: Nek2 (gene:FBgn0029970 transcript:FBtr0071142)

HSP 1 Score: 124.79 bits (312), Expect = 3.450e-29
Identity = 90/281 (32.03%), Postives = 146/281 (51.96%), Query Frame = 3
Query: 1305 RGMEHFEFLQEKGRGAFGTVDLYQERISGNKFIVKKLN-----DVKC-SLYRDAFIGAKLSQSNLLRYSE--VIKGQHSAHLAMPYMPGGTLSKHIYKGRCQN----EEDIFKISYQILAQI----NKLHKLEIIHRDIKPDNIVLDEGGNPKLIDFGLSRYTARLTNEDLSDKLAAYFPGTINYMAPELIRVRPYSNKIDIWSFGMVLVEMVTRKPPFHWAADGRITIELKKMQKFKFKPIMPI-SDGLHQFINSCLTVDPSERPSGEHLIGSQWIIDNL 2096
            + ++ +E L   G G+FGT    +++ +G  F  K +N     + KC +L  +  +  +L   N+++Y    V +   S ++ M    GG L++ + + R Q     E  I+++ +Q+   +    NK+    I+HRDIKP NI LD  GN KL DFGL    AR+   D S   AA F GT +YM+PEL++ R Y  K D+W+ G ++ EM   +PPF   A  +++   +K+ + +F  I  I S  L + I   L VD  +RP  E +I    ++ N+
Sbjct:   14 KTLQDYEVLAVMGNGSFGTCYKVRDKSTGELFAWKGMNYDELDEAKCDALVSEISVLRQLQHPNIVQYYHHLVNREAKSVYIVMECCAGGDLAQIVQRARSQRQRFEEPYIWRVLFQLCRALQVCHNKIPNGTILHRDIKPANIFLDAAGNAKLGDFGL----ARMLRRDQS--FAASFVGTPHYMSPELVKGRKYDRKSDVWAVGCLVYEMCALRPPFRGRAFDQLS---EKIAQGEFSRIPAIYSTDLQEIIAFMLAVDHEQRPGIEVIIRHPLVVRNI 285          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: CaMKII (gene:FBgn0264607 transcript:FBtr0333673)

HSP 1 Score: 112.849 bits (281), Expect = 5.475e-26
Identity = 81/275 (29.45%), Postives = 138/275 (50.18%), Query Frame = 3
Query: 1305 RGMEHFEFLQEKGRGAFGTVDLYQERISGNKFIVKKLNDVKCS------LYRDAFIGAKLSQSNLLRYSEVIKGQHSAHLAMPYMPGGTLSKHIYKGRCQNEEDIFKISYQILAQINKLHKLEIIHRDIKPDNIVL---DEGGNPKLIDFGLSRYTARLTNEDLSDKLAAY-FPGTINYMAPELIRVRPYSNKIDIWSFGMVLVEMVTRKPPFHWAADG-RITIELKK----MQKFKFKPIMPISDGLHQFINSCLTVDPSERPSGEHLIGSQWI 2084
            R  ++++  +E G+GAF  V    ++ +G +F  K +N  K +      L R+A I  KL   N++R  + I+ ++  +L    + GG L + I      +E D      QIL  +N  H+  ++HRD+KP+N++L    +G   KL DFGL+        E   D  A + F GT  Y++PE+++  PY   +DIW+ G++L  ++   PPF W  D  R+  ++K         ++  + P +  L   IN  LTV+P++R +    +   WI
Sbjct:    9 RFSDNYDIKEELGKGAFSIVKRCVQKSTGFEFAAKIINTKKLTARDFQKLEREARICRKLHHPNIVRLHDSIQEENYHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESVNHCHQNGVVHRDLKPENLLLASKAKGAAVKLADFGLAI-------EVQGDHQAWFGFAGTPGYLSPEVLKKEPYGKSVDIWACGVILYILLVGYPPF-WDEDQHRLYSQIKAGAYDYPSPEWDTVTPEAKNL---INQMLTVNPNKRITAAEALKHPWI 272          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: CaMKII (gene:FBgn0264607 transcript:FBtr0300377)

HSP 1 Score: 112.849 bits (281), Expect = 5.853e-26
Identity = 81/275 (29.45%), Postives = 138/275 (50.18%), Query Frame = 3
Query: 1305 RGMEHFEFLQEKGRGAFGTVDLYQERISGNKFIVKKLNDVKCS------LYRDAFIGAKLSQSNLLRYSEVIKGQHSAHLAMPYMPGGTLSKHIYKGRCQNEEDIFKISYQILAQINKLHKLEIIHRDIKPDNIVL---DEGGNPKLIDFGLSRYTARLTNEDLSDKLAAY-FPGTINYMAPELIRVRPYSNKIDIWSFGMVLVEMVTRKPPFHWAADG-RITIELKK----MQKFKFKPIMPISDGLHQFINSCLTVDPSERPSGEHLIGSQWI 2084
            R  ++++  +E G+GAF  V    ++ +G +F  K +N  K +      L R+A I  KL   N++R  + I+ ++  +L    + GG L + I      +E D      QIL  +N  H+  ++HRD+KP+N++L    +G   KL DFGL+        E   D  A + F GT  Y++PE+++  PY   +DIW+ G++L  ++   PPF W  D  R+  ++K         ++  + P +  L   IN  LTV+P++R +    +   WI
Sbjct:    9 RFSDNYDIKEELGKGAFSIVKRCVQKSTGFEFAAKIINTKKLTARDFQKLEREARICRKLHHPNIVRLHDSIQEENYHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESVNHCHQNGVVHRDLKPENLLLASKAKGAAVKLADFGLAI-------EVQGDHQAWFGFAGTPGYLSPEVLKKEPYGKSVDIWACGVILYILLVGYPPF-WDEDQHRLYSQIKAGAYDYPSPEWDTVTPEAKNL---INQMLTVNPNKRITAAEALKHPWI 272          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: CaMKII (gene:FBgn0264607 transcript:FBtr0089217)

HSP 1 Score: 112.849 bits (281), Expect = 5.853e-26
Identity = 81/275 (29.45%), Postives = 138/275 (50.18%), Query Frame = 3
Query: 1305 RGMEHFEFLQEKGRGAFGTVDLYQERISGNKFIVKKLNDVKCS------LYRDAFIGAKLSQSNLLRYSEVIKGQHSAHLAMPYMPGGTLSKHIYKGRCQNEEDIFKISYQILAQINKLHKLEIIHRDIKPDNIVL---DEGGNPKLIDFGLSRYTARLTNEDLSDKLAAY-FPGTINYMAPELIRVRPYSNKIDIWSFGMVLVEMVTRKPPFHWAADG-RITIELKK----MQKFKFKPIMPISDGLHQFINSCLTVDPSERPSGEHLIGSQWI 2084
            R  ++++  +E G+GAF  V    ++ +G +F  K +N  K +      L R+A I  KL   N++R  + I+ ++  +L    + GG L + I      +E D      QIL  +N  H+  ++HRD+KP+N++L    +G   KL DFGL+        E   D  A + F GT  Y++PE+++  PY   +DIW+ G++L  ++   PPF W  D  R+  ++K         ++  + P +  L   IN  LTV+P++R +    +   WI
Sbjct:    9 RFSDNYDIKEELGKGAFSIVKRCVQKSTGFEFAAKIINTKKLTARDFQKLEREARICRKLHHPNIVRLHDSIQEENYHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESVNHCHQNGVVHRDLKPENLLLASKAKGAAVKLADFGLAI-------EVQGDHQAWFGFAGTPGYLSPEVLKKEPYGKSVDIWACGVILYILLVGYPPF-WDEDQHRLYSQIKAGAYDYPSPEWDTVTPEAKNL---INQMLTVNPNKRITAAEALKHPWI 272          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: CaMKII (gene:FBgn0264607 transcript:FBtr0089218)

HSP 1 Score: 112.849 bits (281), Expect = 5.853e-26
Identity = 81/275 (29.45%), Postives = 138/275 (50.18%), Query Frame = 3
Query: 1305 RGMEHFEFLQEKGRGAFGTVDLYQERISGNKFIVKKLNDVKCS------LYRDAFIGAKLSQSNLLRYSEVIKGQHSAHLAMPYMPGGTLSKHIYKGRCQNEEDIFKISYQILAQINKLHKLEIIHRDIKPDNIVL---DEGGNPKLIDFGLSRYTARLTNEDLSDKLAAY-FPGTINYMAPELIRVRPYSNKIDIWSFGMVLVEMVTRKPPFHWAADG-RITIELKK----MQKFKFKPIMPISDGLHQFINSCLTVDPSERPSGEHLIGSQWI 2084
            R  ++++  +E G+GAF  V    ++ +G +F  K +N  K +      L R+A I  KL   N++R  + I+ ++  +L    + GG L + I      +E D      QIL  +N  H+  ++HRD+KP+N++L    +G   KL DFGL+        E   D  A + F GT  Y++PE+++  PY   +DIW+ G++L  ++   PPF W  D  R+  ++K         ++  + P +  L   IN  LTV+P++R +    +   WI
Sbjct:    9 RFSDNYDIKEELGKGAFSIVKRCVQKSTGFEFAAKIINTKKLTARDFQKLEREARICRKLHHPNIVRLHDSIQEENYHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESVNHCHQNGVVHRDLKPENLLLASKAKGAAVKLADFGLAI-------EVQGDHQAWFGFAGTPGYLSPEVLKKEPYGKSVDIWACGVILYILLVGYPPF-WDEDQHRLYSQIKAGAYDYPSPEWDTVTPEAKNL---INQMLTVNPNKRITAAEALKHPWI 272          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: nek1 (NIMA-related kinase 1 [Source:ZFIN;Acc:ZDB-GENE-040730-1])

HSP 1 Score: 118.627 bits (296), Expect = 3.434e-29
Identity = 81/272 (29.78%), Postives = 135/272 (49.63%), Query Frame = 3
Query: 1311 MEHFEFLQEKGRGAFGTVDLYQERISGNKFIVKKL------NDVKCSLYRDAFIGAKLSQSNLLRYSEVIKGQHSAHLAMPYMPGGTLSKHI--YKGRCQNEEDIFKISYQILAQINKLHKLEIIHRDIKPDNIVLDEGGNPKLIDFGLSRYTARLTNEDLSDKLAAYFPGTINYMAPELIRVRPYSNKIDIWSFGMVLVEMVTRKPPFHWAADGRITIELKKMQKFKFKPI-MPISDGLHQFINSCLTVDPSERPSGEHLIGSQWIIDNLH 2099
            M+ +E L++ G G+FG   L + R  G ++++K++      N  +    ++  + A +S  N+++Y E  +     ++ M Y  GG L K I   +G    EE I     QI   +  +H  +I+HRDIK  NI L + G  +L DFG+    AR+ N  +  +LA    GT  Y++PE+   +PY+NK DIW+ G VL EM T K   H    G +   + K+ +  + P+ +  S  L   +      +P ERPS   ++   ++   +H
Sbjct:    1 MDKYERLKKIGEGSFGKAILVKSRTDGRQYVIKEIGISRMSNKERQESRKEVAVLANMSHPNIVQYKESFEESGCLYIVMDYCEGGDLFKKINNQRGSLFPEEQILDWFVQICLALKHVHDRKILHRDIKSQNIFLTKDGTVQLGDFGI----ARVLNSTV--ELARTCIGTPYYLSPEICENKPYNNKSDIWALGCVLYEMCTLK---HAFEAGNMKNLVLKIIRGSYPPVSIHYSPDLRSLLAQLFKRNPRERPSVSTILDKPFLARRIH 263          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: camk1db (calcium/calmodulin-dependent protein kinase 1Db [Source:ZFIN;Acc:ZDB-GENE-070112-1872])

HSP 1 Score: 118.242 bits (295), Expect = 3.206e-28
Identity = 77/272 (28.31%), Postives = 134/272 (49.26%), Query Frame = 3
Query: 1320 FEFLQEKGRGAFGTVDLYQERISGNKFIVK-----KLNDVKCSLYRDAFIGAKLSQSNLLRYSEVIKGQHSAHLAMPYMPGGTLSKHIYKGRCQNEEDIFKISYQILAQINKLHKLEIIHRDIKPDNIVL---DEGGNPKLIDFGLSRYTARLTNEDLSDKLAAYFPGTINYMAPELIRVRPYSNKIDIWSFGMVLVEMVTRKPPFHWAADGRITIELKKMQ-KFKFKPIMPISDGLHQFINSCLTVDPSERPSGEHLIGSQWIIDNLHMCK 2108
            FEF +  G GAF  V L QE+ +G+ + VK      L   +  +  +  +  K+   N++   ++ +     +L M  + GG L   I +     E+D   +  Q+L  +N LH L I+HRD+KP+N++     E     + DFGLS+       E  ++ + +   GT  Y+APE++  +PYS  +D WS G++   ++   PPF+   D ++  ++ K + +F       ISD    FIN+ +  DP +R + +  +   WI  +  +CK
Sbjct:   24 FEFKEILGTGAFSEVVLAQEKATGDMYAVKCIPKKALRGKESGIENEIAVLRKIKHENIVALEDIYESPSHLYLIMQLVSGGELFDRIVERGFYTEQDASALIKQVLDAVNYLHSLGIVHRDLKPENLLYFNPHEESKIMISDFGLSKM------EGAANDIMSTACGTPGYVAPEVLAQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDSKLFEQILKAEYEFDSPYWDDISDSAKDFINNLMQKDPEKRFTCDEALRHPWIAGDTALCK 289          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: camk1da (calcium/calmodulin-dependent protein kinase 1Da [Source:ZFIN;Acc:ZDB-GENE-080402-7])

HSP 1 Score: 118.242 bits (295), Expect = 8.611e-28
Identity = 81/274 (29.56%), Postives = 134/274 (48.91%), Query Frame = 3
Query: 1314 EHFEFLQEKGRGAFGTVDLYQERISGNKFIVK-----KLNDVKCSLYRDAFIGAKLSQSNLLRYSEVIKGQHSAHLAMPYMPGGTLSKHIYKGRCQNEEDIFKISYQILAQINKLHKLEIIHRDIKPDNIVL---DEGGNPKLIDFGLSRYTARLTNEDLSDKLAAYFPGTINYMAPELIRVRPYSNKIDIWSFGMVLVEMVTRKPPFHWAADGRITIE-LKKMQKFKFKPIMPISDGLHQFINSCLTVDPSERPSGEHLIGSQWIIDNLHMCK 2108
            E FEF +  G GAF  V L +ER +G  + VK      L   + S+  +  +  K+   N++   ++ +     +L M  + GG L   I +     E+D   +  Q+L  +N LH + I+HRD+KP+N++     +G    + DFGLS+       E   D ++    GT  Y+APE++  +PYS  +D WS G++   ++   PPF+   D ++  + LK   +F       ISD    FI+  +  DPS+R + E  +   WI  +  +CK
Sbjct:   23 EIFEFKEVLGTGAFSEVVLAEERSTGKMYAVKCIPKKALKGKESSIENEIAVLRKIKHENIVALEDIYESSDHLYLIMQLVSGGELFDRIVEKGFYTEKDASTLIRQVLDAVNYLHTMGIVHRDLKPENLLYFNPQDGSKIMISDFGLSKM------EGTGDVMSTAC-GTPGYVAPEVLAQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDSKLFEQILKADYEFDAPYWDDISDSAKDFISCLMEKDPSKRNTCEQALRHPWIAGDTALCK 289          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: camk1db (calcium/calmodulin-dependent protein kinase 1Db [Source:ZFIN;Acc:ZDB-GENE-070112-1872])

HSP 1 Score: 116.701 bits (291), Expect = 1.346e-27
Identity = 77/272 (28.31%), Postives = 134/272 (49.26%), Query Frame = 3
Query: 1320 FEFLQEKGRGAFGTVDLYQERISGNKFIVK-----KLNDVKCSLYRDAFIGAKLSQSNLLRYSEVIKGQHSAHLAMPYMPGGTLSKHIYKGRCQNEEDIFKISYQILAQINKLHKLEIIHRDIKPDNIVL---DEGGNPKLIDFGLSRYTARLTNEDLSDKLAAYFPGTINYMAPELIRVRPYSNKIDIWSFGMVLVEMVTRKPPFHWAADGRITIELKKMQ-KFKFKPIMPISDGLHQFINSCLTVDPSERPSGEHLIGSQWIIDNLHMCK 2108
            FEF +  G GAF  V L QE+ +G+ + VK      L   +  +  +  +  K+   N++   ++ +     +L M  + GG L   I +     E+D   +  Q+L  +N LH L I+HRD+KP+N++     E     + DFGLS+       E  ++ + +   GT  Y+APE++  +PYS  +D WS G++   ++   PPF+   D ++  ++ K + +F       ISD    FIN+ +  DP +R + +  +   WI  +  +CK
Sbjct:   24 FEFKEILGTGAFSEVVLAQEKATGDMYAVKCIPKKALRGKESGIENEIAVLRKIKHENIVALEDIYESPSHLYLIMQLVSGGELFDRIVERGFYTEQDASALIKQVLDAVNYLHSLGIVHRDLKPENLLYFNPHEESKIMISDFGLSKM------EGAANDIMSTACGTPGYVAPEVLAQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDSKLFEQILKAEYEFDSPYWDDISDSAKDFINNLMQKDPEKRFTCDEALRHPWIAGDTALCK 289          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: camk2g1 (calcium/calmodulin-dependent protein kinase (CaM kinase) II gamma 1 [Source:ZFIN;Acc:ZDB-GENE-050913-146])

HSP 1 Score: 118.242 bits (295), Expect = 2.365e-27
Identity = 82/282 (29.08%), Postives = 137/282 (48.58%), Query Frame = 3
Query: 1284 GIIIEMMRGMEHFEFLQEKGRGAFGTVDLYQERISGNKFIVKKLNDVKCS------LYRDAFIGAKLSQSNLLRYSEVIKGQHSAHLAMPYMPGGTLSKHIYKGRCQNEEDIFKISYQILAQINKLHKLEIIHRDIKPDNIVLD---EGGNPKLIDFGLSRYTARLTNEDLSDKLAAY-FPGTINYMAPELIRVRPYSNKIDIWSFGMVLVEMVTRKPPFHWAADGRITIELKKMQKFKFK-----PIMPISDGLHQFINSCLTVDPSERPSGEHLIGSQWI 2084
              I+   R  + ++  +E G+GAF  V    ++ +G ++  K +N  K S      L R+A I   L   N++R  + I  +   +L    + GG L + I      +E D      QIL  +N +H+ +I+HRD+KP+N++L    +G   KL DFGL+        E   D+ A + F GT  Y++PE++R  PY   +DIW+ G++L  ++   PPF W  D     +  K   + F       + P +  L   IN  LT++P++R + E  +   W+
Sbjct:    2 ATIVTSTRFTDEYQLYEELGKGAFSVVRRCVKKSTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCISQILESVNHIHQHDIVHRDLKPENLLLASKMKGAAVKLADFGLAI-------EVQGDQQAWFGFAGTPGYLSPEVLRKDPYGKPVDIWACGVILYILLVGYPPF-WDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAKNL---INQMLTINPAKRITAEQALKHPWV 272          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: banf1 (barrier to autointegration factor 1 [Source:Xenbase;Acc:XB-GENE-5745250])

HSP 1 Score: 115.931 bits (289), Expect = 4.831e-27
Identity = 79/252 (31.35%), Postives = 124/252 (49.21%), Query Frame = 3
Query: 1341 GRGAFGTVDLYQERISGNKFIVKKLNDVKC-----SLYRDAFIGAKLSQSNLLRYSEVIKGQHSAHLAMPYMPGGTLSKHI--YKGRCQNEEDIFKISYQILAQINKLHKLEIIHRDIKPDNIVLDEGGNPKLIDFGLSRYTARLTNEDLSDKLAAYFPGTINYMAPELIRVRPYSNKIDIWSFGMVLVEMVTRKPPFHWAADGRITIELKKMQKFKFKPI-MPISDGLHQFINSCLTVDPSERPSGEHLIG 2072
            G G+FG   L   + S +K+++K++   K         ++A + A +  SN++ + E  +G    ++ M Y  GG L + I   KGR   E+ I +   QI   +  +H+  ++HRDIK  NI L E  N KL DFG    +AR+     +   A  + GT  Y+ PE+    PY+NK DIWS G VL E+ T K PF   +   + +   K+ +  +KP+ +  S  L   IN     +P  RPS   ++ 
Sbjct:   13 GEGSFGRALLVCHKSSNHKYVMKEIRLPKSFHAMEDSRKEAVLLANMKHSNIVTFQESFEGDGHLYIVMEYCQGGDLLQKIKLQKGRLFTEQTILQWFVQICLAVQYIHEKRVLHRDIKSKNIFLTESCNIKLGDFG----SARILTSPAA--YACTYVGTPYYVPPEIWENMPYNNKSDIWSLGCVLYELCTLKHPFQAGSWKNLIL---KICQGSYKPLPLQYSYELRSLINQMFRKNPRSRPSASTILS 255          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: banf1 (barrier to autointegration factor 1 [Source:Xenbase;Acc:XB-GENE-5745250])

HSP 1 Score: 112.464 bits (280), Expect = 4.945e-27
Identity = 79/251 (31.47%), Postives = 125/251 (49.80%), Query Frame = 3
Query: 1347 GAFGTVDLYQERISGNKFIVKKLNDVKCSLY------RDAFIGAKLSQSNLLRYSEVIKGQHSAHLAMPYMPGGTLSKHI--YKGRCQNEEDIFKISYQILAQINKLHKLEIIHRDIKPDNIVLDEGGNPKLIDFGLSRYTARLTNEDLSDKLAAYFPGTINYMAPELIRVRPYSNKIDIWSFGMVLVEMVTRKPPFHWAADGRITIELKKMQKFKFKPI-MPISDGLHQFINSCLTVDPSERPSGEHLIG 2072
            G+FG   L   + S +K+++K++   K S +      ++A + A +  SN++ + E  +G    ++ M Y  GG L + I   KGR   E+ I +   QI   +  +H+  ++HRDIK  NI L E  N KL DFG    +AR+     +   A  + GT  Y+ PE+    PY+NK DIWS G VL E+ T K PF   +   + +   K+ +  +KP+ +  S  L   IN     +P  RPS   ++ 
Sbjct:   10 GSFGRALLVCHKSSNHKYVMKEIRLPK-SFHAMEDSRKEAVLLANMKHSNIVTFQESFEGDGHLYIVMEYCQGGDLLQKIKLQKGRLFTEQTILQWFVQICLAVQYIHEKRVLHRDIKSKNIFLTESCNIKLGDFG----SARILTSPAA--YACTYVGTPYYVPPEIWENMPYNNKSDIWSLGCVLYELCTLKHPFQAGSWKNLIL---KICQGSYKPLPLQYSYELRSLINQMFRKNPRSRPSASTILS 250          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: banf1 (barrier to autointegration factor 1 [Source:Xenbase;Acc:XB-GENE-5745250])

HSP 1 Score: 115.546 bits (288), Expect = 5.252e-27
Identity = 82/263 (31.18%), Postives = 129/263 (49.05%), Query Frame = 3
Query: 1311 MEHFEFLQEKGRGAFGTVDLY-QERISGNKFIVKKLNDVKC-----SLYRDAFIGAKLSQSNLLRYSEVIKGQHSAHLAMPYMPGGTLSKHI--YKGRCQNEEDIFKISYQILAQINKLHKLEIIHRDIKPDNIVLDEGGNPKLIDFGLSRYTARLTNEDLSDKLAAYFPGTINYMAPELIRVRPYSNKIDIWSFGMVLVEMVTRKPPFHWAADGRITIELKKMQKFKFKPI-MPISDGLHQFINSCLTVDPSERPSGEHLIG 2072
            ME +  ++  G G+FG   L   E  S +K+++K++   K         ++A + A +  SN++ + E  +G    ++ M Y  GG L + I   KGR   E+ I +   QI   +  +H+  ++HRDIK  NI L E  N KL DFG    +AR+     +   A  + GT  Y+ PE+    PY+NK DIWS G VL E+ T K PF   +   + +   K+ +  +KP+ +  S  L   IN     +P  RPS   ++ 
Sbjct:    1 MEQYNIVRVIGEGSFGRALLVIGEGSSNHKYVMKEIRLPKSFHAMEDSRKEAVLLANMKHSNIVTFQESFEGDGHLYIVMEYCQGGDLLQKIKLQKGRLFTEQTILQWFVQICLAVQYIHEKRVLHRDIKSKNIFLTESCNIKLGDFG----SARILTSPAA--YACTYVGTPYYVPPEIWENMPYNNKSDIWSLGCVLYELCTLKHPFQAGSWKNLIL---KICQGSYKPLPLQYSYELRSLINQMFRKNPRSRPSASTILS 254          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: banf1 (barrier to autointegration factor 1 [Source:Xenbase;Acc:XB-GENE-5745250])

HSP 1 Score: 115.161 bits (287), Expect = 9.855e-27
Identity = 79/252 (31.35%), Postives = 124/252 (49.21%), Query Frame = 3
Query: 1341 GRGAFGTVDLYQERISGNKFIVKKLNDVKC-----SLYRDAFIGAKLSQSNLLRYSEVIKGQHSAHLAMPYMPGGTLSKHI--YKGRCQNEEDIFKISYQILAQINKLHKLEIIHRDIKPDNIVLDEGGNPKLIDFGLSRYTARLTNEDLSDKLAAYFPGTINYMAPELIRVRPYSNKIDIWSFGMVLVEMVTRKPPFHWAADGRITIELKKMQKFKFKPI-MPISDGLHQFINSCLTVDPSERPSGEHLIG 2072
            G G+FG   L   + S +K+++K++   K         ++A + A +  SN++ + E  +G    ++ M Y  GG L + I   KGR   E+ I +   QI   +  +H+  ++HRDIK  NI L E  N KL DFG    +AR+     +   A  + GT  Y+ PE+    PY+NK DIWS G VL E+ T K PF   +   + +   K+ +  +KP+ +  S  L   IN     +P  RPS   ++ 
Sbjct:   11 GEGSFGRALLVCHKSSNHKYVMKEIRLPKSFHAMEDSRKEAVLLANMKHSNIVTFQESFEGDGHLYIVMEYCQGGDLLQKIKLQKGRLFTEQTILQWFVQICLAVQYIHEKRVLHRDIKSKNIFLTESCNIKLGDFG----SARILTSPAA--YACTYVGTPYYVPPEIWENMPYNNKSDIWSLGCVLYELCTLKHPFQAGSWKNLIL---KICQGSYKPLPLQYSYELRSLINQMFRKNPRSRPSASTILS 253          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: banf1 (barrier to autointegration factor 1 [Source:Xenbase;Acc:XB-GENE-5745250])

HSP 1 Score: 114.775 bits (286), Expect = 3.112e-26
Identity = 79/252 (31.35%), Postives = 124/252 (49.21%), Query Frame = 3
Query: 1341 GRGAFGTVDLYQERISGNKFIVKKLNDVKC-----SLYRDAFIGAKLSQSNLLRYSEVIKGQHSAHLAMPYMPGGTLSKHI--YKGRCQNEEDIFKISYQILAQINKLHKLEIIHRDIKPDNIVLDEGGNPKLIDFGLSRYTARLTNEDLSDKLAAYFPGTINYMAPELIRVRPYSNKIDIWSFGMVLVEMVTRKPPFHWAADGRITIELKKMQKFKFKPI-MPISDGLHQFINSCLTVDPSERPSGEHLIG 2072
            G G+FG   L   + S +K+++K++   K         ++A + A +  SN++ + E  +G    ++ M Y  GG L + I   KGR   E+ I +   QI   +  +H+  ++HRDIK  NI L E  N KL DFG    +AR+     +   A  + GT  Y+ PE+    PY+NK DIWS G VL E+ T K PF   +   + +   K+ +  +KP+ +  S  L   IN     +P  RPS   ++ 
Sbjct:   23 GEGSFGRALLVCHKSSNHKYVMKEIRLPKSFHAMEDSRKEAVLLANMKHSNIVTFQESFEGDGHLYIVMEYCQGGDLLQKIKLQKGRLFTEQTILQWFVQICLAVQYIHEKRVLHRDIKSKNIFLTESCNIKLGDFG----SARILTSPAA--YACTYVGTPYYVPPEIWENMPYNNKSDIWSLGCVLYELCTLKHPFQAGSWKNLIL---KICQGSYKPLPLQYSYELRSLINQMFRKNPRSRPSASTILS 265          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Aurkc (aurora kinase C [Source:MGI Symbol;Acc:MGI:1321119])

HSP 1 Score: 119.783 bits (299), Expect = 1.633e-29
Identity = 77/267 (28.84%), Postives = 129/267 (48.31%), Query Frame = 3
Query: 1320 FEFLQEKGRGAFGTVDLYQERISGNKFIVK---------KLNDVKCSLYRDAFIGAKLSQSNLLRYSEVIKGQHSAHLAMPYMPGGTLSKHIYKGRCQNEEDIFKISYQILAQINKLHKLEIIHRDIKPDNIVLDEGGNPKLIDFGLSRYTARLTNEDLSDKLAAYFPGTINYMAPELIRVRPYSNKIDIWSFGMVLVEMVTRKPPFHWAADGRITIELKKMQKFKFKPIMPISDGLHQFINSCLTVDPSERPSGEHLIGSQWIIDN 2093
            FE  +  GRG FG V  Y  R+  N FIV          +   ++  L R+  I A L   N+LR           +L + Y PGG L K + + +  +++    I  ++   +   H+ ++IHRDIKP+N++L   G  K+ DFG S +T  L  + +         GT++Y+ PE+I  +PY+  +D+W  G++  E++  KPPF  +        ++++  FKF   +P   G    I+  L   PSER S   ++   W+ ++
Sbjct:   16 FEIGRPLGRGKFGRV--YLARLKENHFIVALKVLFKSEIEKEGLEHQLRREVEIQAHLQHRNILRLYNYFYDDTRIYLILEYAPGGELYKELQRHQKLDQQRTATIIQELSDALTYCHEKKVIHRDIKPENLLLGLNGEVKISDFGWSVHTPSLRRKTMC--------GTLDYLPPEMIAQKPYNEMVDLWCIGVLCYELLVGKPPFESSTSSETYRRIRQVD-FKFPSSVPA--GAQDLISKLLRYHPSERLSLAQVLKHPWVREH 269          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Aurkc (aurora kinase C [Source:MGI Symbol;Acc:MGI:1321119])

HSP 1 Score: 119.783 bits (299), Expect = 1.633e-29
Identity = 77/267 (28.84%), Postives = 129/267 (48.31%), Query Frame = 3
Query: 1320 FEFLQEKGRGAFGTVDLYQERISGNKFIVK---------KLNDVKCSLYRDAFIGAKLSQSNLLRYSEVIKGQHSAHLAMPYMPGGTLSKHIYKGRCQNEEDIFKISYQILAQINKLHKLEIIHRDIKPDNIVLDEGGNPKLIDFGLSRYTARLTNEDLSDKLAAYFPGTINYMAPELIRVRPYSNKIDIWSFGMVLVEMVTRKPPFHWAADGRITIELKKMQKFKFKPIMPISDGLHQFINSCLTVDPSERPSGEHLIGSQWIIDN 2093
            FE  +  GRG FG V  Y  R+  N FIV          +   ++  L R+  I A L   N+LR           +L + Y PGG L K + + +  +++    I  ++   +   H+ ++IHRDIKP+N++L   G  K+ DFG S +T  L  + +         GT++Y+ PE+I  +PY+  +D+W  G++  E++  KPPF  +        ++++  FKF   +P   G    I+  L   PSER S   ++   W+ ++
Sbjct:   16 FEIGRPLGRGKFGRV--YLARLKENHFIVALKVLFKSEIEKEGLEHQLRREVEIQAHLQHRNILRLYNYFYDDTRIYLILEYAPGGELYKELQRHQKLDQQRTATIIQELSDALTYCHEKKVIHRDIKPENLLLGLNGEVKISDFGWSVHTPSLRRKTMC--------GTLDYLPPEMIAQKPYNEMVDLWCIGVLCYELLVGKPPFESSTSSETYRRIRQVD-FKFPSSVPA--GAQDLISKLLRYHPSERLSLAQVLKHPWVREH 269          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Aurkc (aurora kinase C [Source:MGI Symbol;Acc:MGI:1321119])

HSP 1 Score: 119.783 bits (299), Expect = 3.263e-29
Identity = 77/267 (28.84%), Postives = 129/267 (48.31%), Query Frame = 3
Query: 1320 FEFLQEKGRGAFGTVDLYQERISGNKFIVK---------KLNDVKCSLYRDAFIGAKLSQSNLLRYSEVIKGQHSAHLAMPYMPGGTLSKHIYKGRCQNEEDIFKISYQILAQINKLHKLEIIHRDIKPDNIVLDEGGNPKLIDFGLSRYTARLTNEDLSDKLAAYFPGTINYMAPELIRVRPYSNKIDIWSFGMVLVEMVTRKPPFHWAADGRITIELKKMQKFKFKPIMPISDGLHQFINSCLTVDPSERPSGEHLIGSQWIIDN 2093
            FE  +  GRG FG V  Y  R+  N FIV          +   ++  L R+  I A L   N+LR           +L + Y PGG L K + + +  +++    I  ++   +   H+ ++IHRDIKP+N++L   G  K+ DFG S +T  L  + +         GT++Y+ PE+I  +PY+  +D+W  G++  E++  KPPF  +        ++++  FKF   +P   G    I+  L   PSER S   ++   W+ ++
Sbjct:   55 FEIGRPLGRGKFGRV--YLARLKENHFIVALKVLFKSEIEKEGLEHQLRREVEIQAHLQHRNILRLYNYFYDDTRIYLILEYAPGGELYKELQRHQKLDQQRTATIIQELSDALTYCHEKKVIHRDIKPENLLLGLNGEVKISDFGWSVHTPSLRRKTMC--------GTLDYLPPEMIAQKPYNEMVDLWCIGVLCYELLVGKPPFESSTSSETYRRIRQVD-FKFPSSVPA--GAQDLISKLLRYHPSERLSLAQVLKHPWVREH 308          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Camk1d (calcium/calmodulin-dependent protein kinase ID [Source:MGI Symbol;Acc:MGI:2442190])

HSP 1 Score: 112.849 bits (281), Expect = 2.386e-26
Identity = 75/272 (27.57%), Postives = 132/272 (48.53%), Query Frame = 3
Query: 1320 FEFLQEKGRGAFGTVDLYQERISGNKFIVK-----KLNDVKCSLYRDAFIGAKLSQSNLLRYSEVIKGQHSAHLAMPYMPGGTLSKHIYKGRCQNEEDIFKISYQILAQINKLHKLEIIHRDIKPDNIVL---DEGGNPKLIDFGLSRYTARLTNEDLSDKLAAYFPGTINYMAPELIRVRPYSNKIDIWSFGMVLVEMVTRKPPFHWAADGRITIELKKMQ-KFKFKPIMPISDGLHQFINSCLTVDPSERPSGEHLIGSQWIIDNLHMCK 2108
            FEF +  G GAF  V L +E+ +G  F VK      L   + S+  +  +  K+   N++   ++ +  +  +L M  + GG L   I +     E+D   +  Q+L  +  LH++ I+HRD+KP+N++    DE     + DFGLS+   +         + +   GT  Y+APE++  +PYS  +D WS G++   ++   PPF+   D ++  ++ K + +F       ISD    FI + +  DP++R + E      WI  +  + K
Sbjct:   23 FEFKETLGTGAFSEVVLAEEKATGKLFAVKCIPKKALKGKESSIENEIAVLRKIKHENIVALEDIYESPNHLYLVMQLVSGGELFDRIVEKGFYTEKDASTLIRQVLDAVYYLHRMGIVHRDLKPENLLYYSQDEESKIMISDFGLSKMEGK-------GDVMSTACGTPGYVAPEVLAQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDSKLFEQILKAEYEFDSPYWDDISDSAKDFIRNLMEKDPNKRYTCEQAARHPWIAGDTALSK 287          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Camk2g (calcium/calmodulin-dependent protein kinase II gamma [Source:MGI Symbol;Acc:MGI:88259])

HSP 1 Score: 114.775 bits (286), Expect = 2.651e-26
Identity = 79/275 (28.73%), Postives = 135/275 (49.09%), Query Frame = 3
Query: 1305 RGMEHFEFLQEKGRGAFGTVDLYQERISGNKFIVKKLNDVKCS------LYRDAFIGAKLSQSNLLRYSEVIKGQHSAHLAMPYMPGGTLSKHIYKGRCQNEEDIFKISYQILAQINKLHKLEIIHRDIKPDNIVLD---EGGNPKLIDFGLSRYTARLTNEDLSDKLAAY-FPGTINYMAPELIRVRPYSNKIDIWSFGMVLVEMVTRKPPFHWAADGRITIELKKMQKFKFK-----PIMPISDGLHQFINSCLTVDPSERPSGEHLIGSQWI 2084
            R  + ++  +E G+GAF  V    ++ S  ++  K +N  K S      L R+A I   L   N++R  + I  +   +L    + GG L + I      +E D     +QIL  +N +H+ +I+HRD+KP+N++L    +G   KL DFGL+        E   ++ A + F GT  Y++PE++R  PY   +DIW+ G++L  ++   PPF W  D     +  K   + F       + P +  L   IN  LT++P++R + +  +   W+
Sbjct:    9 RFTDDYQLFEELGKGAFSVVRRCVKKTSTQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIHQILESVNHIHQHDIVHRDLKPENLLLASKCKGAAVKLADFGLAI-------EVQGEQQAWFGFAGTPGYLSPEVLRKDPYGKPVDIWACGVILYILLVGYPPF-WDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAKNL---INQMLTINPAKRITADQALKHPWV 272          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q55BN8|NEK2_DICDI (Probable serine/threonine-protein kinase nek2 OS=Dictyostelium discoideum OX=44689 GN=nek2 PE=1 SV=1)

HSP 1 Score: 129.798 bits (325), Expect = 6.706e-31
Identity = 94/274 (34.31%), Postives = 142/274 (51.82%), Query Frame = 3
Query: 1311 MEHFEFLQEKGRGAFGTVDLYQERISGNKFIVKKL------NDVKCSLYRDAFIGAKLSQSNLLRYSEVIKGQHSAHL--AMPYMPGGTLSKHIYKGRCQ----NEEDIFKISYQILAQINKLHKLE---IIHRDIKPDNIVLDEGGNPKLIDFGLSRYTARLTNEDLSDKLAAYFPGTINYMAPELIRVRPYSNKIDIWSFGMVLVEMVTRKPPFHWAADGRITIELKKMQKFKFKPI-MPISDGLHQFINSCLTVDPSERPSGEHLIGSQWI 2084
            M+ +E L   G+G+FG V   + +  G   + K++         K  L  +  I  KL   N++RY + I  + S+ L   M +  GG LS+ I K R +    +EE I++   QIL+ + ++H  +   I+HRDIKP N+ LDE  N KL DFGL    A++ NE L    A  F GT  YM+PE I    Y+ + D+WS G ++ EM T  PPF      ++T    K+Q  ++ PI    S+ L + I+  + VDP  RP+   L+G  +I
Sbjct:    1 MDQYEILGALGKGSFGVVSKIKRKEDGRVLVWKEICYENMQEKEKQLLVNEVNILQKLKHQNIVRYYDRIIDKPSSRLYIIMEHCSGGDLSQLIKKCRNERTYMDEEVIWRTLLQILSALQEIHNRKDGVILHRDIKPGNLFLDENKNIKLGDFGL----AKILNESL---YAHTFVGTPYYMSPEQIHGLKYNERSDVWSVGCLIYEMATLSPPFEATNQAQLT---SKIQVGRYNPIPSQYSEHLSKVISLMINVDPKSRPNVNELLGYSFI 264          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|O88445|AURKC_MOUSE (Aurora kinase C OS=Mus musculus OX=10090 GN=Aurkc PE=1 SV=2)

HSP 1 Score: 119.783 bits (299), Expect = 1.142e-28
Identity = 77/267 (28.84%), Postives = 129/267 (48.31%), Query Frame = 3
Query: 1320 FEFLQEKGRGAFGTVDLYQERISGNKFIVK---------KLNDVKCSLYRDAFIGAKLSQSNLLRYSEVIKGQHSAHLAMPYMPGGTLSKHIYKGRCQNEEDIFKISYQILAQINKLHKLEIIHRDIKPDNIVLDEGGNPKLIDFGLSRYTARLTNEDLSDKLAAYFPGTINYMAPELIRVRPYSNKIDIWSFGMVLVEMVTRKPPFHWAADGRITIELKKMQKFKFKPIMPISDGLHQFINSCLTVDPSERPSGEHLIGSQWIIDN 2093
            FE  +  GRG FG V  Y  R+  N FIV          +   ++  L R+  I A L   N+LR           +L + Y PGG L K + + +  +++    I  ++   +   H+ ++IHRDIKP+N++L   G  K+ DFG S +T  L  + +         GT++Y+ PE+I  +PY+  +D+W  G++  E++  KPPF  +        ++++  FKF   +P   G    I+  L   PSER S   ++   W+ ++
Sbjct:   16 FEIGRPLGRGKFGRV--YLARLKENHFIVALKVLFKSEIEKEGLEHQLRREVEIQAHLQHRNILRLYNYFYDDTRIYLILEYAPGGELYKELQRHQKLDQQRTATIIQELSDALTYCHEKKVIHRDIKPENLLLGLNGEVKISDFGWSVHTPSLRRKTMC--------GTLDYLPPEMIAQKPYNEMVDLWCIGVLCYELLVGKPPFESSTSSETYRRIRQVD-FKFPSSVPA--GAQDLISKLLRYHPSERLSLAQVLKHPWVREH 269          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6YY75|NEK6_ORYSJ (Serine/threonine-protein kinase Nek6 OS=Oryza sativa subsp. japonica OX=39947 GN=NEK6 PE=1 SV=2)

HSP 1 Score: 124.02 bits (310), Expect = 2.398e-28
Identity = 90/279 (32.26%), Postives = 146/279 (52.33%), Query Frame = 3
Query: 1311 MEHFEFLQEKGRGAFGTVDLYQERISGNKFIVKKL-----ND-VKCSLYRDAFIGAKLSQSNLLRYSE--VIKGQHSAHLAMPYMPGGTLSKHIYKGRCQ--NEEDIFKISYQILAQINKLHKLEIIHRDIKPDNIVLDEGGNPKLIDFGLSRYTARLTNEDLSDKLAAYFPGTINYMAPELIRVRPYSNKIDIWSFGMVLVEMVTRKPPFHWAADGRITIELKKMQKFKFKPIMPI-SDGLHQFINSCLTVDPSERPSGEHLIGSQWIIDNL-HMCKC 2111
            ME +E +++ GRGA+G+  L   +    ++++KK+     ND  + + Y++  + A LS   ++ Y +  V +G  SA +   Y  GG +++ I K R    +EE + +   Q+L  ++ LH   ++HRD+K  NI+L +  N +L DFGL    A+L  EDL    A+   GT NYM PE++   PY  K DIWS G  + E++  +P F  AAD  +   + K+ +    P+ PI S  L Q + S L  +P  RP+   L+   ++   L   C C
Sbjct:    1 MEQYEVVEQIGRGAYGSAYLVVHKGERKRYVMKKIRLSKQNDKFQRTAYQEMSLMASLSNPYIVEYKDGWVDEGT-SACIVTSYCEGGDMAERIKKARGVLFSEERVCRWFTQLLLALDYLHCNRVLHRDLKCSNILLTKDNNIRLADFGL----AKLLMEDL----ASTIVGTPNYMCPEILADIPYGYKSDIWSLGCCMFEILAHRPAFK-AAD--MASLINKINRSSISPMPPIYSSSLKQIVKSMLRKNPEHRPTAGELLRHPYLQPYLAESCSC 267          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q10056|SHK2_SCHPO (Serine/threonine-protein kinase shk2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=shk2 PE=3 SV=1)

HSP 1 Score: 119.398 bits (298), Expect = 1.104e-26
Identity = 84/266 (31.58%), Postives = 136/266 (51.13%), Query Frame = 3
Query: 1311 MEHFEFLQEKGRGAFGTVDLYQERISGNK------FIVKKLNDVKCSLYRDAFIG--AKLSQS---NLLRY--SEVIKGQHSAHLAMPYMPGGTLSKHIYKGRCQNEEDIFKISYQILAQINKLHKLEIIHRDIKPDNIVLDEGGNPKLIDFGLSRYTARLTNEDLSDKLAAYFPGTINYMAPELIRVRPYSNKIDIWSFGMVLVEMVTRKPPFHWAADGRITIELKKMQKFKFKPIMPISDGLHQFINSCLTVDPSERPSGEHLI 2069
            +E+F    + G+GA G+V  Y  ++ G K       +  K  D++C   ++  +     + +S   N++ Y  S +++ +H   + M YM  G+L+  I K +   E  I +I  +    I  LH   IIHRDIK DN++LD  GN K+ DFG   + ARL+N   ++K      GT  +MAPE+++   Y  K+DIWS G++++EM+  +PP+      R    + K      K    +S  L  F+NSCLT+D   R +   L+
Sbjct:  306 VEYFNVKHKLGQGASGSV--YLAKVVGGKQLGIFDSVAIKSIDLQCQTRKELILNEITVMRESIHPNIVTYLDSFLVRERH-LWVVMEYMNAGSLTDIIEKSKL-TEAQIARICLETCKGIQHLHARNIIHRDIKSDNVLLDNSGNIKITDFG---FCARLSNR--TNKRVTMV-GTPYWMAPEVVKQNEYGTKVDIWSLGIMIIEMIENEPPYLREDPIRALYLIAKNGTPTLKKPNLVSKNLKSFLNSCLTIDTIFRATAAELL 561          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q7YRC6|AURKB_BOVIN (Aurora kinase B OS=Bos taurus OX=9913 GN=AURKB PE=2 SV=1)

HSP 1 Score: 114.775 bits (286), Expect = 2.167e-26
Identity = 78/265 (29.43%), Postives = 126/265 (47.55%), Query Frame = 3
Query: 1311 MEHFEFLQEKGRGAFGTVDLYQERISGNKFIVKKL-------NDVKCSLYRDAFIGAKLSQSNLLRYSEVIKGQHSAHLAMPYMPGGTLSKHIYKGRCQNEEDIFKISYQILAQINKLHKLEIIHRDIKPDNIVLDEGGNPKLIDFGLSRYTARLTNEDLSDKLAAYFPGTINYMAPELIRVRPYSNKIDIWSFGMVLVEMVTRKPPFHWAADGRITIELKKMQKFKFKPIMPISDGLHQFINSCLTVDPSERPSGEHLIGSQWI 2084
            ++ FE  +  G+G FG V L +E+ S     +K L         V+  L R+  I A L   N+LR       +   +L + Y P G L K + K R  +E+    I  ++   +   H  ++IHRDIKP+N++L   G  K+ DFG S +   L  + +         GT++Y+ PE+I  R ++ K+D+W  G++  E++   PPF  A+       + K+   KF P +P+  G   FI   L  +PSER     +    W+
Sbjct:   74 IDDFEIGRPLGKGKFGNVYLAREKKSHFIVALKVLFKSQIEKEGVEHQLRREIEIQAHLQHPNILRLYNYFYDRRRIYLILEYAPRGELYKELQKSRTFDEQRTATIMEELADALTYCHAKKVIHRDIKPENLLLGLRGELKIADFGWSVHAPSLRRKTMC--------GTLDYLPPEMIEGRTHNEKVDLWCIGVLCYELLVGNPPFESASHNETYRRIVKVD-LKFPPSVPL--GAQDFIYKLLKHNPSERLPLAQVSAHPWV 327          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0BFM2 (Protein kinase domain-containing protein OS=Paramecium tetraurelia OX=5888 GN=GSPATT00028374001 PE=4 SV=1)

HSP 1 Score: 150.984 bits (380), Expect = 3.889e-36
Identity = 92/272 (33.82%), Postives = 142/272 (52.21%), Query Frame = 3
Query: 1290 IIEMMRGMEHFEFLQEKGRGAFGTVDLYQERISGNKFIVKKLNDVK----CS---LYRDAFIGAKLSQSNLLRYSEVIKGQHSAHLAMPYMPGGTLSKHIYKGRCQNEEDIFKISYQILAQINKLHKLEIIHRDIKPDNIVLDEGGNPKLIDFGLSRYTARLTNEDLSDKLAAYFPGTINYMAPELIRVRPYSNKIDIWSFGMVLVEMVTRKPPFHWAADGRITIELKKMQKFKFKPIMPISDGLHQFINSCLTVDPSERPSGEHLIGSQWI 2084
            +++   G +     Q  G+G+FG V L +E  +GN F +K +   +    C+   L R+  I  KL   N+++     + + + +L + Y  GG+L K I K R  +EE+ F   YQ    I  LHK++IIHRDIKP+N++LD  GN K+ DFG S            D L   F GTI YMAPE+I+ +  + K+DIW  G++L EMV  KPPF    D    + +   Q+ K++    +S+     I   L  +P  RPS + ++  +W+
Sbjct:   29 VLKTFEGSDFQSMQQTLGQGSFGWVTLVKEIKTGNLFAMKAMRKEELFKYCTVDNLKREIKIQRKLHHPNIIKLDSYFEDKTNVYLILEYAEGGSLFKKIKKERRLSEEEAFHYLYQTCLGIEYLHKMKIIHRDIKPENLLLDAKGNIKICDFGWSTEM---------DNLKKAFCGTIEYMAPEMIKSQSTNFKLDIWCLGVLLYEMVQGKPPFTGRNDQEKCVAILSGQQLKYEEF--VSEDCKALIAMILQANPFNRPSIQGILNHKWM 289          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0BWA1 (Protein kinase domain-containing protein OS=Paramecium tetraurelia OX=5888 GN=GSPATT00032670001 PE=4 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 1.143e-34
Identity = 96/295 (32.54%), Postives = 153/295 (51.86%), Query Frame = 3
Query: 1332 QEKGRGAFGTVDLYQERISGNKFIVKKLNDVK----CS---LYRDAFIGAKLSQSNLLRYSEVIKGQHSAHLAMPYMPGGTLSKHIYKGRCQNEEDIFKISYQILAQINKLHKLEIIHRDIKPDNIVLDEGGNPKLIDFGLSRYTARLTNEDLSDKLAAYFPGTINYMAPELIRVRPYSNKIDIWSFGMVLVEMVTRKPPFHWAADGRITIELKKMQKFKFKPIMPISDGLHQFINSCLTVDPSERPSGEHLIGSQWIIDNLHMCKCDDNT*WNNQYNSIQPNINHIRISEYSLS 2195
            Q  G+G+FG V L +E  +G  F +K +   +    C+   L R+  I  KL+  +++      + + + +L + Y  GG+L K I K R  +E++ +   YQ    I  LHK++IIHRDIKP+N++LD  GN K+ DFG S            D L   F GTI YMAPE+I+ +  + K+DIW  G++L EMV  KPPF    D    + +   Q+ K++    +S+     I   L  +P  RPS + ++  +W++          +  +N+Q NS   +I+ + + EYS S
Sbjct:    3 QTLGQGSFGWVTLVREIQTGKLFAMKAMKKAELFKYCTIDNLKREIKIQRKLNHPHIIDLDSYFEDKTNVYLILEYAEGGSLFKRIKKQRRLSEDEAYHYLYQTCLGIEYLHKMKIIHRDIKPENLLLDAKGNIKICDFGWSTEM---------DNLKKAFCGTIEYMAPEMIKSQSTNYKLDIWCLGVLLYEMVQGKPPFTGKNDQEKCVAILSGQQLKYEE--SVSEDCKSLIAMILQPNPFNRPSIQGILNHKWMLSK------QQSKSYNDQLNS--RSISMLMMEEYSHS 278          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0DG76 (Protein kinase domain-containing protein OS=Paramecium tetraurelia OX=5888 GN=GSPATT00002172001 PE=3 SV=1)

HSP 1 Score: 138.272 bits (347), Expect = 7.554e-32
Identity = 82/273 (30.04%), Postives = 146/273 (53.48%), Query Frame = 3
Query: 1275 FSQGIIIEMMRGMEHFEFLQEKGRGAFGTVDLYQERISGNKFIVKKLNDVKCSLYRDAFIGAKLSQSNLLRYSEVIKGQHSAHLAMPYMPGGTLSKHIYKGRCQNEEDI--FKISYQILAQINKLHKLEIIHRDIKPDNIVLDEGGNPKLIDFGLSRYTARLTNEDLSDKLAAYFPGTINYMAPELIRVRPYSNKIDIWSFGMVLVEMVTRKPPFHWAADGRITIELKKMQKFKFKPIMPISD-GLHQFINSCLTVDPSERPSGEHLIGSQWI 2084
              Q +I++    ++  + L++ G+G+FGTV  ++ +I G  + +KK+N  +CS  ++  I   L+  N++++   I+     ++ M Y   GTL+        QN E+   + I  Q+      LH+  IIHRD+KPDNI+LD+ GNPK+ DFGL+ Y + +++          F GT  +MAPE+I+  P + K+D+WS   +L  ++  KP       G    +++++  FK      I++  +   +N  L  DP ER S + ++ ++WI
Sbjct:   52 IEQAVIVDKQSVIKEMQLLEQIGQGSFGTV--HKIQIQGQLYALKKMNKNQCS--KEVRIHKHLNHKNIIQFHYFIEDDDYIYIVMEYASKGTLT--------QNRENCNFYNIFIQLCEATMYLHEKGIIHRDLKPDNILLDKNGNPKICDFGLATYESVISS----------FSGTFEFMAPEVIKNLPQTQKVDVWSLAAILYWLLENKP----LVQGNQIEKMQQILDFKSPQFTKITNPQIQDLLNQMLVPDPDERISLQGVLNNKWI 298          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0BZI1 (Protein kinase domain-containing protein OS=Paramecium tetraurelia OX=5888 GN=GSPATT00033801001 PE=4 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 2.780e-31
Identity = 87/272 (31.99%), Postives = 142/272 (52.21%), Query Frame = 3
Query: 1305 RGMEHFEFLQEK-GRGAFGTVDLYQERISGNKFIVKKLNDVK----CS---LYRDAFIGAKLSQSNLLRYSEVIKGQHSAHLAMPYMPGGTLSKHIYKGRCQNEEDIFKISYQILAQINKLHKLEIIHRDIKPDNIVLDEGGNPKLIDFGLSRYTARLTNEDLSDKLAAYFPGTINYMAPELIRVRPYSNKIDIWSFGMVLVEMVTRKPPFHWAADGRITIELKKMQKFKFKPIMPISDGLHQFINSCLTVDPSERPSGEHLIGSQWIIDNL 2096
            R +  F+ +Q+  G+G+FG V L +E  +G    +K +   +    C+   L R+  I  KL+  N+++     + + + +L + Y  GG+L K I K R  +E++     YQ    I+ LHK +IIHRDIKP+N++LD  GN K+ DFG   ++  + N      L   F GTI YMAPE+I+ +  + K+DIW  G++L EMV  KPPF    D      +      K+     +S+     I+  L  +P  RPS + ++  +W++  +
Sbjct:   64 RDISDFQAMQQTLGQGSFGWVTLVKEISTGKLLAMKAMKKAELFKYCTVDNLKREIKIQRKLNHPNIIKLDSYFEDKTNVYLVLEYAEGGSLFKQIKKQRHLSEDEASHYLYQTCLGIDYLHKQKIIHRDIKPENLLLDNKGNIKICDFG---WSTEMGN------LKKAFCGTIEYMAPEMIKSQSTNYKLDIWCLGVLLYEMVQGKPPFTGRNDQEKCQAILSGSPLKYDEY--VSEDCKSLISMILQQNPFNRPSIQGILSHRWMLSKI 324          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: B4NCW1 (Protein kinase domain-containing protein OS=Drosophila willistoni OX=7260 GN=Dwil\GK10114 PE=4 SV=1)

HSP 1 Score: 139.428 bits (350), Expect = 1.837e-30
Identity = 99/282 (35.11%), Postives = 152/282 (53.90%), Query Frame = 3
Query: 1305 RGMEHFEFLQEKGRGAFGTVDLYQERISGNKFIVKKLN-----DVKC-SLYRDAFIGAKLSQSNLLRYSE--VIKGQHSAHLAMPYMPGGTLSKHIYKGRCQN----EEDIFKISYQILAQI----NKLHKLEIIHRDIKPDNIVLDEGGNPKLIDFGLSRYTARLTNEDLSDKLAAYFPGTINYMAPELIRVRPYSNKIDIWSFGMVLVEMVTRKPPFHWAADGRITIEL-KKMQKFKFKPIMPI-SDGLHQFINSCLTVDPSERPSGEHLIGSQWIIDNL 2096
            + ++ +E L   G G FGT    +++I+G+ F  K +N     + KC SL  +  + ++L   N+++Y    V +   S ++ M    GG L++ I K R Q     E  I+++ +Q+   +    NK+    I+HRDIKP NI LDE GN KL DFGL+R  AR  N       AA F GT +YM+PEL++ R Y  K D+WS G ++ EM   +PPF     GR+  +L KK+ + +F  I  + S  L + I+  L+VD  ERP  E +I    ++ N+
Sbjct:   24 KTLQDYEVLAVMGNGTFGTCYKVRDKITGHLFAWKGMNYDELDEEKCDSLISEINVLSQLQHPNIVQYYHHLVNREAKSIYIVMECCAGGDLAQVIQKARKQKQRFEESYIWRVLFQLCRALQVCHNKIANGTILHRDIKPANIFLDERGNAKLGDFGLARMLARNQN------FAASFVGTPHYMSPELVKGRQYDRKSDVWSVGCLIYEMCALQPPFR----GRVFEQLTKKITQGEFNGIPKVFSSDLQEIISFMLSVDHEERPGIEVIIRHPLVVRNI 295          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: camk2g1 (calcium/calmodulin-dependent protein kinase type II subunit gamma-like [Source:NCBI gene;Acc:103032713])

HSP 1 Score: 119.783 bits (299), Expect = 5.583e-28
Identity = 82/282 (29.08%), Postives = 138/282 (48.94%), Query Frame = 3
Query: 1284 GIIIEMMRGMEHFEFLQEKGRGAFGTVDLYQERISGNKFIVKKLNDVKCS------LYRDAFIGAKLSQSNLLRYSEVIKGQHSAHLAMPYMPGGTLSKHIYKGRCQNEEDIFKISYQILAQINKLHKLEIIHRDIKPDNIVLD---EGGNPKLIDFGLSRYTARLTNEDLSDKLAAY-FPGTINYMAPELIRVRPYSNKIDIWSFGMVLVEMVTRKPPFHWAADGRITIELKKMQKFKFK-----PIMPISDGLHQFINSCLTVDPSERPSGEHLIGSQWI 2084
              I+   R  + ++  +E G+GAF  V    ++ +G ++  K +N  K S      L R+A I   L   N++R  + I  +   +L    + GG L + I      +E D  +   QIL  +N +H+ +I+HRD+KP+N++L    +G   KL DFGL+        E   D+ A + F GT  Y++PE++R  PY   +DIW+ G++L  ++   PPF W  D     +  K   + F       + P +  L   IN  LT++P++R + E  +   W+
Sbjct:    2 ATIVTSTRFTDEYQLYEELGKGAFSVVRRCVKKSTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSIAEEGFHYLVFDLVTGGELFEDIVAREYYSEADASQCINQILESVNHIHQHDIVHRDLKPENLLLASKMKGAAVKLADFGLAI-------EVQGDQQAWFGFAGTPGYLSPEVLRKDPYGKPVDIWACGVILYILLVGYPPF-WDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAKNL---INQMLTINPAKRITAEQALKHPWV 272          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: camk2g1 (calcium/calmodulin-dependent protein kinase type II subunit gamma-like [Source:NCBI gene;Acc:103032713])

HSP 1 Score: 119.783 bits (299), Expect = 7.900e-28
Identity = 82/282 (29.08%), Postives = 138/282 (48.94%), Query Frame = 3
Query: 1284 GIIIEMMRGMEHFEFLQEKGRGAFGTVDLYQERISGNKFIVKKLNDVKCS------LYRDAFIGAKLSQSNLLRYSEVIKGQHSAHLAMPYMPGGTLSKHIYKGRCQNEEDIFKISYQILAQINKLHKLEIIHRDIKPDNIVLD---EGGNPKLIDFGLSRYTARLTNEDLSDKLAAY-FPGTINYMAPELIRVRPYSNKIDIWSFGMVLVEMVTRKPPFHWAADGRITIELKKMQKFKFK-----PIMPISDGLHQFINSCLTVDPSERPSGEHLIGSQWI 2084
              I+   R  + ++  +E G+GAF  V    ++ +G ++  K +N  K S      L R+A I   L   N++R  + I  +   +L    + GG L + I      +E D  +   QIL  +N +H+ +I+HRD+KP+N++L    +G   KL DFGL+        E   D+ A + F GT  Y++PE++R  PY   +DIW+ G++L  ++   PPF W  D     +  K   + F       + P +  L   IN  LT++P++R + E  +   W+
Sbjct:    2 ATIVTSTRFTDEYQLYEELGKGAFSVVRRCVKKSTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSIAEEGFHYLVFDLVTGGELFEDIVAREYYSEADASQCINQILESVNHIHQHDIVHRDLKPENLLLASKMKGAAVKLADFGLAI-------EVQGDQQAWFGFAGTPGYLSPEVLRKDPYGKPVDIWACGVILYILLVGYPPF-WDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAKNL---INQMLTINPAKRITAEQALKHPWV 272          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: camk2g1 (calcium/calmodulin-dependent protein kinase type II subunit gamma-like [Source:NCBI gene;Acc:103032713])

HSP 1 Score: 119.398 bits (298), Expect = 8.811e-28
Identity = 82/282 (29.08%), Postives = 138/282 (48.94%), Query Frame = 3
Query: 1284 GIIIEMMRGMEHFEFLQEKGRGAFGTVDLYQERISGNKFIVKKLNDVKCS------LYRDAFIGAKLSQSNLLRYSEVIKGQHSAHLAMPYMPGGTLSKHIYKGRCQNEEDIFKISYQILAQINKLHKLEIIHRDIKPDNIVLD---EGGNPKLIDFGLSRYTARLTNEDLSDKLAAY-FPGTINYMAPELIRVRPYSNKIDIWSFGMVLVEMVTRKPPFHWAADGRITIELKKMQKFKFK-----PIMPISDGLHQFINSCLTVDPSERPSGEHLIGSQWI 2084
              I+   R  + ++  +E G+GAF  V    ++ +G ++  K +N  K S      L R+A I   L   N++R  + I  +   +L    + GG L + I      +E D  +   QIL  +N +H+ +I+HRD+KP+N++L    +G   KL DFGL+        E   D+ A + F GT  Y++PE++R  PY   +DIW+ G++L  ++   PPF W  D     +  K   + F       + P +  L   IN  LT++P++R + E  +   W+
Sbjct:    2 ATIVTSTRFTDEYQLYEELGKGAFSVVRRCVKKSTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSIAEEGFHYLVFDLVTGGELFEDIVAREYYSEADASQCINQILESVNHIHQHDIVHRDLKPENLLLASKMKGAAVKLADFGLAI-------EVQGDQQAWFGFAGTPGYLSPEVLRKDPYGKPVDIWACGVILYILLVGYPPF-WDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAKNL---INQMLTINPAKRITAEQALKHPWV 272          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: nek8 (NIMA related kinase 8 [Source:NCBI gene;Acc:103024333])

HSP 1 Score: 120.168 bits (300), Expect = 1.079e-27
Identity = 91/261 (34.87%), Postives = 134/261 (51.34%), Query Frame = 3
Query: 1311 MEHFEFLQEKGRGAFGTVDLYQERISGNKFIVKKLNDVKCSLYRDAFIGAK--------LSQSNLLRYSEVIKGQHSAHLAMPYMPGGTLSKHIYKGRCQ---NEEDIFKISYQILAQINKLHKLEIIHRDIKPDNIVLDEGGN-PKLIDFGLSRYTARLTNEDLSDKLAAY-FPGTINYMAPELIRVRPYSNKIDIWSFGMVLVEMVTRKPPFHWAADGRITIELKKMQKFKFKPIMP-ISDGLHQFINSCLTVDPSERP 2051
            ME +E ++  GRGAFG V L + R+ G   I+K++   +  + RD  + A+        L+  N++ Y E      +  +AM Y PGGTL+ +I K RC    +E+ I     QIL  +  +H   I+HRD+K  NI+LD+     K+ DFG+S+         L  K  AY   GT  Y++PEL   +PY+ K DIW+ G VL E+ + K  F  A    +   + K+    F PI    S  L Q I + L +DPS+RP
Sbjct:    1 MEKYEKIKVVGRGAFGIVHLCRRRVDGALVILKEIPVEQ--MTRDERLAAQNECQVLKLLNHPNIIEYYENFLEDKALMIAMEYAPGGTLADYIQK-RCNSLLDEDTILHFFVQILLALYHVHNKLILHRDLKTQNILLDKHQMIVKIGDFGISKI--------LVSKSKAYTVVGTPCYISPELCEGKPYNQKSDIWALGCVLYELASLKRAFEAA---NLPALVLKIMSGTFAPISDRYSPELRQLILTMLNLDPSKRP 247          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: camk2g1 (calcium/calmodulin-dependent protein kinase type II subunit gamma-like [Source:NCBI gene;Acc:103032713])

HSP 1 Score: 119.398 bits (298), Expect = 1.146e-27
Identity = 82/283 (28.98%), Postives = 138/283 (48.76%), Query Frame = 3
Query: 1284 GIIIEMMRGMEHFEFLQEKGRGAFGTVDLYQERISGNKFIVKKLNDVKCS------LYRDAFIGAKLSQSNLLRYSEVIKGQHSAHLAMPYMPGGTLSKHIYKGRCQNEEDIFKISYQILAQINKLHKLEIIHRDIKPDNIVLD---EGGNPKLIDFGLSRYTARLTNEDLSDKLAAY-FPGTINYMAPELIRVRPYSNKIDIWSFGMVLVEMVTRKPPFHWAADGRITIELKKMQKFKFK-----PIMPISDGLHQFINSCLTVDPSERPSGEHLIGSQWII 2087
              I+   R  + ++  +E G+GAF  V    ++ +G ++  K +N  K S      L R+A I   L   N++R  + I  +   +L    + GG L + I      +E D  +   QIL  +N +H+ +I+HRD+KP+N++L    +G   KL DFGL+        E   D+ A + F GT  Y++PE++R  PY   +DIW+ G++L  ++   PPF W  D     +  K   + F       + P +  L   IN  LT++P++R + E  +   W+ 
Sbjct:    2 ATIVTSTRFTDEYQLYEELGKGAFSVVRRCVKKSTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSIAEEGFHYLVFDLVTGGELFEDIVAREYYSEADASQCINQILESVNHIHQHDIVHRDLKPENLLLASKMKGAAVKLADFGLAI-------EVQGDQQAWFGFAGTPGYLSPEVLRKDPYGKPVDIWACGVILYILLVGYPPF-WDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAKNL---INQMLTINPAKRITAEQALKHPWVC 273          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008748.1 (pep scaffold:Pmarinus_7.0:GL476577:591:63029:-1 gene:ENSPMAG00000007907.1 transcript:ENSPMAT00000008748.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 114.775 bits (286), Expect = 6.568e-28
Identity = 81/281 (28.83%), Postives = 132/281 (46.98%), Query Frame = 3
Query: 1305 RGMEHFEFLQEKGRGAFGTVDLYQERISGNKFIVKKLNDVKCS------LYRDAFIGAKLSQSNLLRYSEVIKGQHSAHLAMPYMPGGTLSKHIYKGRCQNEEDIFKISYQILAQINKLHKLEIIHRDIKPDNIVLD---EGGNPKLIDFGLSRYTARLTNEDLSDKLAAY-FPGTINYMAPELIRVRPYSNKIDIWSFGMVLVEMVTRKPPFHWAADGRITIELKKMQKFKFKPIM--PISDGLHQFINSCLTVDPSERPSGEHLIGSQWIIDNLHMCKC 2111
            R  + ++  +E G+GAF  V    +  +G +F  K +N  K S      L R+A I   L  SN++R  E I  +   +L    + GG L + I      +E D      QIL  ++  H+  I+HRD+KP+N++L    +G   KL DFGL+        E   D+ A + F GT  Y++PE++R  PY   +D+W+ G++L  ++   PPF W  D     +  K   + F       ++      IN  LT++P++R +    +   WI     +  C
Sbjct:    9 RFTDEYQLYEELGKGAFSVVRRCVKVSTGQEFAAKIINTKKLSARDHQKLEREARICRLLKHSNIVRLHESIAEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILESVHHCHQHGIVHRDLKPENLLLASKMKGAAVKLADFGLA-------IEVQGDQQAWFGFAGTPGYLSPEVLRKDPYGKPVDMWACGVILYILLVGYPPF-WDEDQHKLYQQIKAGAYDFPSPEWDTVTAEAKNLINQMLTINPAKRITAAEALKHPWICQRSTVASC 281          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007414.1 (pep scaffold:Pmarinus_7.0:GL476981:230882:244405:1 gene:ENSPMAG00000006689.1 transcript:ENSPMAT00000007414.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 107.457 bits (267), Expect = 1.072e-25
Identity = 75/256 (29.30%), Postives = 128/256 (50.00%), Query Frame = 3
Query: 1311 MEHFEFLQEKGRGAFGTVDLYQERISGNKFIVKKLNDVKCS------LYRDAFIGAKLSQSNLLRYSEVIKGQHSAHLAMPYMPGGTLSKHI--YKGRCQNEEDIFKISYQILAQINKLHKLEIIHRDIKPDNIVLDEGGNPKLIDFGLSRYTARLTNEDLSDKLAAYFPGTINYMAPELIRVRPYSNKIDIWSFGMVLVEMVTRKPPFHWAADGRITIELKKMQKFKFKPIMP-ISDGLHQFINSCLTVDPSERP 2051
            ME +  + + G G+FG   L + +  G+ +++K++N  + S        ++  + A +   N++ Y E  + + + ++ M Y  GG L K I   KG   +E+ I     Q+   +  +H  +I+HRDIK  NI L + G  +L DFG+    AR+ N   + +LA    GT  Y++PE+   +PY++K D+W+ G VL EM T +   H    G +   + K+ +  F P+    S  L   ++  L  DP  RP
Sbjct:    1 MERYTMVSQIGEGSFGKAMLVKSKADGHLYVIKEINISRMSPKERDEARKEVCVLANMRHPNIVSYKESFEERGNLYIVMDYCEGGDLFKRINAQKGVLFSEDQILDWLVQLCLALKHVHDRKILHRDIKSQNIFLTKAGIVQLGDFGI----ARVLNS--TTELARTCIGTPYYLSPEICENKPYNHKSDMWALGCVLYEMCTLR---HAFEAGNMKNLVLKIIRGSFPPVSAHYSSELRSTLSGLLRRDPRARP 247          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: MARK3 (microtubule affinity regulating kinase 3 [Source:HGNC Symbol;Acc:HGNC:6897])

HSP 1 Score: 100.138 bits (248), Expect = 1.204e-22
Identity = 76/266 (28.57%), Postives = 138/266 (51.88%), Query Frame = 3
Query: 1317 HFEFLQEKGRGAFGTVDLYQERISGNKFIVKKLNDVKCS------LYRDAFIGAKLSQSNLLRYSEVIKGQHSAHLAMPYMPGGTLSKH-IYKGRCQNEEDIFKISYQILAQINKLHKLEIIHRDIKPDNIVLDEGGNPKLIDFGLSRYTARLTNE-DLSDKLAAYFPGTINYMAPELIRVRPYSN-KIDIWSFGMVLVEMVTRKPPFHWAADGRITIELK-KMQKFKFKPIMPISDGLHQFINSCLTVDPSERPSGEHLIGSQWI 2084
            ++  L+  G+G F  V L +  ++G +  VK ++  + +      L+R+  I   L+  N+++  EVI+ + + +L M Y  GG +  + +  GR + +E   K   QI++ +   H+  I+HRD+K +N++LD   N K+ DFG S       NE  L  KL   F G+  Y APEL + + Y   ++D+WS G++L  +V+   PF    DG+   EL+ ++ + K++    +S      +   L + P +R S E ++  +W+
Sbjct:   67 NYRLLKTIGKGNFAKVKLAKHTLTGQEVAVKIIDKTQLNTSSLQKLFREVRIMKVLNHPNIVKLFEVIEMEKTLYLVMEYSSGGEVFDYLVAHGRMKEKEARAKFR-QIVSAVQYCHQKHIVHRDLKAENLLLDADMNIKIADFGFS-------NEFTLGSKLDT-FCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPF----DGQNLKELRERVLRGKYRIPFYMSTDCENLLKRFLVLHPLKRGSLEQIMKDRWM 319          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004683.1 (pep scaffold:Pmarinus_7.0:GL488517:199:5283:1 gene:ENSPMAG00000004265.1 transcript:ENSPMAT00000004683.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 93.9745 bits (232), Expect = 1.691e-22
Identity = 50/133 (37.59%), Postives = 79/133 (59.40%), Query Frame = 3
Query: 1521 HLAMPYMPGGTLSKHIYKGRCQNEEDIFKISYQILAQINKLHKLEIIHRDIKPDNIVLDEGGNPKLIDFGLSRYTARLTNEDLSDKLAAY-FPGTINYMAPELIRVRPYSNKIDIWSFGMVLVEMVTRKPPFH 1916
            +L + ++ GG L   + K     EED+     ++   ++ LH L II+RD+KP+NI+LDE G+  L DFGLS+       E +  +  AY F GT+ YMAPE++  + +++  D WSFG+++ EM+T   PF 
Sbjct:    9 YLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALALDHLHSLGIIYRDLKPENILLDESGHIGLTDFGLSK-------ESIDHEKKAYSFCGTVEYMAPEVVNRKGHTHSADWWSFGVLMFEMLTGTLPFQ 134          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: snrka (SNF related kinase a [Source:ZFIN;Acc:ZDB-GENE-040718-84])

HSP 1 Score: 100.138 bits (248), Expect = 3.674e-22
Identity = 85/276 (30.80%), Postives = 130/276 (47.10%), Query Frame = 3
Query: 1320 FEFLQEKGRGAFGTVDLYQERISGNKFIVK-----KLNDVKCS-LYRDAFIGAKLSQ-SNLLRYSEVIKGQHSAHLAMPYMPGGTLSKHIYKGRCQNEEDIFKISY-QILAQINKLHKLEIIHRDIKPDNIV-LDEGGNPKLIDFGLSRYTARLTNEDLSDKLAAYFPGTINYMAPELIRVRPY-SNKIDIWSFGMVLVEMVTRKPPFHWAADGRITIELKKMQKFKFKPIMPISDGLHQFINSCLTVDPSERPSGEHLIGSQWI--IDNLHMCKC 2111
            ++  +  GRG F  V L +   +G K  VK     KL+ +  S L++      KL Q  N++R  EVI  Q   +L +    GG L  +I +     +E++ K  + Q++  I+  H+L ++HRD+KP+N+V  ++ G  KL DFG S      T      KLA    G++ Y APE++    Y +  +DIWS G++L  +V   PPF  A D      L  +   K+     IS      I   L  DP  R S + + G  W+  +D     KC
Sbjct:   16 YDLEKTLGRGHFAVVKLARHVFTGEKVAVKVIDKSKLDPMATSHLFQQEVRCMKLVQHPNVVRLYEVIDTQTKLYLILELADGGDLYDYIMRHEGGLQEELAKTYFAQVVHAISYCHRLHVVHRDLKPENVVFFEKQGLVKLTDFGFSNLFQPGT------KLATSC-GSLAYSAPEILLGDEYDAPAVDIWSLGVILYMLVCGHPPFQEANDSET---LTMIMDCKYTVPAHISRECKDLIARMLQRDPRRRASLQEMEGHPWLCGVDPSPAAKC 281          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: MKK2 (MAPKK involved in the protein kinase C signaling pathway; involved in control of cell integrity; upon activation by Bck1p phosphorylates downstream target, Slt2p; functionally redundant with Mkk1p; MKK2 has a paralog, MKK1, that arose from the whole genome duplication [Source:SGD;Acc:S000006061])

HSP 1 Score: 115.161 bits (287), Expect = 1.745e-27
Identity = 89/277 (32.13%), Postives = 138/277 (49.82%), Query Frame = 3
Query: 1341 GRGAFGTVDLYQERISGNKFIVKKLNDVKC------SLYRDAFIGAKLSQSNLLRYSEVIKGQHSA--HLAMPYMPGGTLS---KHIYK--GRCQNEEDIFKISYQILAQINKLHKLEIIHRDIKPDNIVLDEGGNPKLIDFGLSRYTARLTNEDLSDKLAAYFPGTINYMAPELIRVRPYSNKIDIWSFGMVLVEMVTRKPPFHWAADGRIT-----IELKKM-----QKFKFKPIMPI--SDGLHQFINSCLTVDPSERPSGEHLIGSQWIIDNL 2096
            G GA G+V   + +     F +K +N +         ++R+           +++Y  +   + S+  ++AM YM G +L    K++ K  GR  +E  I KI+  +L  ++ LH+ ++IHRDIKP NI+L+E G  KL DFG+S         +  + LA  F GT  YMAPE I+ +PYS   D+WS G+ L+E+   + PF      +IT     IEL  M      + K +P + I  S     FI+ CL  D  ERPS   ++   WI+  +
Sbjct:  221 GEGAGGSVAKCRLKNGKKVFALKTINTMNTDPEYQKQIFRELQFNKSFKSDYIVQYYGMFTDEQSSSIYIAMEYMGGKSLEATYKNLLKRGGRI-SERVIGKIAESVLRGLSYLHERKVIHRDIKPQNILLNEKGEIKLCDFGVS--------GEAVNSLAMTFTGTSFYMAPERIQGQPYSVTCDVWSLGLTLLEVAGGRFPFE---SDKITQNVAPIELLTMILTFSPQLKDEPELDISWSKTFRSFIDYCLKKDARERPSPRQMLKHPWIVGQM 485          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: CDC15 (Protein kinase of the Mitotic Exit Network; localized to the spindle pole bodies at late anaphase; promotes mitotic exit by directly switching on the kinase activity of Dbf2p; required for spindle disassembly after meiosis II; relocalizes to the cytoplasm upon DNA replication stress [Source:SGD;Acc:S000000072])

HSP 1 Score: 113.62 bits (283), Expect = 2.709e-26
Identity = 78/286 (27.27%), Postives = 135/286 (47.20%), Query Frame = 3
Query: 1260 SERDRFSQGIIIEMMRGMEHFEFLQEKGRGAFGTV----DLYQERISGNKFIV----KKLNDVKCSLYRDAFIGAKLSQSNLLRYSEVIKGQHSAHLAMPYMPGGTLSKHIYK---GRCQNEEDIFKISYQILAQINKLHKLEIIHRDIKPDNIVLDEGGNPKLIDFGLSRYTARLTNEDLSDKLAAYFPGTINYMAPELIRVRPYSNKIDIWSFGMVLVEMVTRKPPFHWAADGRITIELKKMQKFKFKPIMPISDGLHQFINSCLTVDPSERPSGEHLIGSQWI 2084
            ++ DR +   I         +   Q  GRG++G V    + + +++   K +V    ++LND+   +     +   L+ +N+++Y   I+  +  ++ + Y   G+L + I +   G  +NE   +    Q L  +  LH   +IHRDIK  NI+L      KL DFG+S          + +  A    GT+N+MAPE++  R  S   DIWS G  +VEM+T+ PP+H   D  I      ++   + P    S+ L  F++ C   +  +RP+ + L+   WI
Sbjct:    5 ADTDRVNLTPIQRASEKSVQYHLKQVIGRGSYGVVYKAINKHTDQVVAIKEVVYENDEELNDIMAEIS----LLKNLNHNNIVKYHGFIRKSYELYILLEYCANGSLRRLISRSSTGLSENESKTYVT--QTLLGLKYLHGEGVIHRDIKAANILLSADNTVKLADFGVST---------IVNSSALTLAGTLNWMAPEILGNRGASTLSDIWSLGATVVEMLTKNPPYHNLTDANI---YYAVENDTYYPPSSFSEPLKDFLSKCFVKNMYKRPTADQLLKHVWI 272          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: MKK1 (MAPKK involved in the protein kinase C signaling pathway; involved in control of cell integrity; upon activation by Bck1p phosphorylates downstream target, Slt2p; functionally redundant with Mkk2p; MKK1 has a paralog, MKK2, that arose from the whole genome duplication [Source:SGD;Acc:S000005757])

HSP 1 Score: 106.301 bits (264), Expect = 1.499e-24
Identity = 86/283 (30.39%), Postives = 133/283 (47.00%), Query Frame = 3
Query: 1314 EHFEFLQEKGRGAFGTVDLYQERISGNKFIVKKLNDVKC------SLYRDAFIGAKLSQSNLLRYSEVIKGQH--SAHLAMPYMPGGTLSKHIYK------GRCQNEEDIFKISYQILAQINKLHKLEIIHRDIKPDNIVLDEGGNPKLIDFGLSRYTARLTNEDLSDKLAAYFPGTINYMAPELIRVRPYSNKIDIWSFGMVLVEMVTRKPPFHWAADGRITIELKKMQ----------KFKFKPIMPI--SDGLHQFINSCLTVDPSERPSGEHLIGSQWI 2084
            +  E L   G GA G+V   + +     F +K +N +         ++R+           ++RY  +       S ++AM YM G +L   IYK      GR  +E+ + KI+  +L  ++ LH+ ++IHRDIKP NI+L+E G  KL DFG+S         +  + LA  F GT  YMAPE I+ +PYS   D+WS G+ ++E+   K P    +  ++   +   +          + K +P   I  S     FI+ CL  D  ERPS   +I   WI
Sbjct:  219 DRIETLGILGEGAGGSVSKCKLKNGSKIFALKVINTLNTDPEYQKQIFRELQFNRSFQSEYIVRYYGMFTDDENSSIYIAMEYMGGRSLDA-IYKNLLERGGRI-SEKVLGKIAEAVLRGLSYLHEKKVIHRDIKPQNILLNENGQVKLCDFGVS--------GEAVNSLATTFTGTSFYMAPERIQGQPYSVTSDVWSLGLTILEVANGKFP---CSSEKMAANIAPFELLMWILTFTPELKDEPESNIIWSPSFKSFIDYCLKKDSRERPSPRQMINHPWI 488          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: YPL150W_mRNA (Protein kinase of unknown cellular role; binds phosphatidylinositols and cardiolipin in a large-scale study [Source:SGD;Acc:S000006071])

HSP 1 Score: 106.686 bits (265), Expect = 3.416e-24
Identity = 73/247 (29.55%), Postives = 119/247 (48.18%), Query Frame = 3
Query: 1317 HFEFLQEKGRGAFGTVDLYQERISGNKFIVKKLNDVKCSLYRDAFIGAKLSQSNLLRYSEVIKGQHSAHLAMPYMPGGTLSKHIYKGRCQNEEDIFKISYQILAQINKLHKLEIIHRDIKPDNIVLDEGGNPKLIDFGLSRYTARLTNEDLSDKLAAYFPGTINYMAPELIRVRPYSN-KIDIWSFGMVLVEMVTRKPPFHWAADGRITIELKKMQKFKFKPIMPISDGLHQFINSCLTVDPSERPS 2054
            +++ L++ G G+FG V L   R +  K  +K  +    ++ R+ F   +     + +  EVI  +    +A+ Y PG  L  H+   R  +  +  ++  QI   +   H +  +HRD+K +NI+LD+ GN KL DFG +R       E ++        GT  YMAPELI  R Y   KIDIWS G++L  ++T   PF    + +   ++   +      ++P  D     I+  L  +P ERPS
Sbjct:   40 NYKILKQIGEGSFGKVYLALHRPTHRKVCLKTSDKNDPNIVREVFYHRQFDFPYITKLYEVIVTESKVWMALEYCPGKELYDHLLSLRRISLLECGELFAQISGAVYYAHSMHCVHRDLKLENILLDKNGNAKLTDFGFTR-------ECMTKTTLETVCGTTVYMAPELIERRTYDGFKIDIWSLGVILYTLITGYLPFDDDDEAKTKWKIVNEEPKYDAKVIP--DDARDLISRLLAKNPGERPS 277          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: RAD53 (DNA damage response protein kinase; required for cell-cycle arrest, regulation of copper genes in response to DNA damage; phosphorylates nuclear pores to counteract gene gating, preventing aberrant transitions at forks approaching transcribed genes; activates downstream kinase Dun1p; differentially senses mtDNA depletion, mitochondrial ROS; relocalizes to cytosol under hypoxia; human homolog CHEK2 implicated in breast cancer can complement yeast null mutant [Source:SGD;Acc:S000006074])

HSP 1 Score: 105.145 bits (261), Expect = 1.026e-23
Identity = 80/276 (28.99%), Postives = 130/276 (47.10%), Query Frame = 3
Query: 1341 GRGAFGTVDLYQERISGNKFIVKKLNDVKC-----SLYRDAFIGAKLSQSNLLRYSEVIKGQHSAHLAMPYMPGGTLSKHIYKGRCQNEEDIFKISYQILAQINKLHKLEIIHRDIKPDNIVLDEGGNP---KLIDFGLSRYTARLTNEDLSDKLAAYFPGTINYMAPELIR-----VRP--------YSNKIDIWSFGMVLVEMVTRKPPFHWAAD-------GRITIELKKMQKFKFKPIMPISDGLHQFINSCLTVDPSERPSGEHLIGSQWI 2084
            G+GAF TV    ER +G  F VK ++  K       + R+  +  KL+   ++R     +   S ++ M ++ GG L   +       E+   +IS QIL  I  +H + I HRD+KPDNI++++  +P   K+ DFGL++          +      F GT+ Y+APE+IR     V P        YS+ +D+WS G ++  ++T   PF  +         GR +     ++ F+      IS+    FI+S L VDP+ R +    +   WI
Sbjct:  205 GQGAFATVKKAIERTTGKTFAVKIISKRKVIGNMDGVTRELEVLQKLNHPRIVRLKGFYEDTESYYMVMEFVSGGDLMDFVAAHGAVGEDAGREISRQILTAIKYIHSMGISHRDLKPDNILIEQ-DDPVLVKITDFGLAKVQG-------NGSFMKTFCGTLAYVAPEVIRGKDTSVSPDEYEERNEYSSLVDMWSMGCLVYVILTGHLPFSGSTQDQLYKQIGRGSYHEGPLKDFR------ISEEARDFIDSLLQVDPNNRSTAAKALNHPWI 466          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO40703 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6E0])

HSP 1 Score: 115.546 bits (288), Expect = 2.030e-28
Identity = 81/279 (29.03%), Postives = 136/279 (48.75%), Query Frame = 3
Query: 1320 FEFLQEKGRGAFGTVDLYQERISGNKFIVKKLNDVKCS------LYRDAFIGAKLSQSNLLRYSEVIKGQHSAHLAMPYMPGGTLSKHIYKGRCQNEEDIFKISYQILAQINKLHKLEIIHRDIKPDNIVL-----DEGGNPKLIDFGLSRYTARLTNEDLSDKLAAYFPGTINYMAPELIRVRPYSNKIDIWSFGMVLVEMVTRKPPFHWAADGRITIELKKMQKFKFKPIMPISDGLHQFINSC--------LTVDPSERPSGEHLIGSQWIIDNLH 2099
            +EF Q  GRG+FG V+  +   +G ++ +K +N  K        L R+  I  K+   +L+   E+ +     +L M     G L K + + +   E++ + +  Q+++ +  LH L+I+HRD+K +NI+L     +E  N K+ DFGLS     +     SD +     GT  YMAPE+I    YS + D+WS G+++  + T +PPF   AD       +K+ +   K I+  SD   +  +          L VDP+ R + + ++   WI  N H
Sbjct:   27 YEFGQVLGRGSFGVVNEAKHIETGTRWAIKAVNKEKAGSSAVKLLEREVMIMKKIYHEHLIHLEEIYETSKRMYLVMELCDAGGLDKMLERKKRFTEKETWTVIKQLVSAVAYLHDLDIVHRDLKLENILLSHPTGNELLNVKITDFGLSIVKGGVG----SDSMMQSVCGTPMYMAPEVIDDLGYSQQCDVWSIGVIMYTLFTGRPPF--MADTE-----EKLYEIIKKGIVDFSDPCWEVCHESAKNLLLGMLKVDPAHRRTAKEVLIHPWITVNTH 294          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO41410 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4G7])

HSP 1 Score: 114.39 bits (285), Expect = 2.585e-28
Identity = 86/269 (31.97%), Postives = 130/269 (48.33%), Query Frame = 3
Query: 1341 GRGAFGTVDLYQERISGNKFIVKKL----------NDVKCSLYRDAFIGAKLSQSNLLRYSEVIKGQHSAHLAMPYMPGGTLSKHIYKGRCQNEEDIFKISYQILAQINKLHKLEIIHRDIKPDNIVLDEGGNPKLIDFGLSRYTARLTNEDLSDKLAAYFPGTINYMAPELIRVRPYSNKIDIWSFGMVLVEMVTRKPPFHWAADGRITIELKKMQKFKFKPIMP--ISDGLHQFINSCLTVDPSERPSGEHLIGSQWIIDNLHMCKC 2111
            G GAFG V +  +  +G +  VK++          N+VK       F+ A      +++Y  +       ++ M Y+PGG++ +HI +    NE    K S QIL  I  LH   I+HRDIK  NI+ D  GN KL DFG S+    + ++     +     GT  +MAPE+I    Y  K D+WS G  +VEM+T KPP+   AD      L K+     +P +P  +S    +F+ S L ++   RPS + L+   ++  N  M  C
Sbjct:   11 GAGAFGQVYMCHDLDTGRELAVKQIETGQLNSSTKNEVKALEGEIEFMKA-FRNERIVQYYGIETDDLHIYIFMEYLPGGSIHEHIKQHGALNESLTRKYSRQILEGILYLHTNRIVHRDIKGANILRDLYGNVKLADFGASKRLQTIRSKTGFRSVH----GTPYWMAPEVINGEGYGRKADVWSVGCTVVEMLTTKPPW---ADFEPMAALFKIATQPTEPELPSDLSVDAVEFVRSTLRMNSKSRPSADELLRFSFVT-NSSMSTC 270          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO49822 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG20])

HSP 1 Score: 110.153 bits (274), Expect = 9.518e-27
Identity = 76/267 (28.46%), Postives = 131/267 (49.06%), Query Frame = 3
Query: 1311 MEHFEFLQEKGRGAFGTVDLYQERISGNKFIVKKLNDVKCSLY------RDAFIGAKLSQSNLLRYSEVIKGQHSAHLAMPYMPGGTLSKHI--YKGRCQNEEDIFKISYQILAQINKLHKLEIIHRDIKPDNIVLDEGGNPKLIDFGLSRYTARLTNEDLSDKLAAYFPGTINYMAPELIRVRPYSNKIDIWSFGMVLVEMVTRKPPFHWAADGRITIELKKMQKFKFKPI-MPISDGLHQFINSCLTVDPSERPSGEHLIGSQWI 2084
            ME +  +++ G G+FG   L ++R  G  +++K++N  +          ++  + ++L   N++ Y E  +   + ++ M Y  GG L K I   +G   +E+ +     QI   +  +H  +I+HRDIK  NI L   G  K+ DFG++R            +LA    GT  Y++PE++  RPY+NK DIWS G VL EM+T K  F       + +   K+ +  + PI +  S  +   +   L  +P +RPS   ++   +I
Sbjct:    1 MERYVRVKKIGEGSFGKALLVKKRNDGKHYVIKEINICRMKPREREESRKEVKVLSQLKHPNIVSYQESFEESGNLYIVMDYCDGGDLYKKINGQRGIAFSEDQVMDWFVQICLGLKHVHDRKILHRDIKSQNIFLTRHGIIKMGDFGIARVLHSTV------ELARTCIGTPYYLSPEIVENRPYNNKSDIWSLGCVLYEMLTLKHAFEAGNMKNLVL---KIIRGSYPPIPLRYSADIRMLVAQLLKRNPHDRPSVNTVLKKNFI 258          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO37413 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFU9])

HSP 1 Score: 108.997 bits (271), Expect = 2.329e-26
Identity = 82/272 (30.15%), Postives = 138/272 (50.74%), Query Frame = 3
Query: 1320 FEFLQEKGRGAFGTVDLYQERISGNKFIVKKLNDVKCS------LYRDAFIGAKLSQSNLLRYSEVI--KGQHSAHLAMPYMPGGTL----SKHIYKGRCQNEEDIFKISYQILAQINKLHKLE----IIHRDIKPDNIVLDEGGNPKLIDFGLSRYTARLTNEDLSDKLAAYFPGTINYMAPELIRVRPYSNKIDIWSFGMVLVEMVTRKPPFHWAADGRITIELKKMQKFKFKPIMP-ISDGLHQFINSCLTVDPSERPSGEHLIGSQWI 2084
            +E L+  G G++G     + +      + K+L+  + S      L  +  +  +L   +++RY + I  +   + ++ M +   G L     KH  + R   E+ ++K+ YQ++  + + H+ +    ++HRD+KP N+ LD   N KL DFGL    AR+ + D S   A  F GT  YM+PE +  R Y+ K DIWS G ++ E+    PPF   A  +I +E  K++  +F PI    S  L Q INS L V+   RPS + L+ + ++
Sbjct:    9 YEELERIGSGSYGICKKIRRKKDNKVLVWKELDYGQMSETEKQMLVSEVNLLRELKHPHIVRYYDRIIDRTNTTIYIVMEFCENGDLGALIKKHKREKRYTAEDLVWKLLYQLVLAVQECHRRKDGGHVLHRDLKPANVFLDANMNVKLGDFGL----ARVLSHDTS--FAKTFVGTPYYMSPEQVNKRSYNEKSDIWSLGCLMYELCALSPPF--TAMDQIRLE-AKIKVGRFHPIPSHYSSSLSQLINSMLQVNDEMRPSIDELLRNPYL 271          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO36253 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJ85])

HSP 1 Score: 107.842 bits (268), Expect = 8.527e-26
Identity = 72/257 (28.02%), Postives = 125/257 (48.64%), Query Frame = 3
Query: 1341 GRGAFGTVDLYQERISGNKFIVK-----KLNDVKCSLYRDAFIGAKLSQSNLLRYSEVIKGQHSAHLAMPYMPGGTLSKHIYKGRCQNEEDIFKISYQILAQINKLHKLEIIHRDIKPDNIVL---DEGGNPKLIDFGLSRYTARLTNEDLSDKLAAYFPGTINYMAPELIRVRPYSNKIDIWSFGMVLVEMVTRKPPFHWAADGRITIELKKMQ-KFKFKPIMPISDGLHQFINSCLTVDPSERPSGEHLIGSQWI 2084
            G GAF  V L +E+ +G+ F VK     +L   + S+  +  I  K+   N++   ++   +   +L M  + GG L   I +     E+D   +  QIL   + LH L I+HRD+KP+N++    DE     + DFGLS+  A+ +  D +        GT  Y+APE+++ +PY   +D WS G++   ++   PPF+  +D  +  ++ + + +F       IS+    FI   + +DP  R +    +   WI
Sbjct:   24 GTGAFSEVVLAEEKATGSLFAVKCISKKELKGKEESVENEIAILKKVRHKNIIGLKDIFDNKSHLYLVMDLVQGGELFDRIVEKGNYTEQDASALVQQILEAADYLHSLGIVHRDLKPENLLYYSPDEDSKIMISDFGLSKIEAQGSFMDTA-------CGTPGYVAPEVLKQQPYGKAVDCWSIGVITYILLCGYPPFYDDSDANLFAQIMRAEYEFDSPYWDEISESAKDFIRHLMELDPKLRYTCRQALSHPWI 273          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: camk1da (calcium/calmodulin dependent protein kinase ID [Source:NCBI gene;Acc:101162588])

HSP 1 Score: 117.087 bits (292), Expect = 1.477e-27
Identity = 82/275 (29.82%), Postives = 135/275 (49.09%), Query Frame = 3
Query: 1320 FEFLQEKGRGAFGTVDLYQERISGNKFIVK-----KLNDVKCSLYRDAFIGAKLSQSNLLRYSEVIKGQHSAHLAMPYMPGGTLSKHIYKGRCQNEEDIFKISYQILAQINKLHKLEIIHRDIKPDNIVLDEGGNPK------LIDFGLSRYTARLTNEDLSDKLAAYFPGTINYMAPELIRVRPYSNKIDIWSFGMVLVEMVTRKPPFHWAADGRITIE-LKKMQKFKFKPIMPISDGLHQFINSCLTVDPSERPSGEHLIGSQWIIDNLHMCK 2108
            F+F +  G GAF  V L QE++SG  F VK      L   + S+  +  +  K+   N++   ++ +     +L M  + GG L   I +     E+D   +  Q+L  +N LHKL I+HRD+KP+N++     NP+      + DFGLS+          S  + +   GT  Y+APE++  +PYS  +D WS G++   ++   PPF+   D ++  + LK   +F       ISD    FI+  +  DP++R + E  +   WI  +  +CK
Sbjct:   25 FDFKEVLGTGAFSEVVLAQEKLSGRMFAVKCIPKKALKGKESSIENEIAVLRKIKHENIVALEDIYESPDHLYLIMQLVSGGELFDRIVEKGFYTEKDASTLIRQVLDAVNYLHKLGIVHRDLKPENLLY---FNPQDESKIMISDFGLSKMEG-------SGDVMSTACGTPGYVAPEVLAQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDSKLFEQILKADYEFDAPYWDDISDSAKDFISCLMEKDPAKRFTCEQALRHPWIAGDTALCK 289          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000013395.2 (calcium/calmodulin-dependent protein kinase type II subunit gamma [Source:NCBI gene;Acc:101170226])

HSP 1 Score: 117.857 bits (294), Expect = 2.521e-27
Identity = 82/275 (29.82%), Postives = 135/275 (49.09%), Query Frame = 3
Query: 1305 RGMEHFEFLQEKGRGAFGTVDLYQERISGNKFIVKKLNDVKCS------LYRDAFIGAKLSQSNLLRYSEVIKGQHSAHLAMPYMPGGTLSKHIYKGRCQNEEDIFKISYQILAQINKLHKLEIIHRDIKPDNIVLD---EGGNPKLIDFGLSRYTARLTNEDLSDKLAAY-FPGTINYMAPELIRVRPYSNKIDIWSFGMVLVEMVTRKPPFHWAADGRITIELKKMQKFKFK-----PIMPISDGLHQFINSCLTVDPSERPSGEHLIGSQWI 2084
            R  + ++  +E G+GAF  V    ++ SG ++  K +N  K S      L R+A I   L   N++R  + I  +   +L    + GG L + I      +E D      QIL  +N +H+ +I+HRD+KP+N++L    +G   KL DFGL+        E   D+ A + F GT  Y++PE++R  PY   +DIW+ G++L  ++   PPF W  D     +  K   + F       + P +  L   IN  LT++P++R + E  +   W+
Sbjct:    9 RFTDEYQLYEELGKGAFSVVRRCVKKSSGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCISQILESVNHIHQHDIVHRDLKPENLLLASKMKGAAVKLADFGLAI-------EVQGDQQAWFGFAGTPGYLSPEVLRKDPYGKPVDIWACGVILYILLVGYPPF-WDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAKNL---INQMLTINPAKRITAEQALKHPWV 272          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000041780.1 (calcium/calmodulin-dependent protein kinase type II subunit gamma [Source:NCBI gene;Acc:101170226])

HSP 1 Score: 118.242 bits (295), Expect = 3.239e-27
Identity = 82/276 (29.71%), Postives = 135/276 (48.91%), Query Frame = 3
Query: 1305 RGMEHFEFLQEKGRGAFGTVDLYQERISGNKFIVKKLNDVKCS------LYRDAFIGAKLSQSNLLRYSEVIKGQHSAHLAMPYMPGGTLSKHIYKGRCQNEEDIFKISYQILAQINKLHKLEIIHRDIKPDNIVLD---EGGNPKLIDFGLSRYTARLTNEDLSDKLAAY-FPGTINYMAPELIRVRPYSNKIDIWSFGMVLVEMVTRKPPFHWAADGRITIELKKMQKFKFK-----PIMPISDGLHQFINSCLTVDPSERPSGEHLIGSQWII 2087
            R  + ++  +E G+GAF  V    ++ SG ++  K +N  K S      L R+A I   L   N++R  + I  +   +L    + GG L + I      +E D      QIL  +N +H+ +I+HRD+KP+N++L    +G   KL DFGL+        E   D+ A + F GT  Y++PE++R  PY   +DIW+ G++L  ++   PPF W  D     +  K   + F       + P +  L   IN  LT++P++R + E  +   W+ 
Sbjct:    9 RFTDEYQLYEELGKGAFSVVRRCVKKSSGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCISQILESVNHIHQHDIVHRDLKPENLLLASKMKGAAVKLADFGLAI-------EVQGDQQAWFGFAGTPGYLSPEVLRKDPYGKPVDIWACGVILYILLVGYPPF-WDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAKNL---INQMLTINPAKRITAEQALKHPWVC 273          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000043786.1 (calcium/calmodulin-dependent protein kinase type II subunit gamma [Source:NCBI gene;Acc:101170226])

HSP 1 Score: 117.472 bits (293), Expect = 4.836e-27
Identity = 82/275 (29.82%), Postives = 135/275 (49.09%), Query Frame = 3
Query: 1305 RGMEHFEFLQEKGRGAFGTVDLYQERISGNKFIVKKLNDVKCS------LYRDAFIGAKLSQSNLLRYSEVIKGQHSAHLAMPYMPGGTLSKHIYKGRCQNEEDIFKISYQILAQINKLHKLEIIHRDIKPDNIVLD---EGGNPKLIDFGLSRYTARLTNEDLSDKLAAY-FPGTINYMAPELIRVRPYSNKIDIWSFGMVLVEMVTRKPPFHWAADGRITIELKKMQKFKFK-----PIMPISDGLHQFINSCLTVDPSERPSGEHLIGSQWI 2084
            R  + ++  +E G+GAF  V    ++ SG ++  K +N  K S      L R+A I   L   N++R  + I  +   +L    + GG L + I      +E D      QIL  +N +H+ +I+HRD+KP+N++L    +G   KL DFGL+        E   D+ A + F GT  Y++PE++R  PY   +DIW+ G++L  ++   PPF W  D     +  K   + F       + P +  L   IN  LT++P++R + E  +   W+
Sbjct:    9 RFTDEYQLYEELGKGAFSVVRRCVKKSSGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCISQILESVNHIHQHDIVHRDLKPENLLLASKMKGAAVKLADFGLAI-------EVQGDQQAWFGFAGTPGYLSPEVLRKDPYGKPVDIWACGVILYILLVGYPPF-WDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAKNL---INQMLTINPAKRITAEQALKHPWV 272          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000028623.1 (calcium/calmodulin-dependent protein kinase type II subunit gamma [Source:NCBI gene;Acc:101170226])

HSP 1 Score: 117.087 bits (292), Expect = 6.778e-27
Identity = 82/275 (29.82%), Postives = 135/275 (49.09%), Query Frame = 3
Query: 1305 RGMEHFEFLQEKGRGAFGTVDLYQERISGNKFIVKKLNDVKCS------LYRDAFIGAKLSQSNLLRYSEVIKGQHSAHLAMPYMPGGTLSKHIYKGRCQNEEDIFKISYQILAQINKLHKLEIIHRDIKPDNIVLD---EGGNPKLIDFGLSRYTARLTNEDLSDKLAAY-FPGTINYMAPELIRVRPYSNKIDIWSFGMVLVEMVTRKPPFHWAADGRITIELKKMQKFKFK-----PIMPISDGLHQFINSCLTVDPSERPSGEHLIGSQWI 2084
            R  + ++  +E G+GAF  V    ++ SG ++  K +N  K S      L R+A I   L   N++R  + I  +   +L    + GG L + I      +E D      QIL  +N +H+ +I+HRD+KP+N++L    +G   KL DFGL+        E   D+ A + F GT  Y++PE++R  PY   +DIW+ G++L  ++   PPF W  D     +  K   + F       + P +  L   IN  LT++P++R + E  +   W+
Sbjct:    9 RFTDEYQLYEELGKGAFSVVRRCVKKSSGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCISQILESVNHIHQHDIVHRDLKPENLLLASKMKGAAVKLADFGLAI-------EVQGDQQAWFGFAGTPGYLSPEVLRKDPYGKPVDIWACGVILYILLVGYPPF-WDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAKNL---INQMLTINPAKRITAEQALKHPWV 272          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000071997.1 (SMESG000071997.1)

HSP 1 Score: 1425.61 bits (3689), Expect = 0.000e+0
Identity = 689/695 (99.14%), Postives = 692/695 (99.57%), Query Frame = 3
Query:   39 MKIFVVNGENGGEKTAIEIEGLTFVSEIKLRLSEECRVNYFWLINSNNFLLNDNDHLSRYNLSDNDEIWHGSLENFIKKDDVIVEIFLSGWTPFISWLVVKVNQSMSEIRAALVRIEPDIINIFNGDGQLMEDNQLVTDIDRDGYYRLIISCGRGTNMNLSFDECYKFYKLHILRFKYSKSHLLYYAQFYSEGIQEQTRYQLIYQMIRIREIMSSNDVIDTRLNKNLSDFLFFIKSKLLFQQDISARLLEICYSYWFLIKYFYTSEVWAVVGLYFRLSLLNVLSECSNSVVNLGVSADKSFGGIIIDALDNFVLFLSEFGEILKSSAKLWTDLFSLITLAGSEFDDQFDDSYSKESSCTVKSGGRNHQLVIFSNPRTIAEAKEAIAVANKTSEQDLYVIDGQNHDEPSERDRFSQGIIIEMMRGMEHFEFLQEKGRGAFGTVDLYQERISGNKFIVKKLNDVKCSLYRDAFIGAKLSQSNLLRYSEVIKGQHSAHLAMPYMPGGTLSKHIYKGRCQNEEDIFKISYQILAQINKLHKLEIIHRDIKPDNIVLDEGGNPKLIDFGLSRYTARLTNEDLSDKLAAYFPGTINYMAPELIRVRPYSNKIDIWSFGMVLVEMVTRKPPFHWAADGRITIELKKMQKFKFKPIMPISDGLHQFINSCLTVDPSERPSGEHLIGSQWIIDNLHMCKCDDNT 2123
            MKIFVVNGENGGEKTAIEIEGLTFVSEIKLRL EECRVNYFWLINSNNFLLNDNDHLSRYNLSDNDEIWHGSLENFIKKDDVIVEIFLSGWTPFISWLVVKVNQSMSEIRAALVRIEPDIINIFNGDGQLMEDNQLVTDIDRDGYYRLIISCGRG NMNL+FDECYKFYKLHILRFKYSKSHLLYYAQFYSEGIQEQTRYQLIYQMIRIREIMSSNDVIDTRLNKNLSDFLFFIKSKLLFQQDISARLLEICYSYWFLIKYFYTSEVWAVVGLYFRLSLLNVLSECSNSVVNLGVSADKSFGGIIIDALDNFVLFLSEFGEILKSSAKLWTDLFSLITLAGSEFDDQFDDSYSKESSCTVKSGGRNHQLVIFSNPRTIAEAKEAIAVANKTSEQDLYVIDGQNHDEPSERDRFSQGIIIEMMRGMEHFEFLQEKGRGAFGTVDLYQERISGNKFI+KKLNDVKCSLYRDAFIGAKLSQSNLLRYSEVIKGQHSAHLAMPYMPGGTLSKHIYKG CQNEEDIFKISYQILAQINKLHKLEIIHRDIKPDNIVLDEGGNPKLIDFGLSRYTARLTNEDLSDKLAAYFPGTINYMAPELIRVRPYSNKIDIWSFGMVLVEMVTRKPPFHWAADGRITIELKKMQKFKFKPIMPIS+GLHQFINSCLTVDPSERPSGEHLIGSQWIIDNLHMCKCDDNT
Sbjct:    1 MKIFVVNGENGGEKTAIEIEGLTFVSEIKLRLPEECRVNYFWLINSNNFLLNDNDHLSRYNLSDNDEIWHGSLENFIKKDDVIVEIFLSGWTPFISWLVVKVNQSMSEIRAALVRIEPDIINIFNGDGQLMEDNQLVTDIDRDGYYRLIISCGRGANMNLAFDECYKFYKLHILRFKYSKSHLLYYAQFYSEGIQEQTRYQLIYQMIRIREIMSSNDVIDTRLNKNLSDFLFFIKSKLLFQQDISARLLEICYSYWFLIKYFYTSEVWAVVGLYFRLSLLNVLSECSNSVVNLGVSADKSFGGIIIDALDNFVLFLSEFGEILKSSAKLWTDLFSLITLAGSEFDDQFDDSYSKESSCTVKSGGRNHQLVIFSNPRTIAEAKEAIAVANKTSEQDLYVIDGQNHDEPSERDRFSQGIIIEMMRGMEHFEFLQEKGRGAFGTVDLYQERISGNKFIIKKLNDVKCSLYRDAFIGAKLSQSNLLRYSEVIKGQHSAHLAMPYMPGGTLSKHIYKGECQNEEDIFKISYQILAQINKLHKLEIIHRDIKPDNIVLDEGGNPKLIDFGLSRYTARLTNEDLSDKLAAYFPGTINYMAPELIRVRPYSNKIDIWSFGMVLVEMVTRKPPFHWAADGRITIELKKMQKFKFKPIMPISEGLHQFINSCLTVDPSERPSGEHLIGSQWIIDNLHMCKCDDNT 695          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000024565.1 (SMESG000024565.1)

HSP 1 Score: 510.375 bits (1313), Expect = 2.203e-171
Identity = 300/715 (41.96%), Postives = 435/715 (60.84%), Query Frame = 3
Query:   39 MKIFVVNGENGGEKTAIEIEGLTFVSEIKLRLSE--ECRVNY---FWLINSNNFLLNDNDHLSRYNLSDNDEIWHGSLENFIKKDDVIVEIFLSGWTPFISWLVVKVNQSMSEIRAALVRIEPDIINIFNGDGQLMEDNQLVTDIDRDGYYRLIISCGRGTNMNLSFDECYKFYKLHILRFKYSKSHLLYYAQFYSEGIQEQTRYQLIYQMIRIREIMSSNDVIDTRLNKNLSDFL-FFIKSKLLFQQDISARLLEICYSYWFLIKYFYTSEVWAVVGLYFRLSLLNVLSECSNSVVNLGVSADKSFGGIIIDALDNFVLFLSEF-----------------GEILKSSAKLWTDLFSLITLAGSEFDDQFDDSYSKESSCTVKSGGRNHQLVIFSNPRTIAEAKEAIAVANKTSEQDLYVIDGQNHDEPSERDRFSQGII-IEMMRGMEHFEFLQEKGRGAFGTVDLYQERISGNKFIVKKLNDVKCSLYRDAFIGAKLSQSN-LLRYSEVIKGQHSAHLAMPYMPGGTLSKHIYKGRCQNEEDIFKISYQILAQINKLHKLEIIHRDIKPDNIVLDEGGNPKLIDFGLSRYTARLTNEDLSDKLAAYFPGTINYMAPELIRVRPYSNKIDIWSFGMVLVEMVTRKPPFHWAADGRITIELKKMQKFKFKPIMPISDGLHQFINSCLTVDPSERPSGEHLIGSQWIIDNLHMCK 2108
            MKIFV+  EN   K  I++E  + V  I+ +L +    RV +   F  +   N +++D   +  Y L + DEI    +EN++  DDVI+E+FLSG+ P + +L+V+ N S+S+I++ + RI+ +IINI +  G  M  +Q VT+     YYRLI+  GR      +F++C K Y  H  R  +    +L     Y E + E    ++I QM  I+ IM SND  + RL +NLS+F   FIK   +F  DIS+R+ +IC  YW L +    ++ W V+GL+FR++LL VL +      N    A K+F  I++DAL   V  L +                  GE+++     W D F   +   SEFD+ F+  Y+K +  ++K G  + +    S+P+TI EAKEA+A        DLY I  +N D+P++ + + + I+   +M  ME+F+FL+E   GAFG V + Q++IS  + ++KK  +++ SL+RD FIG +L  S+ L +YS ++K   S  LAMPY+ GG+L+  I + +C +E +  KISYQIL QI++LH+L+I+HRDIKPDNI+LD  GN KLIDFGLS+    +T E L +KL AY PGT+NYMAPE++R  PYS KIDIWSFGMVLVEMVT  PPFH  A  R+ IELKKM +++FKP + IS   +QFI  CLTVDP+ERPS + LI SQ+IID L++ K
Sbjct:    1 MKIFVIRVENPEIKIEIKLEEYSLVRNIRNKLDKIFPGRVKWNKHFIKLVHKNIIMDDEKSIGWYKLCEGDEILCVRIENYLCSDDVILEVFLSGFVPEVIYLIVQRNYSISKIKSMIERIQCEIINICDFTGNKMTGSQTVTETSSCAYYRLIVKYGRKETCISTFEDCLKQY--HKFRIIHYYDFILRLRHLY-ECLFETRINEVIKQMNEIKAIMLSNDPFEIRLKENLSEFPSAFIKCHSIFCDDISSRIWDICDDYWQLSRNVIENDEWIVIGLFFRMALLIVLHQYLEHERNHCEIATKTFNSIVVDALGYSVTLLIKIRQMESFCETAGYSFDLIGELMEDICVKWMDPFLSTSRYYSEFDEVFNRYYNK-TFASLKFGNGSVEFHFHSDPQTIIEAKEAMAQKCGVKVNDLYAIYQRNEDKPTDGEPYDETILDFVLMINMENFDFLKEFATGAFGKVFICQDKISSQELVLKKSTEMEFSLHRDIFIGYRLKNSSKLFQYSRIVKDMDSIQLAMPYLSGGSLTSKIQQQKCIHENEKIKISYQILTQIHELHRLQIVHRDIKPDNIILDGAGNAKLIDFGLSKSMENVTIEILLEKLKAYAPGTVNYMAPEILREIPYSYKIDIWSFGMVLVEMVTGNPPFHKKAPPRVVIELKKMVEYEFKPNLLISIEFNQFIKWCLTVDPNERPSAQQLIESQFIIDYLNINK 711          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000024532.1 (SMESG000024532.1)

HSP 1 Score: 498.434 bits (1282), Expect = 3.800e-167
Identity = 302/707 (42.72%), Postives = 426/707 (60.25%), Query Frame = 3
Query:   39 MKIFVVNGENGGEKTAIEIEGLTFVSEIKLRL-----------SEECRVNYFWLINSNNFLLNDNDHLSRYNLSDNDEIWHGSLENFIKKDDVIVEIFLSGWTPFISWLVVKVNQSMSEIRAALVRIEPDIINIFNGDGQLMEDNQLVTDIDRDGYYRLIISCGRGTNMNLSFDECYKFYKLHILRFKYSKSHLLYYAQFYSEGIQEQTRYQLIYQMIRIREIMSSNDVIDTRLNKNLSDFLF-FIKSKLLFQQDISARLLEICYSYWFLIK---YFYTSEVWAVVGLYFRLSLLNVLSECSNSVVNLGVSADKSFGGIIIDALDNFVLFLSEFGEILKSSAKLWTDLFSLITLAGSEFDDQFDDSYSKESSCTVKSGGRNHQ---LVIFSNPRTIAEAKEAIAVANKTSEQDLYVIDGQNHDEPSERDRFSQGI-IIEMMRGMEHFEFLQEKGRGAFGTVDLYQERISGNKFIVKKLNDVKCSLYRDAFIGAK-LSQSNLLRYSEVIKGQHSAHLAMPYMPGGTLSKHIYKGRCQNEEDIFKISYQILAQINKLHKLEIIHRDIKPDNIVLDEGGNPKLIDFGLSRYTARLTNEDLSDKLAAYFPGTINYMAPELIRVRPYSNKIDIWSFGMVLVEMVTRKPPFHWAADGRITIELKKMQKFKFKPIMPISDGLHQFINSCLTVDPSERPSGEHLIGSQWIIDNLH 2099
            MKI VVNGEN   K  IEI+  ++V +IK ++            E  R  Y       N +L+D +++ RY + ++DEIW G +EN+++ DDVI+E+FL+G +P + WL+VK+N S++ IR+ +  ++  +INI++ +G+ M++ Q+V+DID  GYYRLI+S        LSF++C + +     RF  +       ++F  E + E     LI    +IR IMS NDVID RL +NLS+     + SKLLF  +I  R+L+IC  +W   K   Y+    +       F LS+L  L + S+S      + DKSF GI+IDALD  V  L +  + LK   KL+ D F L+    SE+  +  + YS +    +    +++    L +     T+ +AK  IA     S +DLY I+  NHD+  E   + +G  + E+++ ME+    +E G G FG V  YQ+ ISG +  +K  N  K SLYRD FI A  ++ S L +YS + K +   ++AMPYM GG+L+ +I   +   E++  +ISYQIL QI KLH+L+IIHRDIKPDNIV D  GN KLIDFGLS++    T+E++ +KL AY PGTINYMAPE++R  PYS KIDIWSFGMVLVEMVT  PPFH  A  R  IELKKM ++KFKP + IS  LHQFI SCL V+P+ERPS + LIGSQ+II  L 
Sbjct:    1 MKISVVNGENLSVKFVIEIDKHSYVGDIKHKIDKILNGQGKWEKEHLRFIY------KNIILHD-EYIKRYKVCESDEIWFGKIENYLRSDDVIIEVFLAGCSPVLIWLIVKINHSITVIRSMIEIVQSKLINIYDWNGREMQNVQIVSDIDPIGYYRLIVSYEDERGKWLSFEDCVRQHDEFTFRFCLN-------SEFEFEDMTEINTVNLIN---KIRTIMSLNDVIDARLKENLSNIPSGVVNSKLLFYYNIQLRILDICQEFWKSTKDSPYYINYNIIKS----FELSILVALHQYSHSRQKDPENKDKSFNGIVIDALDYLVKHLHDHCKDLKYHQKLFFDHFLLVPRPVSEYI-ELRNEYSSQLITKIIINKKDNIAPFLTLLLTQGTVLDAKCEIAQKLGVSIKDLYCINHWNHDKAEEDKIYKEGFYMFEIIKSMENMNLGKEFGAGGFGRVFFYQDIISGKQLAMKTANSDKSSLYRDIFISALIMNNSELFKYSGLFKYKSELYIAMPYMTGGSLTSYIQGKKGLFEKEALRISYQILIQIEKLHELKIIHRDIKPDNIVFDGAGNAKLIDFGLSKWMKNSTDENILEKLKAYAPGTINYMAPEILREIPYSYKIDIWSFGMVLVEMVTGNPPFHKKAPARAIIELKKMVEYKFKPSVLISIELHQFIKSCLIVNPNERPSAQQLIGSQFIIGYLQ 685          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000024843.1 (SMESG000024843.1)

HSP 1 Score: 436.417 bits (1121), Expect = 1.657e-144
Identity = 250/577 (43.33%), Postives = 361/577 (62.56%), Query Frame = 3
Query:  405 IFNGDGQLMEDNQLVTDIDRDGYYRLIISCGRGTNMNLSFDECYKFY-KLHILRFKYSKSHLLYYAQFYSEGIQEQTRYQLIYQMIRIREIMSSNDVIDTRLNKNLSDFL-FFIKSKLLFQQDISARLLEICYSYWFLIK------YFYTSEVWAVVGLYFRLSLLNVLSECSNSVVNLGVSADKSFGGIIIDALDNFVLFLSEFGEILKSSAKLWTDLFSLITLAGSEFDDQFDDSYSKESSCTVKSGGRNHQLVIFSNPRTIAEAKEAIAVANKTSEQDLYVIDGQNHDEPSERDRFSQGI-IIEMMRGMEHFEFLQEKGRGAFGTVDLYQERISGNKFIVKKLNDVKCSLYRDAFIGAKLSQSNLLRYSEVIKGQHSAHLAMPYMPGGTLSKHIYKGRCQNEEDIFKISYQILAQINKLHKLEIIHRDIKPDNIVLDEGGNPKLIDFGLSRYTARLTNEDLSDKLAAYFPGTINYMAPELIRVRPYSNKIDIWSFGMVLVEMVTRKPPFHWAADGRITIELKKMQKFKFKPIMPISDGLHQFINSCLTVDPSERPSGEHLIGSQWIIDNLHMCK 2108
            +++  G  M++NQ VTDID  GYYRLI++CG+  + NL+FDEC   + +  I+ + YS++    + +F  E   E  R ++I Q+ +IR+I+SSND ID RLN+NLS F   F+K   LF  DI+ R+ +IC  Y  L+K       F  ++ W  + L+F  +LL  + + S++V N   +  KSF  I++DALD  V  L    E  K +AK W + F LIT +  + D+ F       S   V+     +++ +  NP+TI EA +A+A   +   QDLY I+    D+P++ D + Q +   E+M  M  FE L E   G FG V + +++ISG + ++KKL DVK SL+R+  IG+ L    L++YSEVI+ + + HL MPY+PGGTL+ +I + +C  E ++ +IS+QIL QI++LHK +IIH DIKP+NIV D   N KLIDFGL++Y     ++DLS K  A  PGTINYMAPEL +  P S KIDIWSFGMV+VEMVT + PF+    G+I + L K+ K++FKP+M IS+ L QFI+ CLTVDP+ RP+ + LI SQ I + L M K
Sbjct:    1 MWDCKGNEMQNNQSVTDIDAFGYYRLIVNCGQEADDNLTFDECCNQHDRCKIILYYYSEN----WWEF--EKFSEIARVKIINQIKKIRQIISSNDTIDPRLNENLSHFPKAFVKQNYLFGHDITKRIWDICNEYRKLMKSYPFSVQFCLNDEWHAMKLFFLTALLVTMRKYSDAVQNDPKNTKKSFNDILVDALDCLVRHLMNPCEDWKHAAKRWLNSFFLITQSDGDMDELF--VKFDPSMIIVRIKSEEYEMDVELNPKTILEATKAVANKFRIDRQDLYSINHWIPDKPNDGDPYFQPMTFFELMSKMADFENLNELANGGFGKVFICEDKISGKQVVMKKLIDVKDSLHREILIGSILFDKELIKYSEVIRDEKNIHLTMPYLPGGTLTSNIQQLKCLGENEVIRISHQILTQISELHKSKIIHCDIKPENIVFDNERNVKLIDFGLAKYIGDFRSKDLSRKRKASSPGTINYMAPELTKEDPNSVKIDIWSFGMVMVEMVTGQLPFNVMGPGQILLRLGKLLKYEFKPMMEISNDLKQFISWCLTVDPNVRPTAQQLIESQLINNYLQMTK 569          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000024843.1 (SMESG000024843.1)

HSP 1 Score: 434.491 bits (1116), Expect = 5.738e-144
Identity = 249/569 (43.76%), Postives = 357/569 (62.74%), Query Frame = 3
Query:  429 MEDNQLVTDIDRDGYYRLIISCGRGTNMNLSFDECYKFY-KLHILRFKYSKSHLLYYAQFYSEGIQEQTRYQLIYQMIRIREIMSSNDVIDTRLNKNLSDFL-FFIKSKLLFQQDISARLLEICYSYWFLIK------YFYTSEVWAVVGLYFRLSLLNVLSECSNSVVNLGVSADKSFGGIIIDALDNFVLFLSEFGEILKSSAKLWTDLFSLITLAGSEFDDQFDDSYSKESSCTVKSGGRNHQLVIFSNPRTIAEAKEAIAVANKTSEQDLYVIDGQNHDEPSERDRFSQGI-IIEMMRGMEHFEFLQEKGRGAFGTVDLYQERISGNKFIVKKLNDVKCSLYRDAFIGAKLSQSNLLRYSEVIKGQHSAHLAMPYMPGGTLSKHIYKGRCQNEEDIFKISYQILAQINKLHKLEIIHRDIKPDNIVLDEGGNPKLIDFGLSRYTARLTNEDLSDKLAAYFPGTINYMAPELIRVRPYSNKIDIWSFGMVLVEMVTRKPPFHWAADGRITIELKKMQKFKFKPIMPISDGLHQFINSCLTVDPSERPSGEHLIGSQWIIDNLHMCK 2108
            M++NQ VTDID  GYYRLI++CG+  + NL+FDEC   + +  I+ + YS++    + +F  E   E  R ++I Q+ +IR+I+SSND ID RLN+NLS F   F+K   LF  DI+ R+ +IC  Y  L+K       F  ++ W  + L+F  +LL  + + S++V N   +  KSF  I++DALD  V  L    E  K +AK W + F LIT +  + D+ F       S   V+     +++ +  NP+TI EA +A+A   +   QDLY I+    D+P++ D + Q +   E+M  M  FE L E   G FG V + +++ISG + ++KKL DVK SL+R+  IG+ L    L++YSEVI+ + + HL MPY+PGGTL+ +I + +C  E ++ +IS+QIL QI++LHK +IIH DIKP+NIV D   N KLIDFGL++Y     ++DLS K  A  PGTINYMAPEL +  P S KIDIWSFGMV+VEMVT + PF+    G+I + L K+ K++FKP+M IS+ L QFI+ CLTVDP+ RP+ + LI SQ I + L M K
Sbjct:    1 MQNNQSVTDIDAFGYYRLIVNCGQEADDNLTFDECCNQHDRCKIILYYYSEN----WWEF--EKFSEIARVKIINQIKKIRQIISSNDTIDPRLNENLSHFPKAFVKQNYLFGHDITKRIWDICNEYRKLMKSYPFSVQFCLNDEWHAMKLFFLTALLVTMRKYSDAVQNDPKNTKKSFNDILVDALDCLVRHLMNPCEDWKHAAKRWLNSFFLITQSDGDMDELF--VKFDPSMIIVRIKSEEYEMDVELNPKTILEATKAVANKFRIDRQDLYSINHWIPDKPNDGDPYFQPMTFFELMSKMADFENLNELANGGFGKVFICEDKISGKQVVMKKLIDVKDSLHREILIGSILFDKELIKYSEVIRDEKNIHLTMPYLPGGTLTSNIQQLKCLGENEVIRISHQILTQISELHKSKIIHCDIKPENIVFDNERNVKLIDFGLAKYIGDFRSKDLSRKRKASSPGTINYMAPELTKEDPNSVKIDIWSFGMVMVEMVTGQLPFNVMGPGQILLRLGKLLKYEFKPMMEISNDLKQFISWCLTVDPNVRPTAQQLIESQLINNYLQMTK 561          
The following BLAST results are available for this feature:
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NEK52.438e-2631.01NIMA related kinase 5 [Source:HGNC Symbol;Acc:HGNC... [more]
AURKC2.696e-2626.99aurora kinase C [Source:HGNC Symbol;Acc:HGNC:11391... [more]
CAMK1D3.237e-2627.57calcium/calmodulin dependent protein kinase ID [So... [more]
CAMK2G3.862e-2628.73calcium/calmodulin dependent protein kinase II gam... [more]
CAMK2A4.970e-2627.68calcium/calmodulin dependent protein kinase II alp... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-436.065e-2729.93Calcium/calmodulin-dependent protein kinase type I... [more]
unc-436.065e-2729.93Calcium/calmodulin-dependent protein kinase type I... [more]
unc-436.065e-2729.93Calcium/calmodulin-dependent protein kinase type I... [more]
unc-436.181e-2729.93Calcium/calmodulin-dependent protein kinase type I... [more]
unc-436.181e-2729.93Calcium/calmodulin-dependent protein kinase type I... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nek23.450e-2932.03gene:FBgn0029970 transcript:FBtr0071142[more]
CaMKII5.475e-2629.45gene:FBgn0264607 transcript:FBtr0333673[more]
CaMKII5.853e-2629.45gene:FBgn0264607 transcript:FBtr0300377[more]
CaMKII5.853e-2629.45gene:FBgn0264607 transcript:FBtr0089217[more]
CaMKII5.853e-2629.45gene:FBgn0264607 transcript:FBtr0089218[more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nek13.434e-2929.78NIMA-related kinase 1 [Source:ZFIN;Acc:ZDB-GENE-04... [more]
camk1db3.206e-2828.31calcium/calmodulin-dependent protein kinase 1Db [S... [more]
camk1da8.611e-2829.56calcium/calmodulin-dependent protein kinase 1Da [S... [more]
camk1db1.346e-2728.31calcium/calmodulin-dependent protein kinase 1Db [S... [more]
camk2g12.365e-2729.08calcium/calmodulin-dependent protein kinase (CaM k... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
banf14.831e-2731.35barrier to autointegration factor 1 [Source:Xenbas... [more]
banf14.945e-2731.47barrier to autointegration factor 1 [Source:Xenbas... [more]
banf15.252e-2731.18barrier to autointegration factor 1 [Source:Xenbas... [more]
banf19.855e-2731.35barrier to autointegration factor 1 [Source:Xenbas... [more]
banf13.112e-2631.35barrier to autointegration factor 1 [Source:Xenbas... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Aurkc1.633e-2928.84aurora kinase C [Source:MGI Symbol;Acc:MGI:1321119... [more]
Aurkc1.633e-2928.84aurora kinase C [Source:MGI Symbol;Acc:MGI:1321119... [more]
Aurkc3.263e-2928.84aurora kinase C [Source:MGI Symbol;Acc:MGI:1321119... [more]
Camk1d2.386e-2627.57calcium/calmodulin-dependent protein kinase ID [So... [more]
Camk2g2.651e-2628.73calcium/calmodulin-dependent protein kinase II gam... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q55BN8|NEK2_DICDI6.706e-3134.31Probable serine/threonine-protein kinase nek2 OS=D... [more]
sp|O88445|AURKC_MOUSE1.142e-2828.84Aurora kinase C OS=Mus musculus OX=10090 GN=Aurkc ... [more]
sp|Q6YY75|NEK6_ORYSJ2.398e-2832.26Serine/threonine-protein kinase Nek6 OS=Oryza sati... [more]
sp|Q10056|SHK2_SCHPO1.104e-2631.58Serine/threonine-protein kinase shk2 OS=Schizosacc... [more]
sp|Q7YRC6|AURKB_BOVIN2.167e-2629.43Aurora kinase B OS=Bos taurus OX=9913 GN=AURKB PE=... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0BFM23.889e-3633.82Protein kinase domain-containing protein OS=Parame... [more]
A0BWA11.143e-3432.54Protein kinase domain-containing protein OS=Parame... [more]
A0DG767.554e-3230.04Protein kinase domain-containing protein OS=Parame... [more]
A0BZI12.780e-3131.99Protein kinase domain-containing protein OS=Parame... [more]
B4NCW11.837e-3035.11Protein kinase domain-containing protein OS=Drosop... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
camk2g15.583e-2829.08calcium/calmodulin-dependent protein kinase type I... [more]
camk2g17.900e-2829.08calcium/calmodulin-dependent protein kinase type I... [more]
camk2g18.811e-2829.08calcium/calmodulin-dependent protein kinase type I... [more]
nek81.079e-2734.87NIMA related kinase 8 [Source:NCBI gene;Acc:103024... [more]
camk2g11.146e-2728.98calcium/calmodulin-dependent protein kinase type I... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008748.16.568e-2828.83pep scaffold:Pmarinus_7.0:GL476577:591:63029:-1 ge... [more]
ENSPMAT00000007414.11.072e-2529.30pep scaffold:Pmarinus_7.0:GL476981:230882:244405:1... [more]
MARK31.204e-2228.57microtubule affinity regulating kinase 3 [Source:H... [more]
ENSPMAT00000004683.11.691e-2237.59pep scaffold:Pmarinus_7.0:GL488517:199:5283:1 gene... [more]
snrka3.674e-2230.80SNF related kinase a [Source:ZFIN;Acc:ZDB-GENE-040... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
MKK21.745e-2732.13MAPKK involved in the protein kinase C signaling p... [more]
CDC152.709e-2627.27Protein kinase of the Mitotic Exit Network; locali... [more]
MKK11.499e-2430.39MAPKK involved in the protein kinase C signaling p... [more]
YPL150W_mRNA3.416e-2429.55Protein kinase of unknown cellular role; binds pho... [more]
RAD531.026e-2328.99DNA damage response protein kinase; required for c... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO407032.030e-2829.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO414102.585e-2831.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO498229.518e-2728.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO374132.329e-2630.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO362538.527e-2628.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
camk1da1.477e-2729.82calcium/calmodulin dependent protein kinase ID [So... [more]
ENSORLT00000013395.22.521e-2729.82calcium/calmodulin-dependent protein kinase type I... [more]
ENSORLT00000041780.13.239e-2729.71calcium/calmodulin-dependent protein kinase type I... [more]
ENSORLT00000043786.14.836e-2729.82calcium/calmodulin-dependent protein kinase type I... [more]
ENSORLT00000028623.16.778e-2729.82calcium/calmodulin-dependent protein kinase type I... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000071997.10.000e+099.14SMESG000071997.1[more]
SMESG000024565.12.203e-17141.96SMESG000024565.1[more]
SMESG000024532.13.800e-16742.72SMESG000024532.1[more]
SMESG000024843.11.657e-14443.33SMESG000024843.1[more]
SMESG000024843.15.738e-14443.76SMESG000024843.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024411 ID=SMED30024411|Name=Protein kinase domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2284bp
AATCTATATAAATCTTATATGAATAATTTATTTGCTGTATGAAGATATTT
GTGGTAAATGGGGAAAATGGCGGCGAGAAGACAGCGATTGAGATTGAGGG
ATTGACATTCGTCAGTGAGATCAAACTAAGATTGTCAGAAGAGTGTCGGG
TGAATTATTTCTGGCTCATCAACAGCAATAATTTCTTATTGAATGATAAT
GACCATCTCAGTCGCTACAATCTTTCTGACAATGACGAAATTTGGCATGG
CAGCCTGGAGAACTTTATAAAGAAGGATGACGTGATTGTTGAGATATTCC
TTTCAGGATGGACTCCCTTCATCAGCTGGTTGGTAGTGAAGGTCAATCAG
TCCATGTCAGAAATCCGGGCGGCACTGGTAAGGATTGAACCGGATATAAT
TAACATATTCAATGGGGATGGCCAGCTGATGGAAGATAATCAATTGGTGA
CAGATATTGATAGGGATGGTTATTATCGATTGATAATCAGCTGTGGCCGT
GGAACTAACATGAATTTGTCATTTGACGAGTGCTACAAGTTTTATAAGTT
GCACATATTGAGATTCAAATATTCAAAGTCTCATCTCTTATATTATGCAC
AATTCTATTCGGAAGGTATTCAGGAACAGACGCGTTATCAGCTGATTTAT
CAAATGATTCGAATTAGGGAAATCATGTCATCAAATGATGTTATTGATAC
CAGGCTGAATAAAAATTTGTCAGATTTCCTATTTTTCATCAAATCAAAAC
TTTTATTCCAGCAGGATATTTCTGCTCGTCTTTTGGAGATTTGCTATAGC
TATTGGTTTCTTATTAAGTATTTTTACACTTCCGAGGTGTGGGCTGTGGT
GGGATTATATTTCCGGTTATCATTATTGAATGTATTAAGTGAATGTTCAA
ATTCCGTGGTAAATCTTGGAGTAAGTGCGGACAAATCGTTTGGTGGGATT
ATAATCGACGCTTTGGATAACTTTGTTTTGTTTCTGAGTGAATTCGGCGA
AATTCTGAAAAGTTCTGCAAAATTATGGACGGATCTATTCTCCTTGATTA
CTCTTGCTGGATCTGAGTTTGATGATCAATTCGATGACAGCTATTCGAAA
GAATCGTCTTGCACTGTCAAGTCTGGCGGTCGAAATCACCAATTAGTGAT
CTTTTCGAATCCGCGAACAATTGCCGAAGCCAAAGAAGCGATTGCAGTAG
CAAACAAGACGAGCGAGCAAGATTTGTATGTGATCGACGGGCAGAATCAT
GACGAACCGAGTGAGCGAGATCGATTCAGTCAAGGCATCATTATTGAAAT
GATGCGGGGCATGGAACATTTTGAATTTCTTCAAGAAAAAGGCCGAGGGG
CATTTGGTACGGTTGATCTTTACCAGGAGAGGATATCCGGAAACAAATTC
ATTGTAAAAAAGTTAAATGATGTGAAATGCAGTCTTTACCGGGATGCCTT
TATCGGTGCTAAACTTTCACAATCAAACTTGTTGAGGTATTCAGAAGTTA
TCAAAGGTCAGCATAGCGCCCATTTGGCCATGCCATACATGCCAGGGGGC
ACCCTCAGCAAACATATTTACAAAGGAAGGTGTCAAAATGAGGAAGATAT
TTTCAAGATATCCTATCAAATCCTCGCACAAATAAACAAATTACACAAAT
TGGAAATTATCCATCGCGACATCAAACCGGACAATATCGTCCTCGATGAA
GGGGGAAACCCGAAATTAATTGATTTTGGTCTCTCAAGATACACAGCCAG
ACTGACAAATGAGGACCTTTCTGACAAGTTGGCAGCGTATTTCCCAGGAA
CAATTAATTACATGGCGCCCGAATTAATTAGAGTAAGACCGTACTCAAAC
AAGATCGATATTTGGTCATTTGGAATGGTGCTAGTAGAGATGGTGACGCG
AAAACCGCCATTCCATTGGGCGGCAGATGGCAGGATAACGATAGAGCTCA
AGAAAATGCAAAAGTTTAAATTCAAACCAATTATGCCGATTTCTGATGGT
TTACATCAATTTATAAACTCTTGTTTGACTGTAGACCCAAGCGAGAGGCC
ATCTGGTGAGCATTTGATTGGATCACAATGGATTATTGATAATTTGCACA
TGTGCAAATGTGATGATAACACGTGATGGAATAATCAATACAATTCAATT
CAACCAAATATCAATCACATTCGAATATCAGAATATAGTTTAAGCTCGAA
TATAAACATATTTATTCATTTAATATGTTATTGGAATGATAAATTCCGAT
TGTTGTTTATTTGAATGGATGAACTTGTGATCAC
back to top

protein sequence of SMED30024411-orf-1

>SMED30024411-orf-1 ID=SMED30024411-orf-1|Name=SMED30024411-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=696bp
MKIFVVNGENGGEKTAIEIEGLTFVSEIKLRLSEECRVNYFWLINSNNFL
LNDNDHLSRYNLSDNDEIWHGSLENFIKKDDVIVEIFLSGWTPFISWLVV
KVNQSMSEIRAALVRIEPDIINIFNGDGQLMEDNQLVTDIDRDGYYRLII
SCGRGTNMNLSFDECYKFYKLHILRFKYSKSHLLYYAQFYSEGIQEQTRY
QLIYQMIRIREIMSSNDVIDTRLNKNLSDFLFFIKSKLLFQQDISARLLE
ICYSYWFLIKYFYTSEVWAVVGLYFRLSLLNVLSECSNSVVNLGVSADKS
FGGIIIDALDNFVLFLSEFGEILKSSAKLWTDLFSLITLAGSEFDDQFDD
SYSKESSCTVKSGGRNHQLVIFSNPRTIAEAKEAIAVANKTSEQDLYVID
GQNHDEPSERDRFSQGIIIEMMRGMEHFEFLQEKGRGAFGTVDLYQERIS
GNKFIVKKLNDVKCSLYRDAFIGAKLSQSNLLRYSEVIKGQHSAHLAMPY
MPGGTLSKHIYKGRCQNEEDIFKISYQILAQINKLHKLEIIHRDIKPDNI
VLDEGGNPKLIDFGLSRYTARLTNEDLSDKLAAYFPGTINYMAPELIRVR
PYSNKIDIWSFGMVLVEMVTRKPPFHWAADGRITIELKKMQKFKFKPIMP
ISDGLHQFINSCLTVDPSERPSGEHLIGSQWIIDNLHMCKCDDNT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0035404histone-serine phosphorylation
GO:0006810transport
GO:0006468protein phosphorylation
GO:0000165MAPK cascade
GO:0000186activation of MAPKK activity
GO:0007169transmembrane receptor protein tyrosine kinase signaling pathway
GO:0016310phosphorylation
GO:0018108peptidyl-tyrosine phosphorylation
GO:0046854phosphatidylinositol phosphorylation
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR022357MIP_CS
IPR000719Prot_kinase_dom
IPR008271Ser/Thr_kinase_AS
IPR011009Kinase-like_dom_sf
IPR029071Ubiquitin-like_domsf
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005622intracellular
Vocabulary: molecular function
TermDefinition
GO:0005215transporter activity
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:00002851-phosphatidylinositol-3-phosphate 5-kinase activity
GO:0004674protein serine/threonine kinase activity
GO:0004709MAP kinase kinase kinase activity
GO:0004714transmembrane receptor protein tyrosine kinase activity
GO:0016301kinase activity
GO:0016740transferase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 428..682
e-value: 2.9E-58
score: 209.5
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 429..682
e-value: 5.2E-52
score: 176.8
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 428..682
score: 41.418
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 420..694
e-value: 2.1E-64
score: 219.8
NoneNo IPR availablePANTHERPTHR44167FAMILY NOT NAMEDcoord: 387..682
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 540..552
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 417..686