Muscleblind protein

Overview
NameMuscleblind protein
Smed IDSMED30024408
Length (bp)2629
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Muscleblind protein (SMED30024408) t-SNE clustered cells

Violin plots show distribution of expression levels for Muscleblind protein (SMED30024408) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Muscleblind protein (SMED30024408) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Muscleblind protein (SMED30024408) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024408

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30024408h1SMcG0012464 dd_Smed_v4_7489_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30024408h1SMcG0012464 dd_Smed_v4_7489_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30024408h1SMcG0012464 dd_Smed_v4_7489_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30024408h1SMcG0012464 dd_Smed_v4_7489_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30024408h1SMcG0012464 dd_Smed_v4_7489_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30024408h1SMcG0012464 SMED30024408smed_20140614PMID:27502555
Solana et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30024408h1SMcG0012464 SMED30024408smed_20140614PMID:27502555
Solana et al., 2016
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30024408h1SMcG0012464 dd_Smed_v4_7489_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Muscleblind protein vs. Ensembl Human
Match: MBNL2 (muscleblind like splicing regulator 2 [Source:HGNC Symbol;Acc:HGNC:16746])

HSP 1 Score: 105.531 bits (262), Expect = 1.411e-24
Identity = 45/81 (55.56%), Postives = 59/81 (72.84%), Query Frame = 1
Query: 1156 MTVNNTANKDSQWLTLEVCREFQRSMCPRNELECKYAHPPPYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLKDLL 1398
            M +N    +D++WLTLEVCR+FQR  C R++ ECK+AHPP   + +NGRV+ C+DS+KG+C R    CKYLHPP HLK  L
Sbjct:    1 MALNVAPVRDTKWLTLEVCRQFQRGTCSRSDEECKFAHPPKSCQVENGRVIACFDSLKGRCSREN--CKYLHPPTHLKTQL 79          

HSP 2 Score: 74.7146 bits (182), Expect = 4.896e-14
Identity = 42/101 (41.58%), Postives = 56/101 (55.45%), Query Frame = 1
Query: 1093 VTTLLQPNTGTTLQQNPVPLAMTVNNTANKDSQWLTLEVCREFQRSMCPRNELECKYAHPP--PYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLK 1389
            V T + P T   +  +P P+ +  +    K  +   LEVCREFQR  C R E +C++AHP     I+T +  V  C D IKG+C R K  CKY HPP HL+
Sbjct:  144 VPTEILPTTPVIVPGSP-PVTVPGSTATQKLLRTDKLEVCREFQRGNCARGETDCRFAHPADSTMIDTSDNTVTVCMDYIKGRCMREK--CKYFHPPAHLQ 241          
BLAST of Muscleblind protein vs. Ensembl Human
Match: MBNL2 (muscleblind like splicing regulator 2 [Source:HGNC Symbol;Acc:HGNC:16746])

HSP 1 Score: 107.457 bits (267), Expect = 2.419e-24
Identity = 45/81 (55.56%), Postives = 59/81 (72.84%), Query Frame = 1
Query: 1156 MTVNNTANKDSQWLTLEVCREFQRSMCPRNELECKYAHPPPYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLKDLL 1398
            M +N    +D++WLTLEVCR+FQR  C R++ ECK+AHPP   + +NGRV+ C+DS+KG+C R    CKYLHPP HLK  L
Sbjct:    1 MALNVAPVRDTKWLTLEVCRQFQRGTCSRSDEECKFAHPPKSCQVENGRVIACFDSLKGRCSREN--CKYLHPPTHLKTQL 79          

HSP 2 Score: 75.8702 bits (185), Expect = 6.111e-14
Identity = 42/101 (41.58%), Postives = 56/101 (55.45%), Query Frame = 1
Query: 1093 VTTLLQPNTGTTLQQNPVPLAMTVNNTANKDSQWLTLEVCREFQRSMCPRNELECKYAHPP--PYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLK 1389
            V T + P T   +  +P P+ +  +    K  +   LEVCREFQR  C R E +C++AHP     I+T +  V  C D IKG+C R K  CKY HPP HL+
Sbjct:  144 VPTEILPTTPVIVPGSP-PVTVPGSTATQKLLRTDKLEVCREFQRGNCARGETDCRFAHPADSTMIDTSDNTVTVCMDYIKGRCMREK--CKYFHPPAHLQ 241          
BLAST of Muscleblind protein vs. Ensembl Human
Match: MBNL2 (muscleblind like splicing regulator 2 [Source:HGNC Symbol;Acc:HGNC:16746])

HSP 1 Score: 105.916 bits (263), Expect = 8.265e-24
Identity = 45/81 (55.56%), Postives = 59/81 (72.84%), Query Frame = 1
Query: 1156 MTVNNTANKDSQWLTLEVCREFQRSMCPRNELECKYAHPPPYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLKDLL 1398
            M +N    +D++WLTLEVCR+FQR  C R++ ECK+AHPP   + +NGRV+ C+DS+KG+C R    CKYLHPP HLK  L
Sbjct:    1 MALNVAPVRDTKWLTLEVCRQFQRGTCSRSDEECKFAHPPKSCQVENGRVIACFDSLKGRCSREN--CKYLHPPTHLKTQL 79          

HSP 2 Score: 75.0998 bits (183), Expect = 1.346e-13
Identity = 42/101 (41.58%), Postives = 56/101 (55.45%), Query Frame = 1
Query: 1093 VTTLLQPNTGTTLQQNPVPLAMTVNNTANKDSQWLTLEVCREFQRSMCPRNELECKYAHPP--PYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLK 1389
            V T + P T   +  +P P+ +  +    K  +   LEVCREFQR  C R E +C++AHP     I+T +  V  C D IKG+C R K  CKY HPP HL+
Sbjct:  144 VPTEILPTTPVIVPGSP-PVTVPGSTATQKLLRTDKLEVCREFQRGNCARGETDCRFAHPADSTMIDTSDNTVTVCMDYIKGRCMREK--CKYFHPPAHLQ 241          
BLAST of Muscleblind protein vs. Ensembl Human
Match: MBNL2 (muscleblind like splicing regulator 2 [Source:HGNC Symbol;Acc:HGNC:16746])

HSP 1 Score: 105.916 bits (263), Expect = 8.265e-24
Identity = 45/81 (55.56%), Postives = 59/81 (72.84%), Query Frame = 1
Query: 1156 MTVNNTANKDSQWLTLEVCREFQRSMCPRNELECKYAHPPPYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLKDLL 1398
            M +N    +D++WLTLEVCR+FQR  C R++ ECK+AHPP   + +NGRV+ C+DS+KG+C R    CKYLHPP HLK  L
Sbjct:    1 MALNVAPVRDTKWLTLEVCRQFQRGTCSRSDEECKFAHPPKSCQVENGRVIACFDSLKGRCSREN--CKYLHPPTHLKTQL 79          

HSP 2 Score: 75.0998 bits (183), Expect = 1.346e-13
Identity = 42/101 (41.58%), Postives = 56/101 (55.45%), Query Frame = 1
Query: 1093 VTTLLQPNTGTTLQQNPVPLAMTVNNTANKDSQWLTLEVCREFQRSMCPRNELECKYAHPP--PYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLK 1389
            V T + P T   +  +P P+ +  +    K  +   LEVCREFQR  C R E +C++AHP     I+T +  V  C D IKG+C R K  CKY HPP HL+
Sbjct:  144 VPTEILPTTPVIVPGSP-PVTVPGSTATQKLLRTDKLEVCREFQRGNCARGETDCRFAHPADSTMIDTSDNTVTVCMDYIKGRCMREK--CKYFHPPAHLQ 241          
BLAST of Muscleblind protein vs. Ensembl Human
Match: MBNL1 (muscleblind like splicing regulator 1 [Source:HGNC Symbol;Acc:HGNC:6923])

HSP 1 Score: 104.375 bits (259), Expect = 8.612e-24
Identity = 46/81 (56.79%), Postives = 58/81 (71.60%), Query Frame = 1
Query: 1156 MTVNNTANKDSQWLTLEVCREFQRSMCPRNELECKYAHPPPYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLKDLL 1398
            M V+ T  +D++WLTLEVCREFQR  C R + ECK+AHP    + +NGRV+ C+DS+KG+C R    CKYLHPP HLK  L
Sbjct:    1 MAVSVTPIRDTKWLTLEVCREFQRGTCSRPDTECKFAHPSKSCQVENGRVIACFDSLKGRCSREN--CKYLHPPPHLKTQL 79          

HSP 2 Score: 67.3958 bits (163), Expect = 2.402e-11
Identity = 32/63 (50.79%), Postives = 40/63 (63.49%), Query Frame = 1
Query: 1207 VCREFQRSMCPRNELECKYAHPP--PYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLK 1389
            VCRE+QR  C R E +C++AHP     I+T +  V  C D IKG+C R K  CKY HPP HL+
Sbjct:  116 VCREYQRGNCNRGENDCRFAHPADSTMIDTNDNTVTVCMDYIKGRCSREK--CKYFHPPAHLQ 176          
BLAST of Muscleblind protein vs. Ensembl Celegans
Match: mbl-1 (Muscleblind-like protein [Source:UniProtKB/Swiss-Prot;Acc:Q94250])

HSP 1 Score: 118.627 bits (296), Expect = 7.960e-30
Identity = 48/74 (64.86%), Postives = 58/74 (78.38%), Query Frame = 1
Query: 1180 KDSQWLTLEVCREFQRSMCPRNELECKYAHPPPYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLKDLLI 1401
            KDS+WL +EVCREF R  C R++ ECK+AHPPP ++ Q GRV  CYDSIKG+C R  P CKYLHPPQH+KD L+
Sbjct:   34 KDSRWLQVEVCREFLRGQCARSDQECKFAHPPPNVDVQQGRVTACYDSIKGRCTRENPKCKYLHPPQHIKDQLL 107          
BLAST of Muscleblind protein vs. Ensembl Celegans
Match: mbl-1 (Muscleblind-like protein [Source:UniProtKB/Swiss-Prot;Acc:Q94250])

HSP 1 Score: 118.627 bits (296), Expect = 7.960e-30
Identity = 48/74 (64.86%), Postives = 58/74 (78.38%), Query Frame = 1
Query: 1180 KDSQWLTLEVCREFQRSMCPRNELECKYAHPPPYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLKDLLI 1401
            KDS+WL +EVCREF R  C R++ ECK+AHPPP ++ Q GRV  CYDSIKG+C R  P CKYLHPPQH+KD L+
Sbjct:   34 KDSRWLQVEVCREFLRGQCARSDQECKFAHPPPNVDVQQGRVTACYDSIKGRCTRENPKCKYLHPPQHIKDQLL 107          
BLAST of Muscleblind protein vs. Ensembl Celegans
Match: mbl-1 (Muscleblind-like protein [Source:UniProtKB/Swiss-Prot;Acc:Q94250])

HSP 1 Score: 118.627 bits (296), Expect = 7.960e-30
Identity = 48/74 (64.86%), Postives = 58/74 (78.38%), Query Frame = 1
Query: 1180 KDSQWLTLEVCREFQRSMCPRNELECKYAHPPPYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLKDLLI 1401
            KDS+WL +EVCREF R  C R++ ECK+AHPPP ++ Q GRV  CYDSIKG+C R  P CKYLHPPQH+KD L+
Sbjct:   34 KDSRWLQVEVCREFLRGQCARSDQECKFAHPPPNVDVQQGRVTACYDSIKGRCTRENPKCKYLHPPQHIKDQLL 107          
BLAST of Muscleblind protein vs. Ensembl Celegans
Match: mbl-1 (Muscleblind-like protein [Source:UniProtKB/Swiss-Prot;Acc:Q94250])

HSP 1 Score: 120.553 bits (301), Expect = 9.895e-30
Identity = 48/74 (64.86%), Postives = 58/74 (78.38%), Query Frame = 1
Query: 1180 KDSQWLTLEVCREFQRSMCPRNELECKYAHPPPYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLKDLLI 1401
            KDS+WL +EVCREF R  C R++ ECK+AHPPP ++ Q GRV  CYDSIKG+C R  P CKYLHPPQH+KD L+
Sbjct:   34 KDSRWLQVEVCREFLRGQCARSDQECKFAHPPPNVDVQQGRVTACYDSIKGRCTRENPKCKYLHPPQHIKDQLL 107          
BLAST of Muscleblind protein vs. Ensembl Celegans
Match: mbl-1 (Muscleblind-like protein [Source:UniProtKB/Swiss-Prot;Acc:Q94250])

HSP 1 Score: 120.553 bits (301), Expect = 9.895e-30
Identity = 48/74 (64.86%), Postives = 58/74 (78.38%), Query Frame = 1
Query: 1180 KDSQWLTLEVCREFQRSMCPRNELECKYAHPPPYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLKDLLI 1401
            KDS+WL +EVCREF R  C R++ ECK+AHPPP ++ Q GRV  CYDSIKG+C R  P CKYLHPPQH+KD L+
Sbjct:   34 KDSRWLQVEVCREFLRGQCARSDQECKFAHPPPNVDVQQGRVTACYDSIKGRCTRENPKCKYLHPPQHIKDQLL 107          
BLAST of Muscleblind protein vs. Ensembl Fly
Match: mbl (gene:FBgn0265487 transcript:FBtr0086991)

HSP 1 Score: 125.946 bits (315), Expect = 1.390e-32
Identity = 52/75 (69.33%), Postives = 61/75 (81.33%), Query Frame = 1
Query: 1177 NKDSQWLTLEVCREFQRSMCPRNELECKYAHPPPYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLKDLLI 1401
             KDS+WL LEVCREFQR+ C R + ECK+AHPP  +E QNG+V  CYDSIKG+C+R KPPCKY HPPQHLKD L+
Sbjct:   13 GKDSRWLQLEVCREFQRNKCSRQDTECKFAHPPANVEVQNGKVTACYDSIKGRCNRDKPPCKYFHPPQHLKDQLL 87          
BLAST of Muscleblind protein vs. Ensembl Fly
Match: mbl (gene:FBgn0265487 transcript:FBtr0086994)

HSP 1 Score: 126.331 bits (316), Expect = 2.925e-32
Identity = 52/75 (69.33%), Postives = 61/75 (81.33%), Query Frame = 1
Query: 1177 NKDSQWLTLEVCREFQRSMCPRNELECKYAHPPPYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLKDLLI 1401
             KDS+WL LEVCREFQR+ C R + ECK+AHPP  +E QNG+V  CYDSIKG+C+R KPPCKY HPPQHLKD L+
Sbjct:   13 GKDSRWLQLEVCREFQRNKCSRQDTECKFAHPPANVEVQNGKVTACYDSIKGRCNRDKPPCKYFHPPQHLKDQLL 87          
BLAST of Muscleblind protein vs. Ensembl Fly
Match: mbl (gene:FBgn0265487 transcript:FBtr0086992)

HSP 1 Score: 125.561 bits (314), Expect = 2.389e-31
Identity = 52/75 (69.33%), Postives = 61/75 (81.33%), Query Frame = 1
Query: 1177 NKDSQWLTLEVCREFQRSMCPRNELECKYAHPPPYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLKDLLI 1401
             KDS+WL LEVCREFQR+ C R + ECK+AHPP  +E QNG+V  CYDSIKG+C+R KPPCKY HPPQHLKD L+
Sbjct:   13 GKDSRWLQLEVCREFQRNKCSRQDTECKFAHPPANVEVQNGKVTACYDSIKGRCNRDKPPCKYFHPPQHLKDQLL 87          
BLAST of Muscleblind protein vs. Ensembl Fly
Match: mbl (gene:FBgn0265487 transcript:FBtr0306603)

HSP 1 Score: 130.954 bits (328), Expect = 8.249e-31
Identity = 52/75 (69.33%), Postives = 61/75 (81.33%), Query Frame = 1
Query: 1177 NKDSQWLTLEVCREFQRSMCPRNELECKYAHPPPYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLKDLLI 1401
             KDS+WL LEVCREFQR+ C R + ECK+AHPP  +E QNG+V  CYDSIKG+C+R KPPCKY HPPQHLKD L+
Sbjct:   13 GKDSRWLQLEVCREFQRNKCSRQDTECKFAHPPANVEVQNGKVTACYDSIKGRCNRDKPPCKYFHPPQHLKDQLL 87          
BLAST of Muscleblind protein vs. Ensembl Fly
Match: mbl (gene:FBgn0265487 transcript:FBtr0306604)

HSP 1 Score: 130.954 bits (328), Expect = 8.650e-31
Identity = 52/75 (69.33%), Postives = 61/75 (81.33%), Query Frame = 1
Query: 1177 NKDSQWLTLEVCREFQRSMCPRNELECKYAHPPPYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLKDLLI 1401
             KDS+WL LEVCREFQR+ C R + ECK+AHPP  +E QNG+V  CYDSIKG+C+R KPPCKY HPPQHLKD L+
Sbjct:   13 GKDSRWLQLEVCREFQRNKCSRQDTECKFAHPPANVEVQNGKVTACYDSIKGRCNRDKPPCKYFHPPQHLKDQLL 87          
BLAST of Muscleblind protein vs. Ensembl Zebrafish
Match: mbnl3 (muscleblind-like splicing regulator 3 [Source:ZFIN;Acc:ZDB-GENE-081002-3])

HSP 1 Score: 107.842 bits (268), Expect = 8.070e-25
Identity = 47/81 (58.02%), Postives = 58/81 (71.60%), Query Frame = 1
Query: 1156 MTVNNTANKDSQWLTLEVCREFQRSMCPRNELECKYAHPPPYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLKDLL 1398
            M VN T  +D++WLTLEVCREFQR  C R++ ECK+AHP      +NGRV+ C+DS+KG+C R    CKYLHPP HLK  L
Sbjct:    1 MAVNVTMGRDTKWLTLEVCREFQRGTCSRSDSECKFAHPSRTCHVENGRVIACFDSLKGRCTRDN--CKYLHPPPHLKTQL 79          

HSP 2 Score: 78.1814 bits (191), Expect = 6.369e-15
Identity = 40/97 (41.24%), Postives = 53/97 (54.64%), Query Frame = 1
Query: 1105 LQPNTGTTLQQNPVPLAMTVNNTANKDSQWLTLEVCREFQRSMCPRNELECKYAHP--PPYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLK 1389
            L P+    +  +P  + M   N+  K  +   LEVCREFQR  C R E +C+YAHP     ++     V+ C D IKG+C R K  CKY HPP HL+
Sbjct:  147 LLPSAPVLVPGSPTGITMGNGNSTQKHVRTDKLEVCREFQRGNCTRGENDCRYAHPMEAAMVDGSENSVIVCMDYIKGRCTRDK--CKYFHPPAHLQ 241          
BLAST of Muscleblind protein vs. Ensembl Zebrafish
Match: mbnl3 (muscleblind-like splicing regulator 3 [Source:ZFIN;Acc:ZDB-GENE-081002-3])

HSP 1 Score: 107.457 bits (267), Expect = 1.285e-24
Identity = 47/81 (58.02%), Postives = 58/81 (71.60%), Query Frame = 1
Query: 1156 MTVNNTANKDSQWLTLEVCREFQRSMCPRNELECKYAHPPPYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLKDLL 1398
            M VN T  +D++WLTLEVCREFQR  C R++ ECK+AHP      +NGRV+ C+DS+KG+C R    CKYLHPP HLK  L
Sbjct:    1 MAVNVTMGRDTKWLTLEVCREFQRGTCSRSDSECKFAHPSRTCHVENGRVIACFDSLKGRCTRDN--CKYLHPPPHLKTQL 79          

HSP 2 Score: 77.7962 bits (190), Expect = 8.340e-15
Identity = 40/97 (41.24%), Postives = 53/97 (54.64%), Query Frame = 1
Query: 1105 LQPNTGTTLQQNPVPLAMTVNNTANKDSQWLTLEVCREFQRSMCPRNELECKYAHP--PPYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLK 1389
            L P+    +  +P  + M   N+  K  +   LEVCREFQR  C R E +C+YAHP     ++     V+ C D IKG+C R K  CKY HPP HL+
Sbjct:  147 LLPSAPVLVPGSPTGITMGNGNSTQKHVRTDKLEVCREFQRGNCTRGENDCRYAHPMEAAMVDGSENSVIVCMDYIKGRCTRDK--CKYFHPPAHLQ 241          
BLAST of Muscleblind protein vs. Ensembl Zebrafish
Match: mbnl2 (muscleblind-like splicing regulator 2 [Source:ZFIN;Acc:ZDB-GENE-030131-9582])

HSP 1 Score: 106.686 bits (265), Expect = 1.572e-24
Identity = 45/81 (55.56%), Postives = 60/81 (74.07%), Query Frame = 1
Query: 1156 MTVNNTANKDSQWLTLEVCREFQRSMCPRNELECKYAHPPPYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLKDLL 1398
            M +N  + +D++WLTLEVCR+FQR  C R++ ECK+AHPP   + +NGRV+ C+DS+KG+C R    CKYLHPP HLK  L
Sbjct:    1 MALNIASIRDTKWLTLEVCRQFQRGTCSRSDEECKFAHPPKSCQVENGRVIACFDSLKGRCTREN--CKYLHPPAHLKTQL 79          

HSP 2 Score: 75.0998 bits (183), Expect = 6.693e-14
Identity = 35/65 (53.85%), Postives = 42/65 (64.62%), Query Frame = 1
Query: 1201 LEVCREFQRSMCPRNELECKYAHP--PPYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLK 1389
            LEVCREFQR  C R E +C++AHP   P I+T +  V  C D IK +C R K  CKY HPP HL+
Sbjct:  179 LEVCREFQRGNCARGETDCRFAHPSDSPMIDTSDNTVTVCMDYIKSRCSREK--CKYFHPPAHLQ 241          
BLAST of Muscleblind protein vs. Ensembl Zebrafish
Match: mbnl2 (muscleblind-like splicing regulator 2 [Source:ZFIN;Acc:ZDB-GENE-030131-9582])

HSP 1 Score: 106.686 bits (265), Expect = 1.572e-24
Identity = 45/81 (55.56%), Postives = 60/81 (74.07%), Query Frame = 1
Query: 1156 MTVNNTANKDSQWLTLEVCREFQRSMCPRNELECKYAHPPPYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLKDLL 1398
            M +N  + +D++WLTLEVCR+FQR  C R++ ECK+AHPP   + +NGRV+ C+DS+KG+C R    CKYLHPP HLK  L
Sbjct:    1 MALNIASIRDTKWLTLEVCRQFQRGTCSRSDEECKFAHPPKSCQVENGRVIACFDSLKGRCTREN--CKYLHPPAHLKTQL 79          

HSP 2 Score: 75.0998 bits (183), Expect = 6.693e-14
Identity = 35/65 (53.85%), Postives = 42/65 (64.62%), Query Frame = 1
Query: 1201 LEVCREFQRSMCPRNELECKYAHP--PPYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLK 1389
            LEVCREFQR  C R E +C++AHP   P I+T +  V  C D IK +C R K  CKY HPP HL+
Sbjct:  179 LEVCREFQRGNCARGETDCRFAHPSDSPMIDTSDNTVTVCMDYIKSRCSREK--CKYFHPPAHLQ 241          
BLAST of Muscleblind protein vs. Ensembl Zebrafish
Match: mbnl2 (muscleblind-like splicing regulator 2 [Source:ZFIN;Acc:ZDB-GENE-030131-9582])

HSP 1 Score: 107.457 bits (267), Expect = 1.651e-24
Identity = 45/81 (55.56%), Postives = 60/81 (74.07%), Query Frame = 1
Query: 1156 MTVNNTANKDSQWLTLEVCREFQRSMCPRNELECKYAHPPPYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLKDLL 1398
            M +N  + +D++WLTLEVCR+FQR  C R++ ECK+AHPP   + +NGRV+ C+DS+KG+C R    CKYLHPP HLK  L
Sbjct:    1 MALNIASIRDTKWLTLEVCRQFQRGTCSRSDEECKFAHPPKSCQVENGRVIACFDSLKGRCTREN--CKYLHPPAHLKTQL 79          

HSP 2 Score: 75.485 bits (184), Expect = 5.764e-14
Identity = 35/65 (53.85%), Postives = 42/65 (64.62%), Query Frame = 1
Query: 1201 LEVCREFQRSMCPRNELECKYAHP--PPYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLK 1389
            LEVCREFQR  C R E +C++AHP   P I+T +  V  C D IK +C R K  CKY HPP HL+
Sbjct:  179 LEVCREFQRGNCARGETDCRFAHPSDSPMIDTSDNTVTVCMDYIKSRCSREK--CKYFHPPAHLQ 241          
BLAST of Muscleblind protein vs. Ensembl Xenopus
Match: mbnl2 (muscleblind-like splicing regulator 2 [Source:NCBI gene;Acc:780224])

HSP 1 Score: 107.457 bits (267), Expect = 2.152e-24
Identity = 45/81 (55.56%), Postives = 59/81 (72.84%), Query Frame = 1
Query: 1156 MTVNNTANKDSQWLTLEVCREFQRSMCPRNELECKYAHPPPYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLKDLL 1398
            M +N    +D++WLTLEVCR+FQR  C R++ ECK+AHPP   + +NGRV+ C+DS+KG+C R    CKYLHPP HLK  L
Sbjct:    1 MALNVAPVRDTKWLTLEVCRQFQRGTCSRSDEECKFAHPPKSCQVENGRVIACFDSLKGRCSREN--CKYLHPPTHLKTQL 79          

HSP 2 Score: 78.5666 bits (192), Expect = 8.992e-15
Identity = 43/101 (42.57%), Postives = 59/101 (58.42%), Query Frame = 1
Query: 1093 VTTLLQPNTGTTLQQNPVPLAMTVNNTANKDSQWLTLEVCREFQRSMCPRNELECKYAHPP--PYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLK 1389
            V T + P+T   +  +P P+++  +  A K  +   LEVCREFQR  C R E +C++AHP     I+T +  V  C D IKG+C R K  CKY HPP HL+
Sbjct:  144 VPTEILPSTPVIVPGSP-PVSVPGSTAAQKLLRTDKLEVCREFQRGNCARGETDCRFAHPADSTMIDTNDNTVTVCMDYIKGRCMREK--CKYFHPPAHLQ 241          
BLAST of Muscleblind protein vs. Ensembl Xenopus
Match: mbnl2 (muscleblind-like splicing regulator 2 [Source:NCBI gene;Acc:780224])

HSP 1 Score: 107.842 bits (268), Expect = 2.252e-24
Identity = 45/81 (55.56%), Postives = 59/81 (72.84%), Query Frame = 1
Query: 1156 MTVNNTANKDSQWLTLEVCREFQRSMCPRNELECKYAHPPPYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLKDLL 1398
            M +N    +D++WLTLEVCR+FQR  C R++ ECK+AHPP   + +NGRV+ C+DS+KG+C R    CKYLHPP HLK  L
Sbjct:    1 MALNVAPVRDTKWLTLEVCRQFQRGTCSRSDEECKFAHPPKSCQVENGRVIACFDSLKGRCSREN--CKYLHPPTHLKTQL 79          

HSP 2 Score: 78.5666 bits (192), Expect = 9.397e-15
Identity = 43/101 (42.57%), Postives = 59/101 (58.42%), Query Frame = 1
Query: 1093 VTTLLQPNTGTTLQQNPVPLAMTVNNTANKDSQWLTLEVCREFQRSMCPRNELECKYAHPP--PYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLK 1389
            V T + P+T   +  +P P+++  +  A K  +   LEVCREFQR  C R E +C++AHP     I+T +  V  C D IKG+C R K  CKY HPP HL+
Sbjct:  144 VPTEILPSTPVIVPGSP-PVSVPGSTAAQKLLRTDKLEVCREFQRGNCARGETDCRFAHPADSTMIDTNDNTVTVCMDYIKGRCMREK--CKYFHPPAHLQ 241          
BLAST of Muscleblind protein vs. Ensembl Xenopus
Match: MBNL3 (muscleblind-like splicing regulator 3 [Source:NCBI gene;Acc:100496456])

HSP 1 Score: 106.301 bits (264), Expect = 4.517e-24
Identity = 46/81 (56.79%), Postives = 58/81 (71.60%), Query Frame = 1
Query: 1156 MTVNNTANKDSQWLTLEVCREFQRSMCPRNELECKYAHPPPYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLKDLL 1398
            M VN +  +D++WLTLEVCREFQR  C R++ ECK+AHP      +NGRV+ C+DS+KG+C R    CKYLHPP HLK  L
Sbjct:    1 MAVNVSLVRDTKWLTLEVCREFQRGTCSRSDAECKFAHPSRSCHVENGRVIACFDSLKGRCTREN--CKYLHPPPHLKTQL 79          

HSP 2 Score: 78.5666 bits (192), Expect = 7.490e-15
Identity = 49/109 (44.95%), Postives = 58/109 (53.21%), Query Frame = 1
Query: 1075 GMNSNPVTTLLQPNTGTTLQQNPVPLAMTV--NNTANKDSQWLTLEVCREFQRSMCPRNELECKYAHP--PPYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLK 1389
            GM   P   L  PNT   +  NP   A+TV   +   K  +   LEVCREFQR  C R E +C+YAHP     I+T    V  C D IKG+C R K  CKY HPP HL+
Sbjct:  140 GMGLVPAELL--PNTPVLVSGNP---AVTVPGGSAGQKLVRTDKLEVCREFQRGNCTRGENDCRYAHPIDIAMIDTNENTVTVCMDYIKGRCSREK--CKYFHPPAHLQ 241          
BLAST of Muscleblind protein vs. Ensembl Xenopus
Match: MBNL3 (muscleblind-like splicing regulator 3 [Source:NCBI gene;Acc:100496456])

HSP 1 Score: 105.145 bits (261), Expect = 6.549e-24
Identity = 46/81 (56.79%), Postives = 58/81 (71.60%), Query Frame = 1
Query: 1156 MTVNNTANKDSQWLTLEVCREFQRSMCPRNELECKYAHPPPYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLKDLL 1398
            M VN +  +D++WLTLEVCREFQR  C R++ ECK+AHP      +NGRV+ C+DS+KG+C R    CKYLHPP HLK  L
Sbjct:    1 MAVNVSLVRDTKWLTLEVCREFQRGTCSRSDAECKFAHPSRSCHVENGRVIACFDSLKGRCTREN--CKYLHPPPHLKTQL 79          

HSP 2 Score: 77.7962 bits (190), Expect = 8.037e-15
Identity = 49/109 (44.95%), Postives = 58/109 (53.21%), Query Frame = 1
Query: 1075 GMNSNPVTTLLQPNTGTTLQQNPVPLAMTV--NNTANKDSQWLTLEVCREFQRSMCPRNELECKYAHP--PPYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLK 1389
            GM   P   L  PNT   +  NP   A+TV   +   K  +   LEVCREFQR  C R E +C+YAHP     I+T    V  C D IKG+C R K  CKY HPP HL+
Sbjct:  140 GMGLVPAELL--PNTPVLVSGNP---AVTVPGGSAGQKLVRTDKLEVCREFQRGNCTRGENDCRYAHPIDIAMIDTNENTVTVCMDYIKGRCSREK--CKYFHPPAHLQ 241          
BLAST of Muscleblind protein vs. Ensembl Xenopus
Match: mbnl2 (muscleblind-like splicing regulator 2 [Source:NCBI gene;Acc:780224])

HSP 1 Score: 106.301 bits (264), Expect = 6.604e-24
Identity = 45/81 (55.56%), Postives = 59/81 (72.84%), Query Frame = 1
Query: 1156 MTVNNTANKDSQWLTLEVCREFQRSMCPRNELECKYAHPPPYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLKDLL 1398
            M +N    +D++WLTLEVCR+FQR  C R++ ECK+AHPP   + +NGRV+ C+DS+KG+C R    CKYLHPP HLK  L
Sbjct:    1 MALNVAPVRDTKWLTLEVCRQFQRGTCSRSDEECKFAHPPKSCQVENGRVIACFDSLKGRCSREN--CKYLHPPTHLKTQL 79          

HSP 2 Score: 77.7962 bits (190), Expect = 1.511e-14
Identity = 43/101 (42.57%), Postives = 59/101 (58.42%), Query Frame = 1
Query: 1093 VTTLLQPNTGTTLQQNPVPLAMTVNNTANKDSQWLTLEVCREFQRSMCPRNELECKYAHPP--PYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLK 1389
            V T + P+T   +  +P P+++  +  A K  +   LEVCREFQR  C R E +C++AHP     I+T +  V  C D IKG+C R K  CKY HPP HL+
Sbjct:  144 VPTEILPSTPVIVPGSP-PVSVPGSTAAQKLLRTDKLEVCREFQRGNCARGETDCRFAHPADSTMIDTNDNTVTVCMDYIKGRCMREK--CKYFHPPAHLQ 241          
BLAST of Muscleblind protein vs. Ensembl Mouse
Match: Mbnl1 (muscleblind like splicing factor 1 [Source:MGI Symbol;Acc:MGI:1928482])

HSP 1 Score: 105.145 bits (261), Expect = 2.255e-25
Identity = 46/81 (56.79%), Postives = 58/81 (71.60%), Query Frame = 1
Query: 1156 MTVNNTANKDSQWLTLEVCREFQRSMCPRNELECKYAHPPPYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLKDLL 1398
            M V+ T  +D++WLTLEVCREFQR  C R + ECK+AHP    + +NGRV+ C+DS+KG+C R    CKYLHPP HLK  L
Sbjct:    1 MAVSVTPIRDTKWLTLEVCREFQRGTCSRPDTECKFAHPSKSCQVENGRVIACFDSLKGRCSREN--CKYLHPPPHLKTQL 79          
BLAST of Muscleblind protein vs. Ensembl Mouse
Match: Mbnl2 (muscleblind like splicing factor 2 [Source:MGI Symbol;Acc:MGI:2145597])

HSP 1 Score: 105.531 bits (262), Expect = 5.361e-24
Identity = 44/81 (54.32%), Postives = 59/81 (72.84%), Query Frame = 1
Query: 1156 MTVNNTANKDSQWLTLEVCREFQRSMCPRNELECKYAHPPPYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLKDLL 1398
            M +N    +D++WLTLEVCR++QR  C R++ ECK+AHPP   + +NGRV+ C+DS+KG+C R    CKYLHPP HLK  L
Sbjct:    1 MALNVAPVRDTKWLTLEVCRQYQRGTCSRSDEECKFAHPPKSCQVENGRVIACFDSLKGRCSREN--CKYLHPPTHLKTQL 79          

HSP 2 Score: 75.485 bits (184), Expect = 6.053e-14
Identity = 35/65 (53.85%), Postives = 42/65 (64.62%), Query Frame = 1
Query: 1201 LEVCREFQRSMCPRNELECKYAHPP--PYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLK 1389
            LEVCREFQR  C R E +C++AHP     I+T +  V  C D IKG+C R K  CKY HPP HL+
Sbjct:  179 LEVCREFQRGNCARGETDCRFAHPADSTMIDTNDNTVTVCMDYIKGRCMREK--CKYFHPPAHLQ 241          
BLAST of Muscleblind protein vs. Ensembl Mouse
Match: Mbnl2 (muscleblind like splicing factor 2 [Source:MGI Symbol;Acc:MGI:2145597])

HSP 1 Score: 105.531 bits (262), Expect = 5.361e-24
Identity = 44/81 (54.32%), Postives = 59/81 (72.84%), Query Frame = 1
Query: 1156 MTVNNTANKDSQWLTLEVCREFQRSMCPRNELECKYAHPPPYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLKDLL 1398
            M +N    +D++WLTLEVCR++QR  C R++ ECK+AHPP   + +NGRV+ C+DS+KG+C R    CKYLHPP HLK  L
Sbjct:    1 MALNVAPVRDTKWLTLEVCRQYQRGTCSRSDEECKFAHPPKSCQVENGRVIACFDSLKGRCSREN--CKYLHPPTHLKTQL 79          

HSP 2 Score: 75.485 bits (184), Expect = 6.053e-14
Identity = 35/65 (53.85%), Postives = 42/65 (64.62%), Query Frame = 1
Query: 1201 LEVCREFQRSMCPRNELECKYAHPP--PYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLK 1389
            LEVCREFQR  C R E +C++AHP     I+T +  V  C D IKG+C R K  CKY HPP HL+
Sbjct:  179 LEVCREFQRGNCARGETDCRFAHPADSTMIDTNDNTVTVCMDYIKGRCMREK--CKYFHPPAHLQ 241          
BLAST of Muscleblind protein vs. Ensembl Mouse
Match: Mbnl2 (muscleblind like splicing factor 2 [Source:MGI Symbol;Acc:MGI:2145597])

HSP 1 Score: 105.916 bits (263), Expect = 5.393e-24
Identity = 44/81 (54.32%), Postives = 59/81 (72.84%), Query Frame = 1
Query: 1156 MTVNNTANKDSQWLTLEVCREFQRSMCPRNELECKYAHPPPYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLKDLL 1398
            M +N    +D++WLTLEVCR++QR  C R++ ECK+AHPP   + +NGRV+ C+DS+KG+C R    CKYLHPP HLK  L
Sbjct:    1 MALNVAPVRDTKWLTLEVCRQYQRGTCSRSDEECKFAHPPKSCQVENGRVIACFDSLKGRCSREN--CKYLHPPTHLKTQL 79          

HSP 2 Score: 75.8702 bits (185), Expect = 5.472e-14
Identity = 35/65 (53.85%), Postives = 42/65 (64.62%), Query Frame = 1
Query: 1201 LEVCREFQRSMCPRNELECKYAHPP--PYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLK 1389
            LEVCREFQR  C R E +C++AHP     I+T +  V  C D IKG+C R K  CKY HPP HL+
Sbjct:  179 LEVCREFQRGNCARGETDCRFAHPADSTMIDTNDNTVTVCMDYIKGRCMREK--CKYFHPPAHLQ 241          
BLAST of Muscleblind protein vs. Ensembl Mouse
Match: Mbnl2 (muscleblind like splicing factor 2 [Source:MGI Symbol;Acc:MGI:2145597])

HSP 1 Score: 105.916 bits (263), Expect = 5.393e-24
Identity = 44/81 (54.32%), Postives = 59/81 (72.84%), Query Frame = 1
Query: 1156 MTVNNTANKDSQWLTLEVCREFQRSMCPRNELECKYAHPPPYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLKDLL 1398
            M +N    +D++WLTLEVCR++QR  C R++ ECK+AHPP   + +NGRV+ C+DS+KG+C R    CKYLHPP HLK  L
Sbjct:    1 MALNVAPVRDTKWLTLEVCRQYQRGTCSRSDEECKFAHPPKSCQVENGRVIACFDSLKGRCSREN--CKYLHPPTHLKTQL 79          

HSP 2 Score: 75.8702 bits (185), Expect = 5.472e-14
Identity = 35/65 (53.85%), Postives = 42/65 (64.62%), Query Frame = 1
Query: 1201 LEVCREFQRSMCPRNELECKYAHPP--PYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLK 1389
            LEVCREFQR  C R E +C++AHP     I+T +  V  C D IKG+C R K  CKY HPP HL+
Sbjct:  179 LEVCREFQRGNCARGETDCRFAHPADSTMIDTNDNTVTVCMDYIKGRCMREK--CKYFHPPAHLQ 241          
BLAST of Muscleblind protein vs. UniProt/SwissProt
Match: sp|O16011|MBL_DROME (Protein muscleblind OS=Drosophila melanogaster OX=7227 GN=mbl PE=2 SV=2)

HSP 1 Score: 125.561 bits (314), Expect = 2.395e-30
Identity = 52/75 (69.33%), Postives = 61/75 (81.33%), Query Frame = 1
Query: 1177 NKDSQWLTLEVCREFQRSMCPRNELECKYAHPPPYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLKDLLI 1401
             KDS+WL LEVCREFQR+ C R + ECK+AHPP  +E QNG+V  CYDSIKG+C+R KPPCKY HPPQHLKD L+
Sbjct:   13 GKDSRWLQLEVCREFQRNKCSRQDTECKFAHPPANVEVQNGKVTACYDSIKGRCNRDKPPCKYFHPPQHLKDQLL 87          
BLAST of Muscleblind protein vs. UniProt/SwissProt
Match: sp|Q94250|MBL_CAEEL (Muscleblind-like protein OS=Caenorhabditis elegans OX=6239 GN=mbl-1 PE=1 SV=2)

HSP 1 Score: 120.553 bits (301), Expect = 1.748e-28
Identity = 48/74 (64.86%), Postives = 58/74 (78.38%), Query Frame = 1
Query: 1180 KDSQWLTLEVCREFQRSMCPRNELECKYAHPPPYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLKDLLI 1401
            KDS+WL +EVCREF R  C R++ ECK+AHPPP ++ Q GRV  CYDSIKG+C R  P CKYLHPPQH+KD L+
Sbjct:   34 KDSRWLQVEVCREFLRGQCARSDQECKFAHPPPNVDVQQGRVTACYDSIKGRCTRENPKCKYLHPPQHIKDQLL 107          
BLAST of Muscleblind protein vs. UniProt/SwissProt
Match: sp|A8XND8|MBL_CAEBR (Muscleblind-like protein OS=Caenorhabditis briggsae OX=6238 GN=mbl-1 PE=3 SV=2)

HSP 1 Score: 119.783 bits (299), Expect = 2.084e-28
Identity = 48/74 (64.86%), Postives = 58/74 (78.38%), Query Frame = 1
Query: 1180 KDSQWLTLEVCREFQRSMCPRNELECKYAHPPPYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLKDLLI 1401
            KDS+WL +EVCREF R  C R++ ECK+AHPPP ++ Q GRV  CYDSIKG+C R  P CKYLHPPQH+KD L+
Sbjct:   34 KDSRWLQVEVCREFLRGQCARSDQECKFAHPPPNVDVQQGRVTACYDSIKGRCTRENPKCKYLHPPQHIKDQLL 107          
BLAST of Muscleblind protein vs. UniProt/SwissProt
Match: sp|Q56V19|MBNL3_TAKRU (Muscleblind-like protein 3 OS=Takifugu rubripes OX=31033 GN=mbnl3 PE=2 SV=1)

HSP 1 Score: 107.457 bits (267), Expect = 5.755e-24
Identity = 47/81 (58.02%), Postives = 58/81 (71.60%), Query Frame = 1
Query: 1156 MTVNNTANKDSQWLTLEVCREFQRSMCPRNELECKYAHPPPYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLKDLL 1398
            M VN T  +D++WLTLEVCREFQR  C R++ ECK+AHP      +NGRV+ C+DS+KG+C R    CKYLHPP HLK  L
Sbjct:    1 MAVNMTMGRDTKWLTLEVCREFQRGTCSRSDAECKFAHPSRSCHVENGRVIACFDSLKGRCTREN--CKYLHPPPHLKTQL 79          

HSP 2 Score: 79.337 bits (194), Expect = 1.500e-14
Identity = 48/113 (42.48%), Postives = 62/113 (54.87%), Query Frame = 1
Query: 1060 NQMLLGMNSNPVTTLLQPNTGTTLQQNPVPLAMTVNNTAN-KDSQWLTLEVCREFQRSMCPRNELECKYAHP--PPYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLK 1389
            N M  GM   P    L P+T   +  +P  LA   N T++ K  +   LEVCREFQR  C R E +C+YAHP     +++    V+ C D IKG+C R K  CKY HPP HL+
Sbjct:  135 NHMGPGMGLMPE---LLPSTPLLVPGSPTGLAAMSNGTSSPKHMRTDKLEVCREFQRGNCTRGESDCRYAHPLEAGMVDSSENSVIVCMDYIKGRCSRDK--CKYFHPPAHLQ 242          
BLAST of Muscleblind protein vs. UniProt/SwissProt
Match: sp|Q6Q2B2|MBN2A_TAKRU (Muscleblind-like protein 2a OS=Takifugu rubripes OX=31033 GN=mbnl2a PE=2 SV=1)

HSP 1 Score: 107.457 bits (267), Expect = 8.434e-24
Identity = 45/81 (55.56%), Postives = 60/81 (74.07%), Query Frame = 1
Query: 1156 MTVNNTANKDSQWLTLEVCREFQRSMCPRNELECKYAHPPPYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLKDLL 1398
            M +N  + +D++WLTLEVCR+FQR  C R++ ECK+AHPP   + +NGRV+ C+DS+KG+C R    CKYLHPP HLK  L
Sbjct:    1 MALNIASIRDTKWLTLEVCRQFQRGTCSRSDEECKFAHPPKSCQVENGRVIACFDSLKGRCTREN--CKYLHPPAHLKTQL 79          

HSP 2 Score: 78.5666 bits (192), Expect = 3.948e-14
Identity = 44/102 (43.14%), Postives = 62/102 (60.78%), Query Frame = 1
Query: 1093 VTTLLQPNTGTTLQQNPVPLAMTVNNTAN-KDSQWLTLEVCREFQRSMCPRNELECKYAHP--PPYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLK 1389
            V T + P+T   +  +P P+++T  +++N K  +   LEVCREFQR  C R E +C++AHP   P I+T +  V  C D IK +C R K  CKY HPP HL+
Sbjct:  144 VPTDILPSTPVIVPGSP-PVSVTAGSSSNQKLLRTDKLEVCREFQRGNCARGETDCRFAHPSDSPMIDTSDNTVTVCMDYIKSRCSREK--CKYFHPPAHLQ 242          
BLAST of Muscleblind protein vs. TrEMBL
Match: A0A1S3J9K4 (muscleblind-like protein isoform X8 OS=Lingula unguis OX=7574 GN=LOC106171214 PE=4 SV=1)

HSP 1 Score: 141.739 bits (356), Expect = 4.218e-33
Identity = 58/88 (65.91%), Postives = 70/88 (79.55%), Query Frame = 1
Query: 1138 NPVPLAMTVNNTANKDSQWLTLEVCREFQRSMCPRNELECKYAHPPPYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLKDLLI 1401
            NP+  A        KDS+WLTLEVCRE+QR+ C R ELECK+AHPPP++E QNGRV CC+DSIKGKC R +PPCKYLHPPQHL++ L+
Sbjct:   17 NPMAAAQLATLANQKDSRWLTLEVCREYQRNKCTRTELECKFAHPPPHVEVQNGRVTCCFDSIKGKCQRKEPPCKYLHPPQHLREQLL 104          
BLAST of Muscleblind protein vs. TrEMBL
Match: A0A1S3J9A9 (muscleblind-like protein isoform X5 OS=Lingula unguis OX=7574 GN=LOC106171214 PE=4 SV=1)

HSP 1 Score: 142.124 bits (357), Expect = 5.128e-33
Identity = 58/88 (65.91%), Postives = 70/88 (79.55%), Query Frame = 1
Query: 1138 NPVPLAMTVNNTANKDSQWLTLEVCREFQRSMCPRNELECKYAHPPPYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLKDLLI 1401
            NP+  A        KDS+WLTLEVCRE+QR+ C R ELECK+AHPPP++E QNGRV CC+DSIKGKC R +PPCKYLHPPQHL++ L+
Sbjct:   17 NPMAAAQLATLANQKDSRWLTLEVCREYQRNKCTRTELECKFAHPPPHVEVQNGRVTCCFDSIKGKCQRKEPPCKYLHPPQHLREQLL 104          
BLAST of Muscleblind protein vs. TrEMBL
Match: A0A1S3JAI9 (muscleblind-like protein isoform X6 OS=Lingula unguis OX=7574 GN=LOC106171214 PE=4 SV=1)

HSP 1 Score: 141.739 bits (356), Expect = 7.099e-33
Identity = 58/88 (65.91%), Postives = 70/88 (79.55%), Query Frame = 1
Query: 1138 NPVPLAMTVNNTANKDSQWLTLEVCREFQRSMCPRNELECKYAHPPPYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLKDLLI 1401
            NP+  A        KDS+WLTLEVCRE+QR+ C R ELECK+AHPPP++E QNGRV CC+DSIKGKC R +PPCKYLHPPQHL++ L+
Sbjct:   17 NPMAAAQLATLANQKDSRWLTLEVCREYQRNKCTRTELECKFAHPPPHVEVQNGRVTCCFDSIKGKCQRKEPPCKYLHPPQHLREQLL 104          
BLAST of Muscleblind protein vs. TrEMBL
Match: A0A1S3J9K1 (muscleblind-like protein isoform X3 OS=Lingula unguis OX=7574 GN=LOC106171214 PE=4 SV=1)

HSP 1 Score: 142.124 bits (357), Expect = 9.400e-33
Identity = 58/88 (65.91%), Postives = 70/88 (79.55%), Query Frame = 1
Query: 1138 NPVPLAMTVNNTANKDSQWLTLEVCREFQRSMCPRNELECKYAHPPPYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLKDLLI 1401
            NP+  A        KDS+WLTLEVCRE+QR+ C R ELECK+AHPPP++E QNGRV CC+DSIKGKC R +PPCKYLHPPQHL++ L+
Sbjct:   17 NPMAAAQLATLANQKDSRWLTLEVCREYQRNKCTRTELECKFAHPPPHVEVQNGRVTCCFDSIKGKCQRKEPPCKYLHPPQHLREQLL 104          
BLAST of Muscleblind protein vs. TrEMBL
Match: A0A2P2I156 (Protein muscleblind-like (Fragment) OS=Hirondellea gigas OX=1518452 PE=2 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 1.344e-32
Identity = 65/114 (57.02%), Postives = 78/114 (68.42%), Query Frame = 1
Query: 1087 NPVTTLLQPNTGTTLQQNPV-----PLAMTV---NNTAN-KDSQWLTLEVCREFQRSMCPRNELECKYAHPPPYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLKDLLI 1401
            +P   ++QP+ G  +   P      P  M V   NN  N KDS+WL LEVCREFQR+ C R + ECK+AHPPP +E QNGRV  CYDSIKG+C+R KPPCKY HPPQHLKD L+
Sbjct:    2 DPSAGVIQPSNGGPMPGGPYNQMVNPANMAVVSMNNILNVKDSRWLQLEVCREFQRNKCTRPDTECKFAHPPPNVEVQNGRVTACYDSIKGRCNREKPPCKYFHPPQHLKDQLL 115          
BLAST of Muscleblind protein vs. Ensembl Cavefish
Match: MBNL1 (muscleblind-like protein 1 [Source:NCBI gene;Acc:103026224])

HSP 1 Score: 106.686 bits (265), Expect = 2.794e-24
Identity = 47/81 (58.02%), Postives = 58/81 (71.60%), Query Frame = 1
Query: 1156 MTVNNTANKDSQWLTLEVCREFQRSMCPRNELECKYAHPPPYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLKDLL 1398
            M VN T  +D++WLTLEVCREFQR  C R + ECK+AHP    + +NGRV+ C+DS+KG+C R    CKYLHPP HLK  L
Sbjct:    1 MAVNVTPIRDTKWLTLEVCREFQRGTCSRPDSECKFAHPAKSCQVENGRVIACFDSLKGRCSREN--CKYLHPPPHLKTQL 79          

HSP 2 Score: 70.4774 bits (171), Expect = 2.227e-12
Identity = 41/102 (40.20%), Postives = 56/102 (54.90%), Query Frame = 1
Query: 1093 VTTLLQPNTGTTLQQNP-VPLAMTVNNTANKDSQWLTLEVCREFQRSMCPRNELECKYAHPP--PYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLK 1389
            V T + P+    +  +P VP+       A K  +   LEVCRE+QR  C R + +C++AHP     I+T +  V  C D IKG+C R K  CKY HPP HL+
Sbjct:  146 VPTEILPSAPVLVTSSPNVPVPAAAAAAAQKLMRTDRLEVCREYQRGNCTRGKNDCRFAHPADSTMIDTNDNTVTVCMDYIKGRCSREK--CKYFHPPAHLQ 245          
BLAST of Muscleblind protein vs. Ensembl Cavefish
Match: MBNL2 (muscleblind-like protein 2a [Source:NCBI gene;Acc:103042222])

HSP 1 Score: 107.071 bits (266), Expect = 2.812e-24
Identity = 46/81 (56.79%), Postives = 59/81 (72.84%), Query Frame = 1
Query: 1156 MTVNNTANKDSQWLTLEVCREFQRSMCPRNELECKYAHPPPYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLKDLL 1398
            M+V   A +D++WLTLEVCR+FQR  C R++ ECK+AHPP   +  NGRV+ C+DS+KG+C R    CKYLHPP HLK  L
Sbjct:    1 MSVALPAMRDTKWLTLEVCRQFQRGTCSRSDEECKFAHPPKSCQVDNGRVIACFDSLKGRCSRDN--CKYLHPPSHLKSQL 79          

HSP 2 Score: 73.9442 bits (180), Expect = 1.995e-13
Identity = 34/68 (50.00%), Postives = 43/68 (63.24%), Query Frame = 1
Query: 1201 LEVCREFQRSMCPRNELECKYAHP--PPYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLKDLL 1398
            LEVCREFQR  C R E +C++AHP   P I++ +  V  C D +K +C R K  CKY HPP HL+  L
Sbjct:  185 LEVCREFQRGSCSRGETDCRFAHPSDSPMIDSTDNTVTVCMDYVKSRCSREK--CKYFHPPAHLQARL 250          
BLAST of Muscleblind protein vs. Ensembl Cavefish
Match: MBNL2 (muscleblind-like protein 2a [Source:NCBI gene;Acc:103042222])

HSP 1 Score: 106.686 bits (265), Expect = 2.941e-24
Identity = 46/81 (56.79%), Postives = 59/81 (72.84%), Query Frame = 1
Query: 1156 MTVNNTANKDSQWLTLEVCREFQRSMCPRNELECKYAHPPPYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLKDLL 1398
            M+V   A +D++WLTLEVCR+FQR  C R++ ECK+AHPP   +  NGRV+ C+DS+KG+C R    CKYLHPP HLK  L
Sbjct:    1 MSVALPAMRDTKWLTLEVCRQFQRGTCSRSDEECKFAHPPKSCQVDNGRVIACFDSLKGRCSRDN--CKYLHPPSHLKSQL 79          

HSP 2 Score: 73.559 bits (179), Expect = 2.231e-13
Identity = 34/68 (50.00%), Postives = 43/68 (63.24%), Query Frame = 1
Query: 1201 LEVCREFQRSMCPRNELECKYAHP--PPYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLKDLL 1398
            LEVCREFQR  C R E +C++AHP   P I++ +  V  C D +K +C R K  CKY HPP HL+  L
Sbjct:  185 LEVCREFQRGSCSRGETDCRFAHPSDSPMIDSTDNTVTVCMDYVKSRCSREK--CKYFHPPAHLQARL 250          
BLAST of Muscleblind protein vs. Ensembl Cavefish
Match: MBNL1 (muscleblind-like protein 1 [Source:NCBI gene;Acc:103026224])

HSP 1 Score: 105.145 bits (261), Expect = 3.280e-24
Identity = 47/81 (58.02%), Postives = 58/81 (71.60%), Query Frame = 1
Query: 1156 MTVNNTANKDSQWLTLEVCREFQRSMCPRNELECKYAHPPPYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLKDLL 1398
            M VN T  +D++WLTLEVCREFQR  C R + ECK+AHP    + +NGRV+ C+DS+KG+C R    CKYLHPP HLK  L
Sbjct:    1 MAVNVTPIRDTKWLTLEVCREFQRGTCSRPDSECKFAHPAKSCQVENGRVIACFDSLKGRCSREN--CKYLHPPPHLKTQL 79          

HSP 2 Score: 69.707 bits (169), Expect = 2.306e-12
Identity = 41/102 (40.20%), Postives = 56/102 (54.90%), Query Frame = 1
Query: 1093 VTTLLQPNTGTTLQQNP-VPLAMTVNNTANKDSQWLTLEVCREFQRSMCPRNELECKYAHPP--PYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLK 1389
            V T + P+    +  +P VP+       A K  +   LEVCRE+QR  C R + +C++AHP     I+T +  V  C D IKG+C R K  CKY HPP HL+
Sbjct:  146 VPTEILPSAPVLVTSSPNVPVPAAAAAAAQKLMRTDRLEVCREYQRGNCTRGKNDCRFAHPADSTMIDTNDNTVTVCMDYIKGRCSREK--CKYFHPPAHLQ 245          
BLAST of Muscleblind protein vs. Ensembl Cavefish
Match: MBNL1 (muscleblind-like protein 1 [Source:NCBI gene;Acc:103026224])

HSP 1 Score: 106.686 bits (265), Expect = 3.284e-24
Identity = 47/81 (58.02%), Postives = 58/81 (71.60%), Query Frame = 1
Query: 1156 MTVNNTANKDSQWLTLEVCREFQRSMCPRNELECKYAHPPPYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLKDLL 1398
            M VN T  +D++WLTLEVCREFQR  C R + ECK+AHP    + +NGRV+ C+DS+KG+C R    CKYLHPP HLK  L
Sbjct:    1 MAVNVTPIRDTKWLTLEVCREFQRGTCSRPDSECKFAHPAKSCQVENGRVIACFDSLKGRCSREN--CKYLHPPPHLKTQL 79          

HSP 2 Score: 70.4774 bits (171), Expect = 2.254e-12
Identity = 41/102 (40.20%), Postives = 56/102 (54.90%), Query Frame = 1
Query: 1093 VTTLLQPNTGTTLQQNP-VPLAMTVNNTANKDSQWLTLEVCREFQRSMCPRNELECKYAHPP--PYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLK 1389
            V T + P+    +  +P VP+       A K  +   LEVCRE+QR  C R + +C++AHP     I+T +  V  C D IKG+C R K  CKY HPP HL+
Sbjct:  146 VPTEILPSAPVLVTSSPNVPVPAAAAAAAQKLMRTDRLEVCREYQRGNCTRGKNDCRFAHPADSTMIDTNDNTVTVCMDYIKGRCSREK--CKYFHPPAHLQ 245          
BLAST of Muscleblind protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010575.1 (pep scaffold:Pmarinus_7.0:GL479154:930238:931044:-1 gene:ENSPMAG00000009579.1 transcript:ENSPMAT00000010575.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 101.679 bits (252), Expect = 2.155e-24
Identity = 44/81 (54.32%), Postives = 58/81 (71.60%), Query Frame = 1
Query: 1150 LAMTVNNTAN-KDSQWLTLEVCREFQRSMCPRNELECKYAHPPPYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLK 1389
            LA+TV+N A  +D+ WL LEVCR+FQR  C R E EC+YAHPP ++   +GRV+ C+D +KG+C R    CKY HPP+H K
Sbjct:    1 LAVTVSNQAGSRDNNWLMLEVCRDFQRGTCSRTEDECRYAHPPKHVTAPHGRVIACFDFVKGRCTREN--CKYFHPPKHFK 79          

HSP 2 Score: 46.595 bits (109), Expect = 9.470e-6
Identity = 20/56 (35.71%), Postives = 33/56 (58.93%), Query Frame = 1
Query: 1237 PRNELECKYAHPPPY--IETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLKDLL 1398
            P  +  C+ AHPP    ++  +GRV  C D +  +C  ++P C+Y HPP HL+ ++
Sbjct:  145 PAVDTSCRLAHPPELKLMDPVDGRVTVCMDFVMARC--MRPKCRYFHPPLHLQAMV 198          
BLAST of Muscleblind protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006371.1 (pep scaffold:Pmarinus_7.0:GL477500:192013:216759:1 gene:ENSPMAG00000005739.1 transcript:ENSPMAT00000006371.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 74.7146 bits (182), Expect = 1.263e-14
Identity = 34/68 (50.00%), Postives = 43/68 (63.24%), Query Frame = 1
Query: 1201 LEVCREFQRSMCPRNELECKYAHPPP--YIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLKDLL 1398
            LEVCREFQR  C R E EC++AHP     +++ +  V  C D +KG+C R K  CKY HPP HL+  L
Sbjct:  139 LEVCREFQRGNCSRGESECRFAHPAESTAVDSADNTVTVCMDHVKGRCSRDK--CKYFHPPLHLQAKL 204          
BLAST of Muscleblind protein vs. Ensembl Nematostella
Match: EDO38367 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SD65])

HSP 1 Score: 102.834 bits (255), Expect = 4.529e-24
Identity = 43/74 (58.11%), Postives = 54/74 (72.97%), Query Frame = 1
Query: 1177 NKDSQWLTLEVCREFQRSMCPRNELECKYAHPPPYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLKDLL 1398
             KD +WL +EVCREFQR  C R E +C++AHPP ++   NGRV  C+DS+KG+C R K  CKYLHPP+HLK  L
Sbjct:    2 GKDPRWLQVEVCREFQRGKCSRTEDDCRFAHPPAHVAIHNGRVTACFDSLKGRCQREK--CKYLHPPKHLKTQL 73          

HSP 2 Score: 86.6557 bits (213), Expect = 1.479e-18
Identity = 52/116 (44.83%), Postives = 63/116 (54.31%), Query Frame = 1
Query: 1057 SNQMLLGMNSNPVTTLLQPNTGTTLQQNPV---PLAMTVNNTANKDSQWLTLEVCREFQRSMCPRNELECKYAHPPPY--IETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLK 1389
            SN  LL     P   L  P +  TL Q PV   P   ++  T  +  +   LEVCRE+QR  C R E EC+YAHPP +  I+T +G V  C D IKGKC R    CKY HPP HL+
Sbjct:  104 SNSTLL-----PTWPLAVPTSNGTLLQQPVAFLPDPSSLGGTPRRLDKSDKLEVCREYQRGACTREESECRYAHPPRHTSIDTSDGMVTVCMDFIKGKCQR--ETCKYFHPPTHLQ 212          
BLAST of Muscleblind protein vs. Ensembl Medaka
Match: MBNL1 (muscleblind like splicing regulator 1 [Source:NCBI gene;Acc:101171850])

HSP 1 Score: 107.457 bits (267), Expect = 6.650e-26
Identity = 47/81 (58.02%), Postives = 58/81 (71.60%), Query Frame = 1
Query: 1156 MTVNNTANKDSQWLTLEVCREFQRSMCPRNELECKYAHPPPYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLKDLL 1398
            M VN T  +D++WLTLEVCREFQR  C R + ECK+AHP    + +NGRV+ C+DS+KG+C R    CKYLHPP HLK  L
Sbjct:    1 MAVNVTPIRDTKWLTLEVCREFQRGTCSRPDNECKFAHPAKSCQVENGRVIACFDSLKGRCSREN--CKYLHPPPHLKTQL 79          
BLAST of Muscleblind protein vs. Ensembl Medaka
Match: MBNL1 (muscleblind like splicing regulator 1 [Source:NCBI gene;Acc:101171850])

HSP 1 Score: 107.457 bits (267), Expect = 3.301e-25
Identity = 47/81 (58.02%), Postives = 58/81 (71.60%), Query Frame = 1
Query: 1156 MTVNNTANKDSQWLTLEVCREFQRSMCPRNELECKYAHPPPYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLKDLL 1398
            M VN T  +D++WLTLEVCREFQR  C R + ECK+AHP    + +NGRV+ C+DS+KG+C R    CKYLHPP HLK  L
Sbjct:    1 MAVNVTPIRDTKWLTLEVCREFQRGTCSRPDNECKFAHPAKSCQVENGRVIACFDSLKGRCSREN--CKYLHPPPHLKTQL 79          
BLAST of Muscleblind protein vs. Ensembl Medaka
Match: MBNL2 (muscleblind-like protein 2a [Source:NCBI gene;Acc:105356830])

HSP 1 Score: 108.997 bits (271), Expect = 5.565e-25
Identity = 46/81 (56.79%), Postives = 61/81 (75.31%), Query Frame = 1
Query: 1156 MTVNNTANKDSQWLTLEVCREFQRSMCPRNELECKYAHPPPYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLKDLL 1398
            M +N +A +D++WLTLEVCR+FQR  C R++ ECK+AHPP   + +NGRV+ C+DS+KG+C R    CKYLHPP HLK  L
Sbjct:    1 MALNMSAVRDTKWLTLEVCRQFQRGNCSRSDEECKFAHPPKSCQIENGRVIACFDSLKGRCSREN--CKYLHPPSHLKTQL 79          

HSP 2 Score: 74.3294 bits (181), Expect = 1.271e-13
Identity = 42/106 (39.62%), Postives = 61/106 (57.55%), Query Frame = 1
Query: 1078 MNSNPVTTLLQPNTGTTLQQNPVPLAMTVNNTANKDSQWLTLEVCREFQRSMCPRNELECKYAHP--PPYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLK 1389
            ++SNPV  L+  + G  +Q +    + + ++ + K  +   LEVCREFQR  C R E +C++AHP   P I+  +  V  C D IK +C R K  CKY HPP HL+
Sbjct:  149 LSSNPV--LVSGSQGVPVQCSSSSSSSSTSSPSQKLQRTDKLEVCREFQRGNCARGETDCRFAHPSDSPMIDATDNTVTVCMDYIKSRCSREK--CKYFHPPAHLQ 250          
BLAST of Muscleblind protein vs. Ensembl Medaka
Match: MBNL2 (muscleblind-like protein 2a [Source:NCBI gene;Acc:105356830])

HSP 1 Score: 108.612 bits (270), Expect = 5.747e-25
Identity = 46/81 (56.79%), Postives = 61/81 (75.31%), Query Frame = 1
Query: 1156 MTVNNTANKDSQWLTLEVCREFQRSMCPRNELECKYAHPPPYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLKDLL 1398
            M +N +A +D++WLTLEVCR+FQR  C R++ ECK+AHPP   + +NGRV+ C+DS+KG+C R    CKYLHPP HLK  L
Sbjct:    1 MALNMSAVRDTKWLTLEVCRQFQRGNCSRSDEECKFAHPPKSCQIENGRVIACFDSLKGRCSREN--CKYLHPPSHLKTQL 79          

HSP 2 Score: 74.3294 bits (181), Expect = 1.169e-13
Identity = 42/106 (39.62%), Postives = 61/106 (57.55%), Query Frame = 1
Query: 1078 MNSNPVTTLLQPNTGTTLQQNPVPLAMTVNNTANKDSQWLTLEVCREFQRSMCPRNELECKYAHP--PPYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLK 1389
            ++SNPV  L+  + G  +Q +    + + ++ + K  +   LEVCREFQR  C R E +C++AHP   P I+  +  V  C D IK +C R K  CKY HPP HL+
Sbjct:  149 LSSNPV--LVSGSQGVPVQCSSSSSSSSTSSPSQKLQRTDKLEVCREFQRGNCARGETDCRFAHPSDSPMIDATDNTVTVCMDYIKSRCSREK--CKYFHPPAHLQ 250          
BLAST of Muscleblind protein vs. Ensembl Medaka
Match: MBNL2 (muscleblind-like protein 2a [Source:NCBI gene;Acc:105356830])

HSP 1 Score: 108.227 bits (269), Expect = 6.110e-25
Identity = 46/81 (56.79%), Postives = 61/81 (75.31%), Query Frame = 1
Query: 1156 MTVNNTANKDSQWLTLEVCREFQRSMCPRNELECKYAHPPPYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLKDLL 1398
            M +N +A +D++WLTLEVCR+FQR  C R++ ECK+AHPP   + +NGRV+ C+DS+KG+C R    CKYLHPP HLK  L
Sbjct:    1 MALNMSAVRDTKWLTLEVCRQFQRGNCSRSDEECKFAHPPKSCQIENGRVIACFDSLKGRCSREN--CKYLHPPSHLKTQL 79          

HSP 2 Score: 73.9442 bits (180), Expect = 1.302e-13
Identity = 42/106 (39.62%), Postives = 61/106 (57.55%), Query Frame = 1
Query: 1078 MNSNPVTTLLQPNTGTTLQQNPVPLAMTVNNTANKDSQWLTLEVCREFQRSMCPRNELECKYAHP--PPYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLK 1389
            ++SNPV  L+  + G  +Q +    + + ++ + K  +   LEVCREFQR  C R E +C++AHP   P I+  +  V  C D IK +C R K  CKY HPP HL+
Sbjct:  149 LSSNPV--LVSGSQGVPVQCSSSSSSSSTSSPSQKLQRTDKLEVCREFQRGNCARGETDCRFAHPSDSPMIDATDNTVTVCMDYIKSRCSREK--CKYFHPPAHLQ 250          
BLAST of Muscleblind protein vs. Planmine SMEST
Match: SMESG000073369.1 (SMESG000073369.1)

HSP 1 Score: 681.019 bits (1756), Expect = 0.000e+0
Identity = 439/441 (99.55%), Postives = 440/441 (99.77%), Query Frame = 1
Query:  976 MLPFTSTLPCXXXXXXXXXXXXXXXXRSNQMLLGMNSNPVTTLLQPNTGTTLQQNPVPLAMTVNNTANKDSQWLTLEVCREFQRSMCPRNELECKYAHPPPYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLKDLLIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMNNSNSKILYSPQLHSPSTVPLIAQKSGNDNHKFPTIVEQTDSTASNDQKILNKSINDNYCLSSDVVQAQMNSNHFSNFYDCQMTQCLPKNNSSGAPLSISTTTSNDVNSVDLKASRKRPLQTNNSTSNKTEQSSEKHVPIKKLNLLDPQFSVINREHQSNQMGFMINNPLMNYQNQLASLLSMSXXXXXXXXXXXXXXXXXXXXGSLLSMGPSMVCPNTLINVNGIPMISXXXXXXXXXXXXXXXXXXXXYNRSLTDFSGFQ 2298
            MLPFTSTLPCNGLNLRNNFNGLLGDLRSNQMLLGMNSNP+TTLLQPNTGTTLQQNPV LAMTVNNTANKDSQWLTLEVCREFQRSMCPRNELECKYAHPPPYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLKDLLIQNGKNNLLMKNLQMNILQQQLSSLSGNSQSRLGLLSMNNSNSKILYSPQLHSPSTVPLIAQKSGNDNHKFPTIVEQTDSTASNDQKILNKSINDNYCLSSDVVQAQMNSNHFSNFYDCQMTQCLPKNNSSGAPLSISTTTSNDVNSVDLKASRKRPLQTNNSTSNKTEQSSEKHVPIKKLNLLDPQFSVINREHQSNQMGFMINNPLMNYQNQLASLLSMSNQTGLQSNTLNLQTLLASNNGSLLSMGPSMVCPNTLINVNGIPMISTLSTQQQLATTLLQAANALQYNRSLTDFSGFQ
Sbjct:    1 MLPFTSTLPCNGLNLRNNFNGLLGDLRSNQMLLGMNSNPLTTLLQPNTGTTLQQNPVQLAMTVNNTANKDSQWLTLEVCREFQRSMCPRNELECKYAHPPPYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLKDLLIQNGKNNLLMKNLQMNILQQQLSSLSGNSQSRLGLLSMNNSNSKILYSPQLHSPSTVPLIAQKSGNDNHKFPTIVEQTDSTASNDQKILNKSINDNYCLSSDVVQAQMNSNHFSNFYDCQMTQCLPKNNSSGAPLSISTTTSNDVNSVDLKASRKRPLQTNNSTSNKTEQSSEKHVPIKKLNLLDPQFSVINREHQSNQMGFMINNPLMNYQNQLASLLSMSNQTGLQSNTLNLQTLLASNNGSLLSMGPSMVCPNTLINVNGIPMISTLSTQQQLATTLLQAANALQYNRSLTDFSGFQ 441          
BLAST of Muscleblind protein vs. Planmine SMEST
Match: SMESG000073369.1 (SMESG000073369.1)

HSP 1 Score: 669.078 bits (1725), Expect = 0.000e+0
Identity = 439/463 (94.82%), Postives = 440/463 (95.03%), Query Frame = 1
Query:  976 MLPFTSTLPCXXXXXXXXXXXXXXXXRSNQMLLGMNSNPVTTLLQPNTGTTLQQNPVPLAMTVNNTANKDSQWLTLEVCREFQRSMCPRNELECKYAHPPPYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLKDLLIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMNNSNSKILYSPQLHSPSTVPLIAQKSGNDNHKFPTIVEQTDSTASNDQKILNKSINDNYCLSSDVVQAQMNSNHFSNFYDCQMTQCLPKNNSSGAPLSISTTTSNDVNSVDLKASRKRPLQTNNSTSNKTE----------------------QSSEKHVPIKKLNLLDPQFSVINREHQSNQMGFMINNPLMNYQNQLASLLSMSXXXXXXXXXXXXXXXXXXXXGSLLSMGPSMVCPNTLINVNGIPMISXXXXXXXXXXXXXXXXXXXXYNRSLTDFSGFQ 2298
            MLPFTSTLPCNGLNLRNNFNGLLGDLRSNQMLLGMNSNP+TTLLQPNTGTTLQQNPV LAMTVNNTANKDSQWLTLEVCREFQRSMCPRNELECKYAHPPPYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLKDLLIQNGKNNLLMKNLQMNILQQQLSSLSGNSQSRLGLLSMNNSNSKILYSPQLHSPSTVPLIAQKSGNDNHKFPTIVEQTDSTASNDQKILNKSINDNYCLSSDVVQAQMNSNHFSNFYDCQMTQCLPKNNSSGAPLSISTTTSNDVNSVDLKASRKRPLQTNNSTSNKTE                      QSSEKHVPIKKLNLLDPQFSVINREHQSNQMGFMINNPLMNYQNQLASLLSMSNQTGLQSNTLNLQTLLASNNGSLLSMGPSMVCPNTLINVNGIPMISTLSTQQQLATTLLQAANALQYNRSLTDFSGFQ
Sbjct:    1 MLPFTSTLPCNGLNLRNNFNGLLGDLRSNQMLLGMNSNPLTTLLQPNTGTTLQQNPVQLAMTVNNTANKDSQWLTLEVCREFQRSMCPRNELECKYAHPPPYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLKDLLIQNGKNNLLMKNLQMNILQQQLSSLSGNSQSRLGLLSMNNSNSKILYSPQLHSPSTVPLIAQKSGNDNHKFPTIVEQTDSTASNDQKILNKSINDNYCLSSDVVQAQMNSNHFSNFYDCQMTQCLPKNNSSGAPLSISTTTSNDVNSVDLKASRKRPLQTNNSTSNKTESINYSVYGVGQIINDKTNEKQSQSSEKHVPIKKLNLLDPQFSVINREHQSNQMGFMINNPLMNYQNQLASLLSMSNQTGLQSNTLNLQTLLASNNGSLLSMGPSMVCPNTLINVNGIPMISTLSTQQQLATTLLQAANALQYNRSLTDFSGFQ 463          
BLAST of Muscleblind protein vs. Planmine SMEST
Match: SMESG000073369.1 (SMESG000073369.1)

HSP 1 Score: 660.603 bits (1703), Expect = 0.000e+0
Identity = 409/411 (99.51%), Postives = 410/411 (99.76%), Query Frame = 1
Query: 1066 MLLGMNSNPVTTLLQPNTGTTLQQNPVPLAMTVNNTANKDSQWLTLEVCREFQRSMCPRNELECKYAHPPPYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLKDLLIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMNNSNSKILYSPQLHSPSTVPLIAQKSGNDNHKFPTIVEQTDSTASNDQKILNKSINDNYCLSSDVVQAQMNSNHFSNFYDCQMTQCLPKNNSSGAPLSISTTTSNDVNSVDLKASRKRPLQTNNSTSNKTEQSSEKHVPIKKLNLLDPQFSVINREHQSNQMGFMINNPLMNYQNQLASLLSMSXXXXXXXXXXXXXXXXXXXXGSLLSMGPSMVCPNTLINVNGIPMISXXXXXXXXXXXXXXXXXXXXYNRSLTDFSGFQ 2298
            MLLGMNSNP+TTLLQPNTGTTLQQNPV LAMTVNNTANKDSQWLTLEVCREFQRSMCPRNELECKYAHPPPYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLKDLLIQNGKNNLLMKNLQMNILQQQLSSLSGNSQSRLGLLSMNNSNSKILYSPQLHSPSTVPLIAQKSGNDNHKFPTIVEQTDSTASNDQKILNKSINDNYCLSSDVVQAQMNSNHFSNFYDCQMTQCLPKNNSSGAPLSISTTTSNDVNSVDLKASRKRPLQTNNSTSNKTEQSSEKHVPIKKLNLLDPQFSVINREHQSNQMGFMINNPLMNYQNQLASLLSMSNQTGLQSNTLNLQTLLASNNGSLLSMGPSMVCPNTLINVNGIPMISTLSTQQQLATTLLQAANALQYNRSLTDFSGFQ
Sbjct:    1 MLLGMNSNPLTTLLQPNTGTTLQQNPVQLAMTVNNTANKDSQWLTLEVCREFQRSMCPRNELECKYAHPPPYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLKDLLIQNGKNNLLMKNLQMNILQQQLSSLSGNSQSRLGLLSMNNSNSKILYSPQLHSPSTVPLIAQKSGNDNHKFPTIVEQTDSTASNDQKILNKSINDNYCLSSDVVQAQMNSNHFSNFYDCQMTQCLPKNNSSGAPLSISTTTSNDVNSVDLKASRKRPLQTNNSTSNKTEQSSEKHVPIKKLNLLDPQFSVINREHQSNQMGFMINNPLMNYQNQLASLLSMSNQTGLQSNTLNLQTLLASNNGSLLSMGPSMVCPNTLINVNGIPMISTLSTQQQLATTLLQAANALQYNRSLTDFSGFQ 411          
BLAST of Muscleblind protein vs. Planmine SMEST
Match: SMESG000073369.1 (SMESG000073369.1)

HSP 1 Score: 652.129 bits (1681), Expect = 0.000e+0
Identity = 405/407 (99.51%), Postives = 406/407 (99.75%), Query Frame = 1
Query: 1078 MNSNPVTTLLQPNTGTTLQQNPVPLAMTVNNTANKDSQWLTLEVCREFQRSMCPRNELECKYAHPPPYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLKDLLIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMNNSNSKILYSPQLHSPSTVPLIAQKSGNDNHKFPTIVEQTDSTASNDQKILNKSINDNYCLSSDVVQAQMNSNHFSNFYDCQMTQCLPKNNSSGAPLSISTTTSNDVNSVDLKASRKRPLQTNNSTSNKTEQSSEKHVPIKKLNLLDPQFSVINREHQSNQMGFMINNPLMNYQNQLASLLSMSXXXXXXXXXXXXXXXXXXXXGSLLSMGPSMVCPNTLINVNGIPMISXXXXXXXXXXXXXXXXXXXXYNRSLTDFSGFQ 2298
            MNSNP+TTLLQPNTGTTLQQNPV LAMTVNNTANKDSQWLTLEVCREFQRSMCPRNELECKYAHPPPYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLKDLLIQNGKNNLLMKNLQMNILQQQLSSLSGNSQSRLGLLSMNNSNSKILYSPQLHSPSTVPLIAQKSGNDNHKFPTIVEQTDSTASNDQKILNKSINDNYCLSSDVVQAQMNSNHFSNFYDCQMTQCLPKNNSSGAPLSISTTTSNDVNSVDLKASRKRPLQTNNSTSNKTEQSSEKHVPIKKLNLLDPQFSVINREHQSNQMGFMINNPLMNYQNQLASLLSMSNQTGLQSNTLNLQTLLASNNGSLLSMGPSMVCPNTLINVNGIPMISTLSTQQQLATTLLQAANALQYNRSLTDFSGFQ
Sbjct:    1 MNSNPLTTLLQPNTGTTLQQNPVQLAMTVNNTANKDSQWLTLEVCREFQRSMCPRNELECKYAHPPPYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLKDLLIQNGKNNLLMKNLQMNILQQQLSSLSGNSQSRLGLLSMNNSNSKILYSPQLHSPSTVPLIAQKSGNDNHKFPTIVEQTDSTASNDQKILNKSINDNYCLSSDVVQAQMNSNHFSNFYDCQMTQCLPKNNSSGAPLSISTTTSNDVNSVDLKASRKRPLQTNNSTSNKTEQSSEKHVPIKKLNLLDPQFSVINREHQSNQMGFMINNPLMNYQNQLASLLSMSNQTGLQSNTLNLQTLLASNNGSLLSMGPSMVCPNTLINVNGIPMISTLSTQQQLATTLLQAANALQYNRSLTDFSGFQ 407          
BLAST of Muscleblind protein vs. Planmine SMEST
Match: SMESG000073369.1 (SMESG000073369.1)

HSP 1 Score: 649.047 bits (1673), Expect = 0.000e+0
Identity = 409/433 (94.46%), Postives = 410/433 (94.69%), Query Frame = 1
Query: 1066 MLLGMNSNPVTTLLQPNTGTTLQQNPVPLAMTVNNTANKDSQWLTLEVCREFQRSMCPRNELECKYAHPPPYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLKDLLIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMNNSNSKILYSPQLHSPSTVPLIAQKSGNDNHKFPTIVEQTDSTASNDQKILNKSINDNYCLSSDVVQAQMNSNHFSNFYDCQMTQCLPKNNSSGAPLSISTTTSNDVNSVDLKASRKRPLQTNNSTSNKTE----------------------QSSEKHVPIKKLNLLDPQFSVINREHQSNQMGFMINNPLMNYQNQLASLLSMSXXXXXXXXXXXXXXXXXXXXGSLLSMGPSMVCPNTLINVNGIPMISXXXXXXXXXXXXXXXXXXXXYNRSLTDFSGFQ 2298
            MLLGMNSNP+TTLLQPNTGTTLQQNPV LAMTVNNTANKDSQWLTLEVCREFQRSMCPRNELECKYAHPPPYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLKDLLIQNGKNNLLMKNLQMNILQQQLSSLSGNSQSRLGLLSMNNSNSKILYSPQLHSPSTVPLIAQKSGNDNHKFPTIVEQTDSTASNDQKILNKSINDNYCLSSDVVQAQMNSNHFSNFYDCQMTQCLPKNNSSGAPLSISTTTSNDVNSVDLKASRKRPLQTNNSTSNKTE                      QSSEKHVPIKKLNLLDPQFSVINREHQSNQMGFMINNPLMNYQNQLASLLSMSNQTGLQSNTLNLQTLLASNNGSLLSMGPSMVCPNTLINVNGIPMISTLSTQQQLATTLLQAANALQYNRSLTDFSGFQ
Sbjct:    1 MLLGMNSNPLTTLLQPNTGTTLQQNPVQLAMTVNNTANKDSQWLTLEVCREFQRSMCPRNELECKYAHPPPYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLKDLLIQNGKNNLLMKNLQMNILQQQLSSLSGNSQSRLGLLSMNNSNSKILYSPQLHSPSTVPLIAQKSGNDNHKFPTIVEQTDSTASNDQKILNKSINDNYCLSSDVVQAQMNSNHFSNFYDCQMTQCLPKNNSSGAPLSISTTTSNDVNSVDLKASRKRPLQTNNSTSNKTESINYSVYGVGQIINDKTNEKQSQSSEKHVPIKKLNLLDPQFSVINREHQSNQMGFMINNPLMNYQNQLASLLSMSNQTGLQSNTLNLQTLLASNNGSLLSMGPSMVCPNTLINVNGIPMISTLSTQQQLATTLLQAANALQYNRSLTDFSGFQ 433          
The following BLAST results are available for this feature:
BLAST of Muscleblind protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MBNL21.411e-2455.56muscleblind like splicing regulator 2 [Source:HGNC... [more]
MBNL22.419e-2455.56muscleblind like splicing regulator 2 [Source:HGNC... [more]
MBNL28.265e-2455.56muscleblind like splicing regulator 2 [Source:HGNC... [more]
MBNL28.265e-2455.56muscleblind like splicing regulator 2 [Source:HGNC... [more]
MBNL18.612e-2456.79muscleblind like splicing regulator 1 [Source:HGNC... [more]
back to top
BLAST of Muscleblind protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mbl-17.960e-3064.86Muscleblind-like protein [Source:UniProtKB/Swiss-... [more]
mbl-17.960e-3064.86Muscleblind-like protein [Source:UniProtKB/Swiss-... [more]
mbl-17.960e-3064.86Muscleblind-like protein [Source:UniProtKB/Swiss-... [more]
mbl-19.895e-3064.86Muscleblind-like protein [Source:UniProtKB/Swiss-... [more]
mbl-19.895e-3064.86Muscleblind-like protein [Source:UniProtKB/Swiss-... [more]
back to top
BLAST of Muscleblind protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mbl1.390e-3269.33gene:FBgn0265487 transcript:FBtr0086991[more]
mbl2.925e-3269.33gene:FBgn0265487 transcript:FBtr0086994[more]
mbl2.389e-3169.33gene:FBgn0265487 transcript:FBtr0086992[more]
mbl8.249e-3169.33gene:FBgn0265487 transcript:FBtr0306603[more]
mbl8.650e-3169.33gene:FBgn0265487 transcript:FBtr0306604[more]
back to top
BLAST of Muscleblind protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mbnl38.070e-2558.02muscleblind-like splicing regulator 3 [Source:ZFIN... [more]
mbnl31.285e-2458.02muscleblind-like splicing regulator 3 [Source:ZFIN... [more]
mbnl21.572e-2455.56muscleblind-like splicing regulator 2 [Source:ZFIN... [more]
mbnl21.572e-2455.56muscleblind-like splicing regulator 2 [Source:ZFIN... [more]
mbnl21.651e-2455.56muscleblind-like splicing regulator 2 [Source:ZFIN... [more]
back to top
BLAST of Muscleblind protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mbnl22.152e-2455.56muscleblind-like splicing regulator 2 [Source:NCBI... [more]
mbnl22.252e-2455.56muscleblind-like splicing regulator 2 [Source:NCBI... [more]
MBNL34.517e-2456.79muscleblind-like splicing regulator 3 [Source:NCBI... [more]
MBNL36.549e-2456.79muscleblind-like splicing regulator 3 [Source:NCBI... [more]
mbnl26.604e-2455.56muscleblind-like splicing regulator 2 [Source:NCBI... [more]
back to top
BLAST of Muscleblind protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mbnl12.255e-2556.79muscleblind like splicing factor 1 [Source:MGI Sym... [more]
Mbnl25.361e-2454.32muscleblind like splicing factor 2 [Source:MGI Sym... [more]
Mbnl25.361e-2454.32muscleblind like splicing factor 2 [Source:MGI Sym... [more]
Mbnl25.393e-2454.32muscleblind like splicing factor 2 [Source:MGI Sym... [more]
Mbnl25.393e-2454.32muscleblind like splicing factor 2 [Source:MGI Sym... [more]
back to top
BLAST of Muscleblind protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O16011|MBL_DROME2.395e-3069.33Protein muscleblind OS=Drosophila melanogaster OX=... [more]
sp|Q94250|MBL_CAEEL1.748e-2864.86Muscleblind-like protein OS=Caenorhabditis elegans... [more]
sp|A8XND8|MBL_CAEBR2.084e-2864.86Muscleblind-like protein OS=Caenorhabditis briggsa... [more]
sp|Q56V19|MBNL3_TAKRU5.755e-2458.02Muscleblind-like protein 3 OS=Takifugu rubripes OX... [more]
sp|Q6Q2B2|MBN2A_TAKRU8.434e-2455.56Muscleblind-like protein 2a OS=Takifugu rubripes O... [more]
back to top
BLAST of Muscleblind protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3J9K44.218e-3365.91muscleblind-like protein isoform X8 OS=Lingula ung... [more]
A0A1S3J9A95.128e-3365.91muscleblind-like protein isoform X5 OS=Lingula ung... [more]
A0A1S3JAI97.099e-3365.91muscleblind-like protein isoform X6 OS=Lingula ung... [more]
A0A1S3J9K19.400e-3365.91muscleblind-like protein isoform X3 OS=Lingula ung... [more]
A0A2P2I1561.344e-3257.02Protein muscleblind-like (Fragment) OS=Hirondellea... [more]
back to top
BLAST of Muscleblind protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MBNL12.794e-2458.02muscleblind-like protein 1 [Source:NCBI gene;Acc:1... [more]
MBNL22.812e-2456.79muscleblind-like protein 2a [Source:NCBI gene;Acc:... [more]
MBNL22.941e-2456.79muscleblind-like protein 2a [Source:NCBI gene;Acc:... [more]
MBNL13.280e-2458.02muscleblind-like protein 1 [Source:NCBI gene;Acc:1... [more]
MBNL13.284e-2458.02muscleblind-like protein 1 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Muscleblind protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000010575.12.155e-2454.32pep scaffold:Pmarinus_7.0:GL479154:930238:931044:-... [more]
ENSPMAT00000006371.11.263e-1450.00pep scaffold:Pmarinus_7.0:GL477500:192013:216759:1... [more]
back to top
BLAST of Muscleblind protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Muscleblind protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO383674.529e-2458.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Muscleblind protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MBNL16.650e-2658.02muscleblind like splicing regulator 1 [Source:NCBI... [more]
MBNL13.301e-2558.02muscleblind like splicing regulator 1 [Source:NCBI... [more]
MBNL25.565e-2556.79muscleblind-like protein 2a [Source:NCBI gene;Acc:... [more]
MBNL25.747e-2556.79muscleblind-like protein 2a [Source:NCBI gene;Acc:... [more]
MBNL26.110e-2556.79muscleblind-like protein 2a [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Muscleblind protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000073369.10.000e+099.55SMESG000073369.1[more]
SMESG000073369.10.000e+094.82SMESG000073369.1[more]
SMESG000073369.10.000e+099.51SMESG000073369.1[more]
SMESG000073369.10.000e+099.51SMESG000073369.1[more]
SMESG000073369.10.000e+094.46SMESG000073369.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024408 ID=SMED30024408|Name=Muscleblind protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2629bp
ACATTATCTTGTGTTGATAAGAACATATTTAGAAGTGAGCTTTATTTGAA
CGTTCATCAGTTATTTTGTTGGAATTTTCGTTCGTTTTTATTATCGACAA
AATTCTAAACTTCAGTTGGTTTCTAATGACCAAAAATTCTCATCTATTCA
ATAGATTCTATTGACTCATTGGGACTTTGTTGTTTAAACTGCCGTTCTGA
TTAATTCGGAATAAGGTTTTATATTTTGTCATATCTAAAGCAATATCAGA
TGAGTTTATGAGACCCCCAATGCCTATTTCATATTAATTAATCAATTATT
TTAGTTTAGTTTAATTAACTTTGATTCATGCAATGTCCAAGCAGTTTGGC
TGGAATAAGTTGTATGTGTCTTTGTGGTTTTCAAATGTATTAAATTAACA
GGTTAGATAACTTATTTTCTATTTATAGTTTTTTTAAATTTAGATTACCT
CAGGTAATACTATAATTTACTTGTTAAAAATATAAAATCTCCATAAACAA
TATCAATTCAAACCCATCATACAATAAAAAATATTGTATGAATTTAAGGA
TTAATTTAAATATTTTATTAATTAAATTCGAAATCATGGTATCAAGAACC
ATAAACTGATTACATTTTTAAATGAATTTGATTGGTCATGATTTATCCAA
TGAGAAAATAAATTGAAACAAAAGCATAAGGTCTCAAATTTCAATATTTT
CAATCGAAAATTTCAAAGTAACACACTAATTACACGTGTATTAACCTGTA
GACAGAGCAGCACATATTGATAAATTAAAGTATTTTGTGCAATTAAAGTT
AATGTTTGATTTATTGATTGAAAATAACAGCTTGAATCAATACTGTAATT
TACGATCATTAATTTTAAAATCTAGCTAAAATTTTCGGATTGTATACTCC
ATTAAACGTGAGTAATTTATTGATTATTTTTTTATAATTATGATACTAAA
TAGACTTATTTCAACAAATATTTTTATGTTGCCTTTTACATCTACACTGC
CTTGTAATGGCCTCAATCTAAGGAATAATTTTAATGGATTGTTAGGCGAT
TTAAGATCCAATCAAATGTTATTAGGAATGAATTCAAATCCGGTTACAAC
ACTACTTCAGCCAAACACAGGCACAACACTCCAACAAAATCCAGTTCCAT
TAGCAATGACTGTAAATAACACCGCAAACAAAGATTCTCAATGGCTGACT
TTAGAGGTTTGCAGAGAGTTCCAAAGAAGCATGTGTCCACGCAATGAACT
TGAATGCAAATATGCTCACCCTCCTCCATATATTGAAACTCAAAACGGTC
GTGTTATGTGCTGCTATGATTCCATTAAGGGAAAATGTCACCGAATCAAA
CCTCCGTGTAAATATTTACATCCTCCACAACATTTGAAAGATCTTCTAAT
CCAGAATGGAAAAAACAATTTGTTAATGAAAAATCTACAAATGAATATTT
TGCAACAACAACTATCTAGTTTATCTGGGAATTCTCAATCAAGGTTGGGA
TTATTATCAATGAATAATTCCAATAGTAAAATACTTTACTCTCCTCAACT
GCATTCCCCTTCAACCGTTCCTTTGATAGCTCAAAAATCTGGCAACGATA
ACCATAAATTTCCAACAATTGTTGAACAAACTGATTCCACAGCTTCTAAC
GATCAAAAAATTCTCAATAAGTCAATTAATGATAATTACTGTCTGTCAAG
TGATGTTGTCCAGGCGCAAATGAATTCCAACCACTTTTCGAATTTTTATG
ACTGTCAAATGACTCAATGTCTGCCCAAAAATAACTCATCTGGAGCACCT
CTTTCAATATCAACAACGACATCAAACGATGTTAATTCTGTTGATTTAAA
GGCATCAAGGAAGAGACCATTGCAAACAAACAATTCAACTTCGAATAAAA
CTGAACAATCATCAGAGAAACATGTTCCGATCAAAAAGCTAAATTTATTA
GATCCGCAATTCTCAGTAATAAATAGGGAACATCAAAGCAATCAAATGGG
ATTCATGATCAACAATCCTTTAATGAATTATCAAAATCAGTTGGCATCAT
TACTATCAATGAGCAACCAAACTGGACTGCAGTCAAACACTTTGAATTTA
CAAACGTTGTTGGCTTCGAATAATGGAAGCCTCTTGTCTATGGGACCAAG
CATGGTTTGCCCAAATACTCTCATAAACGTCAACGGAATCCCAATGATTT
CAACTCTGTCAACTCAGCAACAACTAGCTACAACATTATTACAAGCGGCA
AATGCCCTCCAATATAATAGAAGTCTTACGGATTTCAGTGGCTTCCAATA
GTAAATAAGAACCTGAATTATTTTAATAAACCAAAGAGTGGACTTTAATA
ATTATATCAAAATTTAAAGTTTCTTTCATACTTCTATTTATCAGTAGATA
GTATTTTCTATATTTTATGAATGTTATTTATAATTTTCTTTTGTGCAATT
TGCAAACAAAAACTGTGACAATTTTAAGTGCCATTATTGATAAAAGTGAA
AATGTGTCAGTAATTCGTTAATAGAACTTAATATATATTCTTACCCTTCT
TGAAGTGCCTTGTGTTTGATATTCGTTTATAAAGCGATATGATTTCGTTT
TTGGTTAAATAATAAATCGTTTTCTTTTG
back to top

protein sequence of SMED30024408-orf-1

>SMED30024408-orf-1 ID=SMED30024408-orf-1|Name=SMED30024408-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=454bp
MILNRLISTNIFMLPFTSTLPCNGLNLRNNFNGLLGDLRSNQMLLGMNSN
PVTTLLQPNTGTTLQQNPVPLAMTVNNTANKDSQWLTLEVCREFQRSMCP
RNELECKYAHPPPYIETQNGRVMCCYDSIKGKCHRIKPPCKYLHPPQHLK
DLLIQNGKNNLLMKNLQMNILQQQLSSLSGNSQSRLGLLSMNNSNSKILY
SPQLHSPSTVPLIAQKSGNDNHKFPTIVEQTDSTASNDQKILNKSINDNY
CLSSDVVQAQMNSNHFSNFYDCQMTQCLPKNNSSGAPLSISTTTSNDVNS
VDLKASRKRPLQTNNSTSNKTEQSSEKHVPIKKLNLLDPQFSVINREHQS
NQMGFMINNPLMNYQNQLASLLSMSNQTGLQSNTLNLQTLLASNNGSLLS
MGPSMVCPNTLINVNGIPMISTLSTQQQLATTLLQAANALQYNRSLTDFS
GFQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR001000GH10
IPR000571Znf_CCCH
Vocabulary: biological process
TermDefinition
GO:0005975carbohydrate metabolic process
Vocabulary: molecular function
TermDefinition
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0046872metal ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000571Zinc finger, CCCH-typeSMARTSM00356c3hfinal6coord: 86..112
e-value: 7.6E-4
score: 28.8
coord: 119..146
e-value: 92.0
score: 0.6
IPR000571Zinc finger, CCCH-typePROSITEPS50103ZF_C3H1coord: 118..147
score: 8.559
IPR000571Zinc finger, CCCH-typePROSITEPS50103ZF_C3H1coord: 85..113
score: 12.352
NoneNo IPR availableGENE3DG3DSA:1.10.150.840coord: 80..164
e-value: 2.0E-31
score: 109.6
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 299..324
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 299..328
NoneNo IPR availablePANTHERPTHR12675:SF5PROTEIN MUSCLEBLINDcoord: 59..272
NoneNo IPR availablePANTHERPTHR12675MUSCLEBLIND-LIKE PROTEINcoord: 59..272