slc38a-6

Overview
Nameslc38a-6 (AKN21665.1)
Smed IDSMED30024398
Length (bp)1579
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc38a-6 (SMED30024398) t-SNE clustered cells

Violin plots show distribution of expression levels for slc38a-6 (SMED30024398) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024398

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30024398SMESG000016671.1 dd_Smed_v4_23596_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30024398SMESG000016671.1 dd_Smed_v6_23596_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc38a-6 vs. Ensembl Human
Match: SLC38A9 (solute carrier family 38 member 9 [Source:HGNC Symbol;Acc:HGNC:26907])

HSP 1 Score: 200.675 bits (509), Expect = 2.084e-57
Identity = 148/378 (39.15%), Postives = 218/378 (57.67%), Query Frame = 1
Query:  142 KRGSLVTIFSIYNTMMGATIISMPWXXXXXXXXXXXXXXXXXXXXTLYTAILVLKSTNYIIRTRHCILEFSDACGFYLGRIGEISAIISSIFVLMSSLIVYYVLLCNFLFLTVLYVFNYIIDSPNYAFPEND--FPTNTTNPQCFNWLNNSLTSYYVVSKDPLSHLNNVERYQISGNSSVVLLKALWSENLTVPFWVLIIIFPLISIKSATFVSRFNAFGTISVIYLIILIMFKFIKWGVHLDFA---NPRNHVTNFGNHFTALTGICSLAFFIHNAIHYIMSNQDKPENNVRDVSIAYSLVALTYLVIGVLFYIIF---PFDKECIQXXXXXXXXXXXXXAVIGRLMLLFQIITVFPLLVNILRTQFMYHLFKTSYP 1251
            K  SLVTIF I+NTMMG +I+S+PW I+QAG   G+ +++ +G LTLY    V+KS   +        E+ D C  Y G  G+ S+++ S+  L+ ++IVY+VL+ NFLF T  ++FN+I     +   + D    TN +NP                S     H +N      + ++     +  W ++ TVPF+++ ++ PL++ KS +F S+FN  GT+SV+YLI L+ FK ++ G HL+F         V      F  LTG+ +LAFFIHN I  ++ N  K ENNVRD+ IAY LV LTYL IGVL +  F   P  K+CI+ N L+N   +D+L+ I R+ LLFQ++TV+PLL  + R Q + H+F   YP
Sbjct:   53 KNTSLVTIFMIWNTMMGTSILSIPWGIKQAGFTTGMCVIILMGLLTLYCCYRVVKSRTMMFSLDTTSWEYPDVCRHYFGSFGQWSSLLFSLVSLIGAMIVYWVLMSNFLFNTGKFIFNFI-----HHINDTDTILSTNNSNPVI------------CPSAGSGGHPDNSSMIFYANDTGAQQFEKWWDKSRTVPFYLVGLLLPLLNFKSPSFFSKFNILGTVSVLYLIFLVTFKAVRLGFHLEFHWFIPTEFFVPEIRFQFPQLTGVLTLAFFIHNCIITLLKNNKKQENNVRDLCIAYMLVTLTYLYIGVLVFASFPSPPLSKDCIEQNFLDNFPSSDTLSFIARIFLLFQMMTVYPLLGYLARVQLLGHIFGDIYP 413          
BLAST of slc38a-6 vs. Ensembl Human
Match: SLC38A9 (solute carrier family 38 member 9 [Source:HGNC Symbol;Acc:HGNC:26907])

HSP 1 Score: 201.06 bits (510), Expect = 5.143e-57
Identity = 148/378 (39.15%), Postives = 218/378 (57.67%), Query Frame = 1
Query:  142 KRGSLVTIFSIYNTMMGATIISMPWXXXXXXXXXXXXXXXXXXXXTLYTAILVLKSTNYIIRTRHCILEFSDACGFYLGRIGEISAIISSIFVLMSSLIVYYVLLCNFLFLTVLYVFNYIIDSPNYAFPEND--FPTNTTNPQCFNWLNNSLTSYYVVSKDPLSHLNNVERYQISGNSSVVLLKALWSENLTVPFWVLIIIFPLISIKSATFVSRFNAFGTISVIYLIILIMFKFIKWGVHLDFA---NPRNHVTNFGNHFTALTGICSLAFFIHNAIHYIMSNQDKPENNVRDVSIAYSLVALTYLVIGVLFYIIF---PFDKECIQXXXXXXXXXXXXXAVIGRLMLLFQIITVFPLLVNILRTQFMYHLFKTSYP 1251
            K  SLVTIF I+NTMMG +I+S+PW I+QAG   G+ +++ +G LTLY    V+KS   +        E+ D C  Y G  G+ S+++ S+  L+ ++IVY+VL+ NFLF T  ++FN+I     +   + D    TN +NP                S     H +N      + ++     +  W ++ TVPF+++ ++ PL++ KS +F S+FN  GT+SV+YLI L+ FK ++ G HL+F         V      F  LTG+ +LAFFIHN I  ++ N  K ENNVRD+ IAY LV LTYL IGVL +  F   P  K+CI+ N L+N   +D+L+ I R+ LLFQ++TV+PLL  + R Q + H+F   YP
Sbjct:  116 KNTSLVTIFMIWNTMMGTSILSIPWGIKQAGFTTGMCVIILMGLLTLYCCYRVVKSRTMMFSLDTTSWEYPDVCRHYFGSFGQWSSLLFSLVSLIGAMIVYWVLMSNFLFNTGKFIFNFI-----HHINDTDTILSTNNSNP------------VICPSAGSGGHPDNSSMIFYANDTGAQQFEKWWDKSRTVPFYLVGLLLPLLNFKSPSFFSKFNILGTVSVLYLIFLVTFKAVRLGFHLEFHWFIPTEFFVPEIRFQFPQLTGVLTLAFFIHNCIITLLKNNKKQENNVRDLCIAYMLVTLTYLYIGVLVFASFPSPPLSKDCIEQNFLDNFPSSDTLSFIARIFLLFQMMTVYPLLGYLARVQLLGHIFGDIYP 476          
BLAST of slc38a-6 vs. Ensembl Human
Match: SLC38A9 (solute carrier family 38 member 9 [Source:HGNC Symbol;Acc:HGNC:26907])

HSP 1 Score: 201.06 bits (510), Expect = 5.143e-57
Identity = 148/378 (39.15%), Postives = 218/378 (57.67%), Query Frame = 1
Query:  142 KRGSLVTIFSIYNTMMGATIISMPWXXXXXXXXXXXXXXXXXXXXTLYTAILVLKSTNYIIRTRHCILEFSDACGFYLGRIGEISAIISSIFVLMSSLIVYYVLLCNFLFLTVLYVFNYIIDSPNYAFPEND--FPTNTTNPQCFNWLNNSLTSYYVVSKDPLSHLNNVERYQISGNSSVVLLKALWSENLTVPFWVLIIIFPLISIKSATFVSRFNAFGTISVIYLIILIMFKFIKWGVHLDFA---NPRNHVTNFGNHFTALTGICSLAFFIHNAIHYIMSNQDKPENNVRDVSIAYSLVALTYLVIGVLFYIIF---PFDKECIQXXXXXXXXXXXXXAVIGRLMLLFQIITVFPLLVNILRTQFMYHLFKTSYP 1251
            K  SLVTIF I+NTMMG +I+S+PW I+QAG   G+ +++ +G LTLY    V+KS   +        E+ D C  Y G  G+ S+++ S+  L+ ++IVY+VL+ NFLF T  ++FN+I     +   + D    TN +NP                S     H +N      + ++     +  W ++ TVPF+++ ++ PL++ KS +F S+FN  GT+SV+YLI L+ FK ++ G HL+F         V      F  LTG+ +LAFFIHN I  ++ N  K ENNVRD+ IAY LV LTYL IGVL +  F   P  K+CI+ N L+N   +D+L+ I R+ LLFQ++TV+PLL  + R Q + H+F   YP
Sbjct:  116 KNTSLVTIFMIWNTMMGTSILSIPWGIKQAGFTTGMCVIILMGLLTLYCCYRVVKSRTMMFSLDTTSWEYPDVCRHYFGSFGQWSSLLFSLVSLIGAMIVYWVLMSNFLFNTGKFIFNFI-----HHINDTDTILSTNNSNP------------VICPSAGSGGHPDNSSMIFYANDTGAQQFEKWWDKSRTVPFYLVGLLLPLLNFKSPSFFSKFNILGTVSVLYLIFLVTFKAVRLGFHLEFHWFIPTEFFVPEIRFQFPQLTGVLTLAFFIHNCIITLLKNNKKQENNVRDLCIAYMLVTLTYLYIGVLVFASFPSPPLSKDCIEQNFLDNFPSSDTLSFIARIFLLFQMMTVYPLLGYLARVQLLGHIFGDIYP 476          
BLAST of slc38a-6 vs. Ensembl Human
Match: SLC38A9 (solute carrier family 38 member 9 [Source:HGNC Symbol;Acc:HGNC:26907])

HSP 1 Score: 189.889 bits (481), Expect = 5.311e-54
Identity = 141/368 (38.32%), Postives = 211/368 (57.34%), Query Frame = 1
Query:  172 IYNTMMGATIISMPWXXXXXXXXXXXXXXXXXXXXTLYTAILVLKSTNYIIRTRHCILEFSDACGFYLGRIGEISAIISSIFVLMSSLIVYYVLLCNFLFLTVLYVFNYIIDSPNYAFPEND--FPTNTTNPQCFNWLNNSLTSYYVVSKDPLSHLNNVERYQISGNSSVVLLKALWSENLTVPFWVLIIIFPLISIKSATFVSRFNAFGTISVIYLIILIMFKFIKWGVHLDFA---NPRNHVTNFGNHFTALTGICSLAFFIHNAIHYIMSNQDKPENNVRDVSIAYSLVALTYLVIGVLFYIIF---PFDKECIQXXXXXXXXXXXXXAVIGRLMLLFQIITVFPLLVNILRTQFMYHLFKTSYP 1251
            I+NTMMG +I+S+PW I+QAG   G+ +++ +G LTLY    V+KS   +        E+ D C  Y G  G+ S+++ S+  L+ ++IVY+VL+ NFLF T  ++FN+I     +   + D    TN +NP                S     H +N      + ++     +  W ++ TVPF+++ ++ PL++ KS +F S+FN  GT+SV+YLI L+ FK ++ G HL+F         V      F  LTG+ +LAFFIHN I  ++ N  K ENNVRD+ IAY LV LTYL IGVL +  F   P  K+CI+ N L+N   +D+L+ I R+ LLFQ++TV+PLL  + R Q + H+F   YP
Sbjct:    2 IWNTMMGTSILSIPWGIKQAGFTTGMCVIILMGLLTLYCCYRVVKSRTMMFSLDTTSWEYPDVCRHYFGSFGQWSSLLFSLVSLIGAMIVYWVLMSNFLFNTGKFIFNFI-----HHINDTDTILSTNNSNP------------VICPSAGSGGHPDNSSMIFYANDTGAQQFEKWWDKSRTVPFYLVGLLLPLLNFKSPSFFSKFNILGTVSVLYLIFLVTFKAVRLGFHLEFHWFIPTEFFVPEIRFQFPQLTGVLTLAFFIHNCIITLLKNNKKQENNVRDLCIAYMLVTLTYLYIGVLVFASFPSPPLSKDCIEQNFLDNFPSSDTLSFIARIFLLFQMMTVYPLLGYLARVQLLGHIFGDIYP 352          
BLAST of slc38a-6 vs. Ensembl Human
Match: SLC38A9 (solute carrier family 38 member 9 [Source:HGNC Symbol;Acc:HGNC:26907])

HSP 1 Score: 172.555 bits (436), Expect = 5.838e-48
Identity = 126/328 (38.41%), Postives = 185/328 (56.40%), Query Frame = 1
Query:  142 KRGSLVTIFSIYNTMMGATIISMPWXXXXXXXXXXXXXXXXXXXXTLYTAILVLKSTNYIIRTRHCILEFSDACGFYLGRIGEISAIISSIFVLMSSLIVYYVLLCNFLFLTVLYVFNYIIDSPNYAFPEND--FPTNTTNPQCFNWLNNSLTSYYVVSKDPLSHLNNVERYQISGNSSVVLLKALWSENLTVPFWVLIIIFPLISIKSATFVSRFNAFGTISVIYLIILIMFKFIKWGVHLDFA---NPRNHVTNFGNHFTALTGICSLAFFIHNAIHYIMSNQDKPENNVRDVSIAYSLVALTYLVIGVLFYIIF---PFDKECIQ 1101
            K  SLVTIF I+NTMMG +I+S+PW I+QAG   G+ +++ +G LTLY    V+KS   +        E+ D C  Y G  G+ S+++ S+  L+ ++IVY+VL+ NFLF T  ++FN+I     +   + D    TN +NP                S     H +N      + ++     +  W ++ TVPF+++ ++ PL++ KS +F S+FN  GT+SV+YLI L+ FK ++ G HL+F         V      F  LTG+ +LAFFIHN I  ++ N  K ENNVRD+ IAY LV LTYL IGVL +  F   P  K+CI+
Sbjct:   53 KNTSLVTIFMIWNTMMGTSILSIPWGIKQAGFTTGMCVIILMGLLTLYCCYRVVKSRTMMFSLDTTSWEYPDVCRHYFGSFGQWSSLLFSLVSLIGAMIVYWVLMSNFLFNTGKFIFNFI-----HHINDTDTILSTNNSNP------------VICPSAGSGGHPDNSSMIFYANDTGAQQFEKWWDKSRTVPFYLVGLLLPLLNFKSPSFFSKFNILGTVSVLYLIFLVTFKAVRLGFHLEFHWFIPTEFFVPEIRFQFPQLTGVLTLAFFIHNCIITLLKNNKKQENNVRDLCIAYMLVTLTYLYIGVLVFASFPSPPLSKDCIE 363          
BLAST of slc38a-6 vs. Ensembl Celegans
Match: F13H10.3 (Sodium-coupled neutral amino acid transporter 9 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q19425])

HSP 1 Score: 233.032 bits (593), Expect = 2.780e-69
Identity = 158/381 (41.47%), Postives = 234/381 (61.42%), Query Frame = 1
Query:  142 KRGSLVTIFSIYNTMMGATIISMPWXXXXXXXXXXXXXXXXXXXXTLYTAILVLKSTNYI--IRTRHCILEFSDACGFYLGRIGEISAIISSIFVLMSSLIVYYVLLCNFLFLTVLYVFNYIIDSPNYA-FPENDFPTNTTNPQCFNWLNNSLTSYYVVSK------DPLSHLNNVERYQISGNSSVVLLKALWSENLTVPFWVLIIIFPLISIKSATFVSRFNAFGTISVIYLIILIMFKFIKWGVHLDFANPRN-HVTNFGN-HFTALTGICSLAFFIHNAIHYIMSNQDKPENNVRDVSIAYSLVALTYLVIGVLFYIIFPFDKECIQXXXXXXXXXXXXXAVIGRLMLLFQIITVFPLLVNILRTQFMYHLFKTSYP 1251
            K+GS+VTIFSI+NTMMG ++++MPWA+QQAGL LGI+++L + A+  YTA +V++S   +  +     + EFSD C    GRIGE  A++ S+ VL+  +IVY+VL+ NFL+ T   V+  +   PN    P  +  T T +  C        TS + + +      D +S +   E    +G+ S    K  W+   TVP ++   +FPL++ KS TF ++FN  GTISV+YL++ +  K ++ GV++DF+NP++ H     N HF AL+G  +L++FIHNA+  I+ NQ  PENN RD+SI Y LVA  Y+ IG  F+  FP  + CI DN LNN    D L+   RL LLFQ+ITV PLL+ ++R+Q  Y +F  ++P
Sbjct:  132 KQGSIVTIFSIWNTMMGTSLLAMPWALQQAGLVLGIIIMLSMAAICFYTAYIVIESPKRLQDLSVDPLLAEFSDVCKSLFGRIGEYCAVVFSVCVLIGGVIVYWVLMSNFLYYTGAVVYESM--QPNSTTIPVMENKTFTCDVYC-----PEQTSQWTIPQWEKQLYDAVSEMEGGE----TGDDSWSFDK-FWTLRGTVPIYLAFALFPLMNFKSPTFFTKFNVLGTISVMYLLMFVFSKLLECGVNMDFSNPKSIHYVQLANMHFPALSGTLTLSYFIHNAVLTILRNQKHPENNARDLSIGYCLVAFCYVFIGFTFFAAFPVQRSCISDNFLNNFGAGDVLSSTARLFLLFQMITVLPLLMFLVRSQLFYAIFGQTWP 500          
BLAST of slc38a-6 vs. Ensembl Celegans
Match: F13H10.3 (Sodium-coupled neutral amino acid transporter 9 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q19425])

HSP 1 Score: 233.032 bits (593), Expect = 2.780e-69
Identity = 158/381 (41.47%), Postives = 234/381 (61.42%), Query Frame = 1
Query:  142 KRGSLVTIFSIYNTMMGATIISMPWXXXXXXXXXXXXXXXXXXXXTLYTAILVLKSTNYI--IRTRHCILEFSDACGFYLGRIGEISAIISSIFVLMSSLIVYYVLLCNFLFLTVLYVFNYIIDSPNYA-FPENDFPTNTTNPQCFNWLNNSLTSYYVVSK------DPLSHLNNVERYQISGNSSVVLLKALWSENLTVPFWVLIIIFPLISIKSATFVSRFNAFGTISVIYLIILIMFKFIKWGVHLDFANPRN-HVTNFGN-HFTALTGICSLAFFIHNAIHYIMSNQDKPENNVRDVSIAYSLVALTYLVIGVLFYIIFPFDKECIQXXXXXXXXXXXXXAVIGRLMLLFQIITVFPLLVNILRTQFMYHLFKTSYP 1251
            K+GS+VTIFSI+NTMMG ++++MPWA+QQAGL LGI+++L + A+  YTA +V++S   +  +     + EFSD C    GRIGE  A++ S+ VL+  +IVY+VL+ NFL+ T   V+  +   PN    P  +  T T +  C        TS + + +      D +S +   E    +G+ S    K  W+   TVP ++   +FPL++ KS TF ++FN  GTISV+YL++ +  K ++ GV++DF+NP++ H     N HF AL+G  +L++FIHNA+  I+ NQ  PENN RD+SI Y LVA  Y+ IG  F+  FP  + CI DN LNN    D L+   RL LLFQ+ITV PLL+ ++R+Q  Y +F  ++P
Sbjct:  132 KQGSIVTIFSIWNTMMGTSLLAMPWALQQAGLVLGIIIMLSMAAICFYTAYIVIESPKRLQDLSVDPLLAEFSDVCKSLFGRIGEYCAVVFSVCVLIGGVIVYWVLMSNFLYYTGAVVYESM--QPNSTTIPVMENKTFTCDVYC-----PEQTSQWTIPQWEKQLYDAVSEMEGGE----TGDDSWSFDK-FWTLRGTVPIYLAFALFPLMNFKSPTFFTKFNVLGTISVMYLLMFVFSKLLECGVNMDFSNPKSIHYVQLANMHFPALSGTLTLSYFIHNAVLTILRNQKHPENNARDLSIGYCLVAFCYVFIGFTFFAAFPVQRSCISDNFLNNFGAGDVLSSTARLFLLFQMITVLPLLMFLVRSQLFYAIFGQTWP 500          
BLAST of slc38a-6 vs. Ensembl Celegans
Match: F13H10.3 (Sodium-coupled neutral amino acid transporter 9 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q19425])

HSP 1 Score: 233.032 bits (593), Expect = 2.837e-69
Identity = 158/381 (41.47%), Postives = 234/381 (61.42%), Query Frame = 1
Query:  142 KRGSLVTIFSIYNTMMGATIISMPWXXXXXXXXXXXXXXXXXXXXTLYTAILVLKSTNYI--IRTRHCILEFSDACGFYLGRIGEISAIISSIFVLMSSLIVYYVLLCNFLFLTVLYVFNYIIDSPNYA-FPENDFPTNTTNPQCFNWLNNSLTSYYVVSK------DPLSHLNNVERYQISGNSSVVLLKALWSENLTVPFWVLIIIFPLISIKSATFVSRFNAFGTISVIYLIILIMFKFIKWGVHLDFANPRN-HVTNFGN-HFTALTGICSLAFFIHNAIHYIMSNQDKPENNVRDVSIAYSLVALTYLVIGVLFYIIFPFDKECIQXXXXXXXXXXXXXAVIGRLMLLFQIITVFPLLVNILRTQFMYHLFKTSYP 1251
            K+GS+VTIFSI+NTMMG ++++MPWA+QQAGL LGI+++L + A+  YTA +V++S   +  +     + EFSD C    GRIGE  A++ S+ VL+  +IVY+VL+ NFL+ T   V+  +   PN    P  +  T T +  C        TS + + +      D +S +   E    +G+ S    K  W+   TVP ++   +FPL++ KS TF ++FN  GTISV+YL++ +  K ++ GV++DF+NP++ H     N HF AL+G  +L++FIHNA+  I+ NQ  PENN RD+SI Y LVA  Y+ IG  F+  FP  + CI DN LNN    D L+   RL LLFQ+ITV PLL+ ++R+Q  Y +F  ++P
Sbjct:  130 KQGSIVTIFSIWNTMMGTSLLAMPWALQQAGLVLGIIIMLSMAAICFYTAYIVIESPKRLQDLSVDPLLAEFSDVCKSLFGRIGEYCAVVFSVCVLIGGVIVYWVLMSNFLYYTGAVVYESM--QPNSTTIPVMENKTFTCDVYC-----PEQTSQWTIPQWEKQLYDAVSEMEGGE----TGDDSWSFDK-FWTLRGTVPIYLAFALFPLMNFKSPTFFTKFNVLGTISVMYLLMFVFSKLLECGVNMDFSNPKSIHYVQLANMHFPALSGTLTLSYFIHNAVLTILRNQKHPENNARDLSIGYCLVAFCYVFIGFTFFAAFPVQRSCISDNFLNNFGAGDVLSSTARLFLLFQMITVLPLLMFLVRSQLFYAIFGQTWP 498          
BLAST of slc38a-6 vs. Ensembl Celegans
Match: F13H10.3 (Sodium-coupled neutral amino acid transporter 9 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q19425])

HSP 1 Score: 233.032 bits (593), Expect = 2.837e-69
Identity = 158/381 (41.47%), Postives = 234/381 (61.42%), Query Frame = 1
Query:  142 KRGSLVTIFSIYNTMMGATIISMPWXXXXXXXXXXXXXXXXXXXXTLYTAILVLKSTNYI--IRTRHCILEFSDACGFYLGRIGEISAIISSIFVLMSSLIVYYVLLCNFLFLTVLYVFNYIIDSPNYA-FPENDFPTNTTNPQCFNWLNNSLTSYYVVSK------DPLSHLNNVERYQISGNSSVVLLKALWSENLTVPFWVLIIIFPLISIKSATFVSRFNAFGTISVIYLIILIMFKFIKWGVHLDFANPRN-HVTNFGN-HFTALTGICSLAFFIHNAIHYIMSNQDKPENNVRDVSIAYSLVALTYLVIGVLFYIIFPFDKECIQXXXXXXXXXXXXXAVIGRLMLLFQIITVFPLLVNILRTQFMYHLFKTSYP 1251
            K+GS+VTIFSI+NTMMG ++++MPWA+QQAGL LGI+++L + A+  YTA +V++S   +  +     + EFSD C    GRIGE  A++ S+ VL+  +IVY+VL+ NFL+ T   V+  +   PN    P  +  T T +  C        TS + + +      D +S +   E    +G+ S    K  W+   TVP ++   +FPL++ KS TF ++FN  GTISV+YL++ +  K ++ GV++DF+NP++ H     N HF AL+G  +L++FIHNA+  I+ NQ  PENN RD+SI Y LVA  Y+ IG  F+  FP  + CI DN LNN    D L+   RL LLFQ+ITV PLL+ ++R+Q  Y +F  ++P
Sbjct:  130 KQGSIVTIFSIWNTMMGTSLLAMPWALQQAGLVLGIIIMLSMAAICFYTAYIVIESPKRLQDLSVDPLLAEFSDVCKSLFGRIGEYCAVVFSVCVLIGGVIVYWVLMSNFLYYTGAVVYESM--QPNSTTIPVMENKTFTCDVYC-----PEQTSQWTIPQWEKQLYDAVSEMEGGE----TGDDSWSFDK-FWTLRGTVPIYLAFALFPLMNFKSPTFFTKFNVLGTISVMYLLMFVFSKLLECGVNMDFSNPKSIHYVQLANMHFPALSGTLTLSYFIHNAVLTILRNQKHPENNARDLSIGYCLVAFCYVFIGFTFFAAFPVQRSCISDNFLNNFGAGDVLSSTARLFLLFQMITVLPLLMFLVRSQLFYAIFGQTWP 498          
BLAST of slc38a-6 vs. Ensembl Celegans
Match: F13H10.3 (Sodium-coupled neutral amino acid transporter 9 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q19425])

HSP 1 Score: 233.417 bits (594), Expect = 5.060e-69
Identity = 158/381 (41.47%), Postives = 234/381 (61.42%), Query Frame = 1
Query:  142 KRGSLVTIFSIYNTMMGATIISMPWXXXXXXXXXXXXXXXXXXXXTLYTAILVLKSTNYI--IRTRHCILEFSDACGFYLGRIGEISAIISSIFVLMSSLIVYYVLLCNFLFLTVLYVFNYIIDSPNYA-FPENDFPTNTTNPQCFNWLNNSLTSYYVVSK------DPLSHLNNVERYQISGNSSVVLLKALWSENLTVPFWVLIIIFPLISIKSATFVSRFNAFGTISVIYLIILIMFKFIKWGVHLDFANPRN-HVTNFGN-HFTALTGICSLAFFIHNAIHYIMSNQDKPENNVRDVSIAYSLVALTYLVIGVLFYIIFPFDKECIQXXXXXXXXXXXXXAVIGRLMLLFQIITVFPLLVNILRTQFMYHLFKTSYP 1251
            K+GS+VTIFSI+NTMMG ++++MPWA+QQAGL LGI+++L + A+  YTA +V++S   +  +     + EFSD C    GRIGE  A++ S+ VL+  +IVY+VL+ NFL+ T   V+  +   PN    P  +  T T +  C        TS + + +      D +S +   E    +G+ S    K  W+   TVP ++   +FPL++ KS TF ++FN  GTISV+YL++ +  K ++ GV++DF+NP++ H     N HF AL+G  +L++FIHNA+  I+ NQ  PENN RD+SI Y LVA  Y+ IG  F+  FP  + CI DN LNN    D L+   RL LLFQ+ITV PLL+ ++R+Q  Y +F  ++P
Sbjct:  164 KQGSIVTIFSIWNTMMGTSLLAMPWALQQAGLVLGIIIMLSMAAICFYTAYIVIESPKRLQDLSVDPLLAEFSDVCKSLFGRIGEYCAVVFSVCVLIGGVIVYWVLMSNFLYYTGAVVYESM--QPNSTTIPVMENKTFTCDVYC-----PEQTSQWTIPQWEKQLYDAVSEMEGGE----TGDDSWSFDK-FWTLRGTVPIYLAFALFPLMNFKSPTFFTKFNVLGTISVMYLLMFVFSKLLECGVNMDFSNPKSIHYVQLANMHFPALSGTLTLSYFIHNAVLTILRNQKHPENNARDLSIGYCLVAFCYVFIGFTFFAAFPVQRSCISDNFLNNFGAGDVLSSTARLFLLFQMITVLPLLMFLVRSQLFYAIFGQTWP 532          
BLAST of slc38a-6 vs. Ensembl Zebrafish
Match: slc38a9 (solute carrier family 38 member 9 [Source:NCBI gene;Acc:562137])

HSP 1 Score: 217.624 bits (553), Expect = 1.442e-63
Identity = 156/380 (41.05%), Postives = 228/380 (60.00%), Query Frame = 1
Query:  130 NYPEKRGSLVTIFSIYNTMMGATIISMPWXXXXXXXXXXXXXXXXXXXXTLYTAILVLKSTNYIIRTRHCILEFSDACGFYLGRIGEISAIISSIFVLMSSLIVYYVLLCNFLFLTVLYVFNYIIDSPNYAFPENDFPTNTTNPQCFNWLNNSLTSYYVVSKDPLSHLNNVERYQISGNSSVVLLKALWSENLTVPFWVLIIIFPLISIKSATFVSRFNAFGTISVIYLIILIMFKFIKWGVHLDF---ANPRNHVTNFGNHFTALTGICSLAFFIHNAIHYIMSNQDKPENNVRDVSIAYSLVALTYLVIGVLFYIIF---PFDKECIQXXXXXXXXXXXXXAVIGRLMLLFQIITVFPLLVNILRTQFMYHLFKTSYP 1251
            + P K  S+VTIF+I+NTMMG +I+S+PW I+QAG  LGI++++ +G LTLY    VLKST  I        EF D C +Y G  G+ S+++ S+  L+ +++VY+VL+ NFLF T  ++FNY+ +             NT++    N     +  Y  V  DP  + ++   Y  S NS+ +     WS+  T+PF++++++ PL++ +SA+F +RF   GTISVIYLI L+ +K I+ G HL+F    +    V  F   F  L+G+ +LAFFIHN I  +M N    ENNVRD+S+AY LV LTYL +GVL +  F   P  KECI+ N L+N   +D L  + R  LLFQ+ TV+PLL  ++R Q M  +F   YP
Sbjct:  100 DSPIKNPSIVTIFAIWNTMMGTSILSIPWGIKQAGFTLGIIIIVLMGLLTLYCCYRVLKSTKSIPYVDTSDWEFPDVCKYYFGGFGKWSSLVFSLVSLIGAMVVYWVLMSNFLFNTGKFIFNYVHN------------VNTSDAFGTNGTERVICPYPDV--DPHGN-SSTSLYSGSDNSTGLEFDHWWSKTNTIPFYLILLLLPLLNFRSASFFARFTFLGTISVIYLIFLVTYKAIQLGFHLEFHWFDSSMFFVPEFRTLFPQLSGVLTLAFFIHNCIITLMKNNKHQENNVRDLSLAYLLVGLTYLYVGVLIFAAFPSPPLSKECIEPNFLDNFPSSDILVFVARTFLLFQMTTVYPLLGYLVRVQLMGQIFGNHYP 464          
BLAST of slc38a-6 vs. Ensembl Xenopus
Match: slc38a9 (solute carrier family 38 member 9 [Source:NCBI gene;Acc:496801])

HSP 1 Score: 198.364 bits (503), Expect = 3.531e-56
Identity = 150/383 (39.16%), Postives = 221/383 (57.70%), Query Frame = 1
Query:  142 KRGSLVTIFSIYNTMMGATIISMPWXXXXXXXXXXXXXXXXXXXXTLYTAILVLKSTNYIIRTRHCILEFSDACGFYLGRIGEISAIISSIFVLMSSLIVYYVLLCNFLFLTVLYVFNYIIDSPNYAFPENDFPTNTT-------NPQCFNWLNNSLTSYYVVSKDPLSHLNNVERYQISGNSSVVLLKALWSENLTVPFWVLIIIFPLISIKSATFVSRFNAFGTISVIYLIILIMFKFIKWGVHLDFANPRNH---VTNFGNHFTALTGICSLAFFIHNAIHYIMSNQDKPENNVRDVSIAYSLVALTYLVIGVLFYIIF---PFDKECIQXXXXXXXXXXXXXAVIGRLMLLFQIITVFPLLVNILRTQFMYHLFKTSYP 1251
            K  S+VTIF I+NTMMG +I+S+PW I+QAG   G+ +L  +G LTLY    V+KS   I  T     EF D C +Y G  G  S+++ S+  L+ ++IVY+VL+ NFLF T  +++NY+ D        +D  +N         NP     LN S+ +Y+        +  N E+++             WS+  TVPF++++++ PL+S +S +F ++FN  GT+S+IYL+ L+  K    G HL F+  +     V  F   F  LTGI +LAFFIHN I  ++ N    +NNVRD+SIAY LV LTY+ +GV  +  F   P  K+CIQ N L+N   +D LA + R+ LLFQ++TV+PLL  ++R Q + H+F   YP
Sbjct:  109 KNSSIVTIFMIWNTMMGTSILSIPWGIKQAGFTTGVCILFLMGILTLYCCYRVVKSRGTIPLTDTSNWEFPDVCQYYFGSFGRWSSLLFSLVSLIGAMIVYWVLMSNFLFNTGKFIYNYVND----VNVTDDVLSNNGSDKVICPNPDSTRPLNKSMDTYF-------GNGTNYEQFE-----------TWWSKTNTVPFYLVVLLLPLLSFRSPSFFAKFNILGTVSIIYLVSLVTLKAAHLGFHLRFSWNQVQEFFVPEFRLSFPQLTGILTLAFFIHNCIITLLKNNRNQKNNVRDLSIAYLLVGLTYIYVGVAVFASFPSPPLSKQCIQQNFLDNFPSSDILAFVARIFLLFQMMTVYPLLGYLVRVQLLGHIFGDIYP 469          
BLAST of slc38a-6 vs. Ensembl Xenopus
Match: slc38a9 (solute carrier family 38 member 9 [Source:NCBI gene;Acc:496801])

HSP 1 Score: 198.364 bits (503), Expect = 4.119e-56
Identity = 148/379 (39.05%), Postives = 219/379 (57.78%), Query Frame = 1
Query:  142 KRGSLVTIFSIYNTMMGATIISMPWXXXXXXXXXXXXXXXXXXXXTLYTAILVLKSTNYIIRTRHCILEFSDACGFYLGRIGEISAIISSIFVLMSSLIVYYVLLCNFLFLTVLYVFNYIID---SPNYAFPENDFPTNTTNPQCFNWLNNSLTSYYVVSKDPLSHLNNVERYQISGNSSVVLLKALWSENLTVPFWVLIIIFPLISIKSATFVSRFNAFGTISVIYLIILIMFKFIKWGVHLDFANPRNH---VTNFGNHFTALTGICSLAFFIHNAIHYIMSNQDKPENNVRDVSIAYSLVALTYLVIGVLFYIIF---PFDKECIQXXXXXXXXXXXXXAVIGRLMLLFQIITVFPLLVNILRTQFMYHLFKTSYP 1251
            K  S+VTIF I+NTMMG +I+S+PW I+QAG   G+ +L  +G LTLY    V+KS   I  T     EF D C +Y G  G  S+++ S+  L+ ++IVY+VL+ NFLF T  +++NY+ D   + +             NP     LN S+ +Y+        +  N E+++             WS+  TVPF++++++ PL+S +S +F ++FN  GT+S+IYL+ L+  K    G HL F+  +     V  F   F  LTGI +LAFFIHN I  ++ N    +NNVRD+SIAY LV LTY+ +GV  +  F   P  K+CIQ N L+N   +D LA + R+ LLFQ++TV+PLL  ++R Q + H+F   YP
Sbjct:  109 KNSSIVTIFMIWNTMMGTSILSIPWGIKQAGFTTGVCILFLMGILTLYCCYRVVKSRGTIPLTDTSNWEFPDVCQYYFGSFGRWSSLLFSLVSLIGAMIVYWVLMSNFLFNTGKFIYNYVNDVNVTDDVLSNNGSDKVICPNPDSTRPLNKSMDTYF-------GNGTNYEQFE-----------TWWSKTNTVPFYLVVLLLPLLSFRSPSFFAKFNILGTVSIIYLVSLVTLKAAHLGFHLRFSWNQVQEFFVPEFRLSFPQLTGILTLAFFIHNCIITLLKNNRNQKNNVRDLSIAYLLVGLTYIYVGVAVFASFPSPPLSKQCIQQNFLDNFPSSDILAFVARIFLLFQMMTVYPLLGYLVRVQLLGHIFGDIYP 469          
BLAST of slc38a-6 vs. Ensembl Xenopus
Match: slc38a9 (solute carrier family 38 member 9 [Source:NCBI gene;Acc:496801])

HSP 1 Score: 198.364 bits (503), Expect = 5.636e-56
Identity = 148/379 (39.05%), Postives = 219/379 (57.78%), Query Frame = 1
Query:  142 KRGSLVTIFSIYNTMMGATIISMPWXXXXXXXXXXXXXXXXXXXXTLYTAILVLKSTNYIIRTRHCILEFSDACGFYLGRIGEISAIISSIFVLMSSLIVYYVLLCNFLFLTVLYVFNYIID---SPNYAFPENDFPTNTTNPQCFNWLNNSLTSYYVVSKDPLSHLNNVERYQISGNSSVVLLKALWSENLTVPFWVLIIIFPLISIKSATFVSRFNAFGTISVIYLIILIMFKFIKWGVHLDFANPRNH---VTNFGNHFTALTGICSLAFFIHNAIHYIMSNQDKPENNVRDVSIAYSLVALTYLVIGVLFYIIF---PFDKECIQXXXXXXXXXXXXXAVIGRLMLLFQIITVFPLLVNILRTQFMYHLFKTSYP 1251
            K  S+VTIF I+NTMMG +I+S+PW I+QAG   G+ +L  +G LTLY    V+KS   I  T     EF D C +Y G  G  S+++ S+  L+ ++IVY+VL+ NFLF T  +++NY+ D   + +             NP     LN S+ +Y+        +  N E+++             WS+  TVPF++++++ PL+S +S +F ++FN  GT+S+IYL+ L+  K    G HL F+  +     V  F   F  LTGI +LAFFIHN I  ++ N    +NNVRD+SIAY LV LTY+ +GV  +  F   P  K+CIQ N L+N   +D LA + R+ LLFQ++TV+PLL  ++R Q + H+F   YP
Sbjct:  126 KNSSIVTIFMIWNTMMGTSILSIPWGIKQAGFTTGVCILFLMGILTLYCCYRVVKSRGTIPLTDTSNWEFPDVCQYYFGSFGRWSSLLFSLVSLIGAMIVYWVLMSNFLFNTGKFIYNYVNDVNVTDDVLSNNGSDKVICPNPDSTRPLNKSMDTYF-------GNGTNYEQFE-----------TWWSKTNTVPFYLVVLLLPLLSFRSPSFFAKFNILGTVSIIYLVSLVTLKAAHLGFHLRFSWNQVQEFFVPEFRLSFPQLTGILTLAFFIHNCIITLLKNNRNQKNNVRDLSIAYLLVGLTYIYVGVAVFASFPSPPLSKQCIQQNFLDNFPSSDILAFVARIFLLFQMMTVYPLLGYLVRVQLLGHIFGDIYP 486          
BLAST of slc38a-6 vs. Ensembl Xenopus
Match: slc38a9 (solute carrier family 38 member 9 [Source:NCBI gene;Acc:496801])

HSP 1 Score: 198.364 bits (503), Expect = 9.051e-56
Identity = 150/383 (39.16%), Postives = 221/383 (57.70%), Query Frame = 1
Query:  142 KRGSLVTIFSIYNTMMGATIISMPWXXXXXXXXXXXXXXXXXXXXTLYTAILVLKSTNYIIRTRHCILEFSDACGFYLGRIGEISAIISSIFVLMSSLIVYYVLLCNFLFLTVLYVFNYIIDSPNYAFPENDFPTNTT-------NPQCFNWLNNSLTSYYVVSKDPLSHLNNVERYQISGNSSVVLLKALWSENLTVPFWVLIIIFPLISIKSATFVSRFNAFGTISVIYLIILIMFKFIKWGVHLDFANPRNH---VTNFGNHFTALTGICSLAFFIHNAIHYIMSNQDKPENNVRDVSIAYSLVALTYLVIGVLFYIIF---PFDKECIQXXXXXXXXXXXXXAVIGRLMLLFQIITVFPLLVNILRTQFMYHLFKTSYP 1251
            K  S+VTIF I+NTMMG +I+S+PW I+QAG   G+ +L  +G LTLY    V+KS   I  T     EF D C +Y G  G  S+++ S+  L+ ++IVY+VL+ NFLF T  +++NY+ D        +D  +N         NP     LN S+ +Y+        +  N E+++             WS+  TVPF++++++ PL+S +S +F ++FN  GT+S+IYL+ L+  K    G HL F+  +     V  F   F  LTGI +LAFFIHN I  ++ N    +NNVRD+SIAY LV LTY+ +GV  +  F   P  K+CIQ N L+N   +D LA + R+ LLFQ++TV+PLL  ++R Q + H+F   YP
Sbjct:  153 KNSSIVTIFMIWNTMMGTSILSIPWGIKQAGFTTGVCILFLMGILTLYCCYRVVKSRGTIPLTDTSNWEFPDVCQYYFGSFGRWSSLLFSLVSLIGAMIVYWVLMSNFLFNTGKFIYNYVND----VNVTDDVLSNNGSDKVICPNPDSTRPLNKSMDTYF-------GNGTNYEQFE-----------TWWSKTNTVPFYLVVLLLPLLSFRSPSFFAKFNILGTVSIIYLVSLVTLKAAHLGFHLRFSWNQVQEFFVPEFRLSFPQLTGILTLAFFIHNCIITLLKNNRNQKNNVRDLSIAYLLVGLTYIYVGVAVFASFPSPPLSKQCIQQNFLDNFPSSDILAFVARIFLLFQMMTVYPLLGYLVRVQLLGHIFGDIYP 513          
BLAST of slc38a-6 vs. Ensembl Xenopus
Match: slc38a9 (solute carrier family 38 member 9 [Source:NCBI gene;Acc:496801])

HSP 1 Score: 168.703 bits (426), Expect = 1.401e-46
Identity = 128/333 (38.44%), Postives = 188/333 (56.46%), Query Frame = 1
Query:  142 KRGSLVTIFSIYNTMMGATIISMPWXXXXXXXXXXXXXXXXXXXXTLYTAILVLKSTNYIIRTRHCILEFSDACGFYLGRIGEISAIISSIFVLMSSLIVYYVLLCNFLFLTVLYVFNYIIDSPNYAFPENDFPTNTT-------NPQCFNWLNNSLTSYYVVSKDPLSHLNNVERYQISGNSSVVLLKALWSENLTVPFWVLIIIFPLISIKSATFVSRFNAFGTISVIYLIILIMFKFIKWGVHLDFANPRNH---VTNFGNHFTALTGICSLAFFIHNAIHYIMSNQDKPENNVRDVSIAYSLVALTYLVIGVLFYIIF---PFDKECIQ 1101
            K  S+VTIF I+NTMMG +I+S+PW I+QAG   G+ +L  +G LTLY    V+KS   I  T     EF D C +Y G  G  S+++ S+  L+ ++IVY+VL+ NFLF T  +++NY+ D        +D  +N         NP     LN S+ +Y+        +  N E+++             WS+  TVPF++++++ PL+S +S +F ++FN  GT+S+IYL+ L+  K    G HL F+  +     V  F   F  LTGI +LAFFIHN I  ++ N    +NNVRD+SIAY LV LTY+ +GV  +  F   P  K+CIQ
Sbjct:   52 KNSSIVTIFMIWNTMMGTSILSIPWGIKQAGFTTGVCILFLMGILTLYCCYRVVKSRGTIPLTDTSNWEFPDVCQYYFGSFGRWSSLLFSLVSLIGAMIVYWVLMSNFLFNTGKFIYNYVND----VNVTDDVLSNNGSDKVICPNPDSTRPLNKSMDTYF-------GNGTNYEQFE-----------TWWSKTNTVPFYLVVLLLPLLSFRSPSFFAKFNILGTVSIIYLVSLVTLKAAHLGFHLRFSWNQVQEFFVPEFRLSFPQLTGILTLAFFIHNCIITLLKNNRNQKNNVRDLSIAYLLVGLTYIYVGVAVFASFPSPPLSKQCIQ 362          
BLAST of slc38a-6 vs. Ensembl Mouse
Match: Slc38a9 (solute carrier family 38, member 9 [Source:MGI Symbol;Acc:MGI:1918839])

HSP 1 Score: 192.971 bits (489), Expect = 2.934e-54
Identity = 148/379 (39.05%), Postives = 217/379 (57.26%), Query Frame = 1
Query:  142 KRGSLVTIFSIYNTMMGATIISMPWXXXXXXXXXXXXXXXXXXXXTLYTAILVLKSTNYIIRTRHCILEFSDACGFYLGRIGEISAIISSIFVLMSSLIVYYVLLCNFLFLTVLYVFNYII---DSPNYAFPENDFPTNTTNPQCFNWLNNSLTSYYVVSKDPLSHLNNVERYQISGNSSVVLLKALWSENLTVPFWVLIIIFPLISIKSATFVSRFNAFGTISVIYLIILIMFKFIKWGVHLD---FANPRNHVTNFGNHFTALTGICSLAFFIHNAIHYIMSNQDKPENNVRDVSIAYSLVALTYLVIGVLFYIIF---PFDKECIQXXXXXXXXXXXXXAVIGRLMLLFQIITVFPLLVNILRTQFMYHLFKTSYP 1251
            K  SLVTIF I+NTMMG +I+S+PW I+QAG   G+ +++ +G LTLY    V+KS + I  +     E+ D C  Y G  G+ S+++ S+  L+ ++IVY+VL+ NFLF T  ++FN+I    D+       N  P    N       +NS   +Y          NN        N+ V L +  W ++ TVPF+++ ++ PL++ KS +F S+FN  GT+SV+YLI ++  K ++ G HL+   F      V      F  L G+ +LAFFIHN I  ++ N    ENNVRD+ IAY LV LTYL IG+L +  F   P  K+CI+ N L+N   +D L+ I R+ LLFQ++TV+PLL  + R Q + H+F   YP
Sbjct:  115 KNTSLVTIFMIWNTMMGTSILSIPWGIKQAGFTTGMCVIVLMGLLTLYCCYRVVKSRSTISTSDTSTWEYPDVCKHYFGSFGQWSSLLFSLVSLIGAMIVYWVLMSNFLFNTGKFIFNFIHHINDTDTVLSTNNSNPVICPNAGSGGRPDNSSMIFY----------NN--------NTEVQLFEKWWDKSRTVPFYLIGLLLPLLNFKSPSFFSKFNILGTVSVLYLIFVVTLKAVRLGFHLEFHWFVPTEFFVPEIRAQFPQLMGVLTLAFFIHNCIITLLKNNKNQENNVRDLCIAYMLVTLTYLYIGILVFASFPSPPLPKDCIEQNFLDNFPSSDILSFIARIFLLFQMMTVYPLLGYLARVQLLGHIFGDIYP 475          
BLAST of slc38a-6 vs. UniProt/SwissProt
Match: sp|Q19425|S38A9_CAEEL (Sodium-coupled neutral amino acid transporter 9 homolog OS=Caenorhabditis elegans OX=6239 GN=F13H10.3 PE=3 SV=2)

HSP 1 Score: 233.032 bits (593), Expect = 7.301e-68
Identity = 158/381 (41.47%), Postives = 234/381 (61.42%), Query Frame = 1
Query:  142 KRGSLVTIFSIYNTMMGATIISMPWXXXXXXXXXXXXXXXXXXXXTLYTAILVLKSTNYI--IRTRHCILEFSDACGFYLGRIGEISAIISSIFVLMSSLIVYYVLLCNFLFLTVLYVFNYIIDSPNYA-FPENDFPTNTTNPQCFNWLNNSLTSYYVVSK------DPLSHLNNVERYQISGNSSVVLLKALWSENLTVPFWVLIIIFPLISIKSATFVSRFNAFGTISVIYLIILIMFKFIKWGVHLDFANPRN-HVTNFGN-HFTALTGICSLAFFIHNAIHYIMSNQDKPENNVRDVSIAYSLVALTYLVIGVLFYIIFPFDKECIQXXXXXXXXXXXXXAVIGRLMLLFQIITVFPLLVNILRTQFMYHLFKTSYP 1251
            K+GS+VTIFSI+NTMMG ++++MPWA+QQAGL LGI+++L + A+  YTA +V++S   +  +     + EFSD C    GRIGE  A++ S+ VL+  +IVY+VL+ NFL+ T   V+  +   PN    P  +  T T +  C        TS + + +      D +S +   E    +G+ S    K  W+   TVP ++   +FPL++ KS TF ++FN  GTISV+YL++ +  K ++ GV++DF+NP++ H     N HF AL+G  +L++FIHNA+  I+ NQ  PENN RD+SI Y LVA  Y+ IG  F+  FP  + CI DN LNN    D L+   RL LLFQ+ITV PLL+ ++R+Q  Y +F  ++P
Sbjct:  162 KQGSIVTIFSIWNTMMGTSLLAMPWALQQAGLVLGIIIMLSMAAICFYTAYIVIESPKRLQDLSVDPLLAEFSDVCKSLFGRIGEYCAVVFSVCVLIGGVIVYWVLMSNFLYYTGAVVYESM--QPNSTTIPVMENKTFTCDVYC-----PEQTSQWTIPQWEKQLYDAVSEMEGGE----TGDDSWSFDK-FWTLRGTVPIYLAFALFPLMNFKSPTFFTKFNVLGTISVMYLLMFVFSKLLECGVNMDFSNPKSIHYVQLANMHFPALSGTLTLSYFIHNAVLTILRNQKHPENNARDLSIGYCLVAFCYVFIGFTFFAAFPVQRSCISDNFLNNFGAGDVLSSTARLFLLFQMITVLPLLMFLVRSQLFYAIFGQTWP 530          
BLAST of slc38a-6 vs. UniProt/SwissProt
Match: sp|Q08BA4|S38A9_DANRE (Sodium-coupled neutral amino acid transporter 9 OS=Danio rerio OX=7955 GN=slc38a9 PE=1 SV=1)

HSP 1 Score: 217.624 bits (553), Expect = 1.088e-62
Identity = 156/380 (41.05%), Postives = 228/380 (60.00%), Query Frame = 1
Query:  130 NYPEKRGSLVTIFSIYNTMMGATIISMPWXXXXXXXXXXXXXXXXXXXXTLYTAILVLKSTNYIIRTRHCILEFSDACGFYLGRIGEISAIISSIFVLMSSLIVYYVLLCNFLFLTVLYVFNYIIDSPNYAFPENDFPTNTTNPQCFNWLNNSLTSYYVVSKDPLSHLNNVERYQISGNSSVVLLKALWSENLTVPFWVLIIIFPLISIKSATFVSRFNAFGTISVIYLIILIMFKFIKWGVHLDF---ANPRNHVTNFGNHFTALTGICSLAFFIHNAIHYIMSNQDKPENNVRDVSIAYSLVALTYLVIGVLFYIIF---PFDKECIQXXXXXXXXXXXXXAVIGRLMLLFQIITVFPLLVNILRTQFMYHLFKTSYP 1251
            + P K  S+VTIF+I+NTMMG +I+S+PW I+QAG  LGI++++ +G LTLY    VLKST  I        EF D C +Y G  G+ S+++ S+  L+ +++VY+VL+ NFLF T  ++FNY+ +             NT++    N     +  Y  V  DP  + ++   Y  S NS+ +     WS+  T+PF++++++ PL++ +SA+F +RF   GTISVIYLI L+ +K I+ G HL+F    +    V  F   F  L+G+ +LAFFIHN I  +M N    ENNVRD+S+AY LV LTYL +GVL +  F   P  KECI+ N L+N   +D L  + R  LLFQ+ TV+PLL  ++R Q M  +F   YP
Sbjct:  100 DSPIKNPSIVTIFAIWNTMMGTSILSIPWGIKQAGFTLGIIIIVLMGLLTLYCCYRVLKSTKSIPYVDTSDWEFPDVCKYYFGGFGKWSSLVFSLVSLIGAMVVYWVLMSNFLFNTGKFIFNYVHN------------VNTSDAFGTNGTERVICPYPDV--DPHGN-SSTSLYSGSDNSTGLEFDHWWSKTNTIPFYLILLLLPLLNFRSASFFARFTFLGTISVIYLIFLVTYKAIQLGFHLEFHWFDSSMFFVPEFRTLFPQLSGVLTLAFFIHNCIITLMKNNKHQENNVRDLSLAYLLVGLTYLYVGVLIFAAFPSPPLSKECIEPNFLDNFPSSDILVFVARTFLLFQMTTVYPLLGYLVRVQLMGQIFGNHYP 464          
BLAST of slc38a-6 vs. UniProt/SwissProt
Match: sp|Q6DFK0|S38A9_XENLA (Sodium-coupled neutral amino acid transporter 9 OS=Xenopus laevis OX=8355 GN=slc38a9 PE=2 SV=1)

HSP 1 Score: 210.305 bits (534), Expect = 6.196e-60
Identity = 150/383 (39.16%), Postives = 222/383 (57.96%), Query Frame = 1
Query:  139 EKRGSLVTIFSIYNTMMGATIISMPWXXXXXXXXXXXXXXXXXXXXTLYTAILVLKSTNYIIRTRHCILEFSDACGFYLGRIGEISAIISSIFVLMSSLIVYYVLLCNFLFLTVLYVFNYIIDSPNYAFPENDFPTNTT------NPQCFNWLNNSLTSYYVVSKDPLSHLNNVERYQISGNSSVVLLKALWSENLTVPFWVLIIIFPLISIKSATFVSRFNAFGTISVIYLIILIMFKFIKWGVHLDFANPRNH---VTNFGNHFTALTGICSLAFFIHNAIHYIMSNQDKPENNVRDVSIAYSLVALTYLVIGVLFYIIF---PFDKECIQXXXXXXXXXXXXXAVIGRLMLLFQIITVFPLLVNILRTQFMYHLFKTSYP 1251
            EK  S+VTIF I+NTMMG +I+S+PW I+QAG   G+ +L  +G LTLY    V+KS   I  T     EF D C +Y G  G  S+++ S+  L+ ++IVY+VL+ NFLF T  +++NY+ D       ++    N T      NP     LN S+ +YY        +  N+E ++             WS+  TVPF++++++ PL+  +S +F ++FN  GT+S+IYL+ L+  K    G HL F+  +     V  F   F  LTGI +LAFFIHN I  ++ N    +NNVRD+SIAY LV LTY+ +GV+ +  F   P  K+CI+ N L+N   +D LA + R+ LLFQ++TV+PLL  ++R Q + H+F   YP
Sbjct:  108 EKNSSIVTIFMIWNTMMGTSILSIPWGIKQAGFTTGVCVLFLMGILTLYCCYRVVKSRGTIPLTDTSTWEFPDVCQYYFGSFGRWSSLLFSMVSLIGAMIVYWVLMSNFLFNTGKFIYNYVND---VNITDDVLSNNGTDKVICPNPDSTGPLNKSMDTYY-------GNGTNLEHFE-----------TWWSKTNTVPFYLVVLLLPLLGFRSPSFFAKFNILGTVSIIYLVSLVTLKAAHLGFHLQFSWNQVQTFFVPEFRVSFPQLTGILTLAFFIHNCIITLLKNNRNQKNNVRDLSIAYLLVGLTYVYVGVVVFASFPSPPLSKQCIEQNFLDNFPSSDILAFVARIFLLFQMMTVYPLLGYLVRVQLLGHIFGDIYP 469          
BLAST of slc38a-6 vs. UniProt/SwissProt
Match: sp|Q3B8Q3|S38A9_RAT (Sodium-coupled neutral amino acid transporter 9 OS=Rattus norvegicus OX=10116 GN=Slc38a9 PE=2 SV=1)

HSP 1 Score: 205.297 bits (521), Expect = 5.977e-58
Identity = 148/377 (39.26%), Postives = 222/377 (58.89%), Query Frame = 1
Query:  139 EKRGSLVTIFSIYNTMMGATIISMPWXXXXXXXXXXXXXXXXXXXXTLYTAILVLKSTNYIIRTRHCILEFSDACGFYLGRIGEISAIISSIFVLMSSLIVYYVLLCNFLFLTVLYVFNYIIDSPNYAFPENDFPTNTTNPQCFNWLNNSLTSYYVVSKDPLSHLNNVERYQISGNSSVVLLKALWSENLTVPFWVLIIIFPLISIKSATFVSRFNAFGTISVIYLIILIMFKFIKWGVHLDF---ANPRNHVTNFGNHFTALTGICSLAFFIHNAIHYIMSNQDKPENNVRDVSIAYSLVALTYLVIGVLFYIIF---PFDKECIQXXXXXXXXXXXXXAVIGRLMLLFQIITVFPLLVNILRTQFMYHLFKTSYP 1251
             K  SLVTIF I+NTMMG +I+S+PW I+QAG   G+ +++ +G LTLY    V+KS + I+ +     E+ D C  Y G  G+ S+++ S+  L+ ++IVY+VL+ NFLF T  ++FN+I     +   + D   +T N           +S  +       H +N      + ++ V L +  W ++ TVPF+++ ++ PL++ KS +F S+FN  GT+SV+YLI ++  K I+ G HL+F   A     V      F  LTG+ +LAFFIHN I  ++ N    ENNVRD+ IAY LV LTYL IGVL +  F   P  K+CI+ N L+N   +D+L+ I R+ LLFQ++TV+PLL  + R Q + H+F   YP
Sbjct:  114 RKNTSLVTIFMIWNTMMGTSILSIPWGIKQAGFTTGMCVIVLMGLLTLYCCYRVVKSRSMIVTSDTTTWEYPDVCKHYFGSFGQWSSLLFSLVSLIGAMIVYWVLMSNFLFNTGKFIFNFI-----HHINDTDTVLSTNN-----------SSPVICPSAGSGHPDNSSMIFYNSDTEVRLFERWWDKSKTVPFYLIGLLLPLLNFKSPSFFSKFNILGTVSVLYLIFIVTLKAIRLGFHLEFHWFAPTEFFVPEIRAQFPQLTGVLTLAFFIHNCIITLLKNNKNQENNVRDLCIAYMLVTLTYLYIGVLVFASFPSPPLPKDCIEQNFLDNFPSSDTLSFIARICLLFQMMTVYPLLGYLARVQLLGHIFGDIYP 474          
BLAST of slc38a-6 vs. UniProt/SwissProt
Match: sp|Q8NBW4|S38A9_HUMAN (Sodium-coupled neutral amino acid transporter 9 OS=Homo sapiens OX=9606 GN=SLC38A9 PE=1 SV=2)

HSP 1 Score: 201.06 bits (510), Expect = 2.470e-56
Identity = 148/378 (39.15%), Postives = 218/378 (57.67%), Query Frame = 1
Query:  142 KRGSLVTIFSIYNTMMGATIISMPWXXXXXXXXXXXXXXXXXXXXTLYTAILVLKSTNYIIRTRHCILEFSDACGFYLGRIGEISAIISSIFVLMSSLIVYYVLLCNFLFLTVLYVFNYIIDSPNYAFPEND--FPTNTTNPQCFNWLNNSLTSYYVVSKDPLSHLNNVERYQISGNSSVVLLKALWSENLTVPFWVLIIIFPLISIKSATFVSRFNAFGTISVIYLIILIMFKFIKWGVHLDFA---NPRNHVTNFGNHFTALTGICSLAFFIHNAIHYIMSNQDKPENNVRDVSIAYSLVALTYLVIGVLFYIIF---PFDKECIQXXXXXXXXXXXXXAVIGRLMLLFQIITVFPLLVNILRTQFMYHLFKTSYP 1251
            K  SLVTIF I+NTMMG +I+S+PW I+QAG   G+ +++ +G LTLY    V+KS   +        E+ D C  Y G  G+ S+++ S+  L+ ++IVY+VL+ NFLF T  ++FN+I     +   + D    TN +NP                S     H +N      + ++     +  W ++ TVPF+++ ++ PL++ KS +F S+FN  GT+SV+YLI L+ FK ++ G HL+F         V      F  LTG+ +LAFFIHN I  ++ N  K ENNVRD+ IAY LV LTYL IGVL +  F   P  K+CI+ N L+N   +D+L+ I R+ LLFQ++TV+PLL  + R Q + H+F   YP
Sbjct:  116 KNTSLVTIFMIWNTMMGTSILSIPWGIKQAGFTTGMCVIILMGLLTLYCCYRVVKSRTMMFSLDTTSWEYPDVCRHYFGSFGQWSSLLFSLVSLIGAMIVYWVLMSNFLFNTGKFIFNFI-----HHINDTDTILSTNNSNP------------VICPSAGSGGHPDNSSMIFYANDTGAQQFEKWWDKSRTVPFYLVGLLLPLLNFKSPSFFSKFNILGTVSVLYLIFLVTFKAVRLGFHLEFHWFIPTEFFVPEIRFQFPQLTGVLTLAFFIHNCIITLLKNNKKQENNVRDLCIAYMLVTLTYLYIGVLVFASFPSPPLSKDCIEQNFLDNFPSSDTLSFIARIFLLFQMMTVYPLLGYLARVQLLGHIFGDIYP 476          
BLAST of slc38a-6 vs. TrEMBL
Match: A0A0H3YFB3 (Slc38a-6 OS=Schmidtea mediterranea OX=79327 GN=slc38a-6 PE=2 SV=1)

HSP 1 Score: 717.998 bits (1852), Expect = 0.000e+0
Identity = 409/409 (100.00%), Postives = 409/409 (100.00%), Query Frame = 1
Query:   28 MLNKVNENTSLINPILIKYEXXXXXXXXXXXXEINYPEKRGSLVTIFSIYNTMMGATIISMPWXXXXXXXXXXXXXXXXXXXXTLYTAILVLKSTNYIIRTRHCILEFSDACGFYLGRIGEISAIISSIFVLMSSLIVYYVLLCNFLFLTVLYVFNYIIDSPNYAFPENDFPTNTTNPQCFNWLNNSLTSYYVVSKDPLSHLNNVERYQISGNSSVVLLKALWSENLTVPFWVLIIIFPLISIKSATFVSRFNAFGTISVIYLIILIMFKFIKWGVHLDFANPRNHVTNFGNHFTALTGICSLAFFIHNAIHYIMSNQDKPENNVRDVSIAYSLVALTYLVIGVLFYIIFPFDKECIQXXXXXXXXXXXXXAVIGRLMLLFQIITVFPLLVNILRTQFMYHLFKTSYPR 1254
            MLNKVNENTSLINPILIKYESDSDSDRSRNSSEINYPEKRGSLVTIFSIYNTMMGATIISMPWAIQQAGLGLGILLLLFIGALTLYTAILVLKSTNYIIRTRHCILEFSDACGFYLGRIGEISAIISSIFVLMSSLIVYYVLLCNFLFLTVLYVFNYIIDSPNYAFPENDFPTNTTNPQCFNWLNNSLTSYYVVSKDPLSHLNNVERYQISGNSSVVLLKALWSENLTVPFWVLIIIFPLISIKSATFVSRFNAFGTISVIYLIILIMFKFIKWGVHLDFANPRNHVTNFGNHFTALTGICSLAFFIHNAIHYIMSNQDKPENNVRDVSIAYSLVALTYLVIGVLFYIIFPFDKECIQDNLLNNLSVNDSLAVIGRLMLLFQIITVFPLLVNILRTQFMYHLFKTSYPR
Sbjct:    1 MLNKVNENTSLINPILIKYESDSDSDRSRNSSEINYPEKRGSLVTIFSIYNTMMGATIISMPWAIQQAGLGLGILLLLFIGALTLYTAILVLKSTNYIIRTRHCILEFSDACGFYLGRIGEISAIISSIFVLMSSLIVYYVLLCNFLFLTVLYVFNYIIDSPNYAFPENDFPTNTTNPQCFNWLNNSLTSYYVVSKDPLSHLNNVERYQISGNSSVVLLKALWSENLTVPFWVLIIIFPLISIKSATFVSRFNAFGTISVIYLIILIMFKFIKWGVHLDFANPRNHVTNFGNHFTALTGICSLAFFIHNAIHYIMSNQDKPENNVRDVSIAYSLVALTYLVIGVLFYIIFPFDKECIQDNLLNNLSVNDSLAVIGRLMLLFQIITVFPLLVNILRTQFMYHLFKTSYPR 409          
BLAST of slc38a-6 vs. TrEMBL
Match: A0A0H3YJE4 (Slc38a-2 OS=Schmidtea mediterranea OX=79327 GN=slc38a-2 PE=2 SV=1)

HSP 1 Score: 276.944 bits (707), Expect = 2.282e-82
Identity = 194/372 (52.15%), Postives = 246/372 (66.13%), Query Frame = 1
Query:  136 PEKRGSLVTIFSIYNTMMGATIISMPWXXXXXXXXXXXXXXXXXXXXTLYTAILVLKSTNYII----RTRHCILEFSDACGFYLGRIGEISAIISSIFVLMSSLIVYYVLLCNFLFLTVLYVFNYIIDSPNY-AFPENDFPTNTTNPQCFNWLNNSLTSYYVVSKDPLSHLNNVER----YQISGNSSVVLLKALWSENLTVPFWVLIIIFPLISIKSATFVSRFNAFGTISVIYLIILIMFKFIKWGVHLDFANPR--NHVTNFGNHFTALTGICSLAFFIHNAIHYIMSNQDKPENNVRDVSIAYSLVALTYLVIGVLFYIIFPFDKECIQXXXXXXXXXXXXXAVIGRLMLLFQIITVFPLLVNILRTQ 1218
            P  + S VTIFSI+NTMMG +++SMPWAIQQ+G  LGI L++ +GAL  YTA LVL+S   +     RT     +FSDAC FYLG+ GEI +I+ S   L+S ++VYYVLLCNFL+ T+ Y+  +II+  N    P      N T+  C          Y V+    LS+ +  E       I  +SS  +   LWS+  TVPFW+LIII PL+SIKS TF ++FNA GTISV YL +L+  K +KWG+H+DF +    + + N    F  LTGI SLAFFIHNAIH I+ NQ KP+NNVRD+ IAY  VA+TYL IG+LFYI FPF K+CIQDNLLNNLS ND LA I R+ L FQ++TV PLL+ ILRTQ
Sbjct:  109 PGTQSSFVTIFSIWNTMMGTSLLSMPWAIQQSGFALGIFLMMLVGALAFYTAYLVLQSIEDLPLEPGRTAFNS-DFSDACRFYLGKTGEIVSIVFSFLALLSGMVVYYVLLCNFLYFTINYLHGFIINKMNLPQIPPITIYDNHTDVIC------PTIPYIVIHNTSLSNFSFYETLFLSGSIHSHSSNSIFGKLWSQTHTVPFWLLIIILPLVSIKSPTFFTKFNALGTISVAYLFLLVFIKVVKWGIHMDFNSTTYPSVIPNARGTFIVLTGIGSLAFFIHNAIHSIVRNQAKPQNNVRDLLIAYICVAITYLGIGILFYISFPFAKDCIQDNLLNNLSENDLLAFIARVSLFFQMLTVLPLLMYILRTQ 473          
BLAST of slc38a-6 vs. TrEMBL
Match: V4ALV4 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_227847 PE=4 SV=1)

HSP 1 Score: 260.766 bits (665), Expect = 2.631e-76
Identity = 162/375 (43.20%), Postives = 248/375 (66.13%), Query Frame = 1
Query:  142 KRGSLVTIFSIYNTMMGATIISMPWXXXXXXXXXXXXXXXXXXXXTLYTAILVLKSTNYIIRTRHCILEFSDACGFYLGRIGEISAIISSIFVLMSSLIVYYVLLCNFLFLTVLYVFNYIIDSPNYAFPENDFP-TNTTNPQCFNWLNNSLTSYYVVSKDPLSHLNNVERYQISGNSSVVLLKALWSENLTVPFWVLIIIFPLISIKSATFVSRFNAFGTISVIYLIILIMFKFIKWGVHLDFANPRNHV----TNFGNHFTALTGICSLAFFIHNAIHYIMSNQDKPENNVRDVSIAYSLVALTYLVIGVLFYIIFPFDKECIQXXXXXXXXXXXXXAVIGRLMLLFQIITVFPLLVNILRTQFMYHLFKTSYP 1251
            K+ S++TIFS++NTMMG +++SMPWAI+QAG   GI LL+F+  L LYT+  +L++   +      +LEFSD C FY G++GEI+A++ S+  L+  +IVY++L+ NF++  V +++ +   S N +  EN    ++   P+     +N+  +Y     D LS L N   + I+      + + +WSE  TVPF++L+++ P+I+ KS TF ++FNA GT SV YL +    K  KWG+H+DF++   H+    +NFG  F ALTGI SLA+FIHNA+  I +N+  P+N+ RD++IAY LVA+TY+ +G +FY  FP +K CI+DNLLNN+  ND +A + R+ L FQ++ VFPLLV ILR QFM+ +F + +P
Sbjct:  106 KQSSIITIFSLWNTMMGTSLLSMPWAIKQAGFITGIGLLIFVAGLMLYTSYRILRAVEVLRAENVDVLEFSDVCKFYFGKVGEITALVCSLMSLIGGMIVYWILMSNFIYHVVSFIYYHADGSFNSSTIENKSAYSDAMCPKANPLPDNNTNTY----PDLLSVLGN---FPIANP----VFEEVWSETKTVPFFLLLVLAPIINFKSPTFFTKFNALGTCSVAYLFVFAAVKAAKWGIHIDFSSADQHLPDYTSNFGWTFPALTGIASLAYFIHNAVLSITANERNPKNSARDLTIAYVLVAITYIYMGAVFYSSFPLNKSCIEDNLLNNIETNDVMAFVARIGLFFQMVCVFPLLVFILRVQFMHSVFGSVWP 469          
BLAST of slc38a-6 vs. TrEMBL
Match: A0A1S3KA10 (sodium-coupled neutral amino acid transporter 9 isoform X2 OS=Lingula unguis OX=7574 GN=LOC106180120 PE=4 SV=1)

HSP 1 Score: 258.07 bits (658), Expect = 4.379e-75
Identity = 166/383 (43.34%), Postives = 238/383 (62.14%), Query Frame = 1
Query:  142 KRGSLVTIFSIYNTMMGATIISMPWXXXXXXXXXXXXXXXXXXXXTLYTAILVLKSTNYIIRTRHCILEFSDACGFYLGRIGEISAIISSIFVLMSSLIVYYVLLCNFLFLTVLYVFNYIIDSPNYAFPENDFPTNTTNPQCFNWLNNSLTSYYVVSKDPLSHLNNVERYQISGN---------SSVVLLKALWSENLTVPFWVLIIIFPLISIKSATFVSRFNAFGTISVIYLIILIMFKFIKWGVHLDFANPRNH----VTNFGNHFTALTGICSLAFFIHNAIHYIMSNQDKPENNVRDVSIAYSLVALTYLVIGVLFYIIFPFDKECIQXXXXXXXXXXXXXAVIGRLMLLFQIITVFPLLVNILRTQFMYHLFKTSYP 1251
            K+ S++TIFSI+NTMMG +++SMPW + ++G G GI +++ +G LTLYT+  V+KS  YI +T+  ILEFSD C  +LG+ GE SA+  S+  L+ ++IVY+VL+ NFL+ TV ++F   +  P          +N T+    +      T Y+        H++N   Y +S N         S       +W +  TVPF+++I++FPL++ KS TF ++FNA GTISV+YL++ + +K  +WG HL+F  P       V  F   F  LTGI +LAFFIHN +  I+ NQ  PENN RD+SIAY  V +TYL++GVLFY  FP  K+CI DNLL+N   ND LA   R+ LLFQ+ TVFPL+  ++R QFM+ +F   YP
Sbjct:  138 KQSSIITIFSIWNTMMGTSLLSMPWGLGESGFGCGIGIIVVMGILTLYTSYRVMKSVGYI-QTKGEILEFSDVCKKFLGKWGEYSAVFFSLAALLGAMIVYWVLMSNFLYNTVRFIFG--LSHPL---------SNHTSAPSIDGTTLCATPYH-------GHISNSTTYHLSQNGLLLSTGLQSETDTFNEVWDQRKTVPFFLIILLFPLVNFKSPTFFTKFNALGTISVLYLLVFVTYKVSQWGFHLNFDPPPAMKDFLVPQFLPSFPNLTGILALAFFIHNCVLTILRNQKNPENNSRDLSIAYFCVGVTYLLVGVLFYAGFPLPKKCIADNLLDNFGHNDILAFAARIFLLFQMTTVFPLITYMIRLQFMHAVFGNIYP 501          
BLAST of slc38a-6 vs. TrEMBL
Match: A0A1S3KAJ6 (sodium-coupled neutral amino acid transporter 9 isoform X1 OS=Lingula unguis OX=7574 GN=LOC106180120 PE=4 SV=1)

HSP 1 Score: 258.07 bits (658), Expect = 4.752e-75
Identity = 166/383 (43.34%), Postives = 238/383 (62.14%), Query Frame = 1
Query:  142 KRGSLVTIFSIYNTMMGATIISMPWXXXXXXXXXXXXXXXXXXXXTLYTAILVLKSTNYIIRTRHCILEFSDACGFYLGRIGEISAIISSIFVLMSSLIVYYVLLCNFLFLTVLYVFNYIIDSPNYAFPENDFPTNTTNPQCFNWLNNSLTSYYVVSKDPLSHLNNVERYQISGN---------SSVVLLKALWSENLTVPFWVLIIIFPLISIKSATFVSRFNAFGTISVIYLIILIMFKFIKWGVHLDFANPRNH----VTNFGNHFTALTGICSLAFFIHNAIHYIMSNQDKPENNVRDVSIAYSLVALTYLVIGVLFYIIFPFDKECIQXXXXXXXXXXXXXAVIGRLMLLFQIITVFPLLVNILRTQFMYHLFKTSYP 1251
            K+ S++TIFSI+NTMMG +++SMPW + ++G G GI +++ +G LTLYT+  V+KS  YI +T+  ILEFSD C  +LG+ GE SA+  S+  L+ ++IVY+VL+ NFL+ TV ++F   +  P          +N T+    +      T Y+        H++N   Y +S N         S       +W +  TVPF+++I++FPL++ KS TF ++FNA GTISV+YL++ + +K  +WG HL+F  P       V  F   F  LTGI +LAFFIHN +  I+ NQ  PENN RD+SIAY  V +TYL++GVLFY  FP  K+CI DNLL+N   ND LA   R+ LLFQ+ TVFPL+  ++R QFM+ +F   YP
Sbjct:  142 KQSSIITIFSIWNTMMGTSLLSMPWGLGESGFGCGIGIIVVMGILTLYTSYRVMKSVGYI-QTKGEILEFSDVCKKFLGKWGEYSAVFFSLAALLGAMIVYWVLMSNFLYNTVRFIFG--LSHPL---------SNHTSAPSIDGTTLCATPYH-------GHISNSTTYHLSQNGLLLSTGLQSETDTFNEVWDQRKTVPFFLIILLFPLVNFKSPTFFTKFNALGTISVLYLLVFVTYKVSQWGFHLNFDPPPAMKDFLVPQFLPSFPNLTGILALAFFIHNCVLTILRNQKNPENNSRDLSIAYFCVGVTYLLVGVLFYAGFPLPKKCIADNLLDNFGHNDILAFAARIFLLFQMTTVFPLITYMIRLQFMHAVFGNIYP 505          
BLAST of slc38a-6 vs. Ensembl Cavefish
Match: slc38a9 (solute carrier family 38 member 9 [Source:NCBI gene;Acc:103041902])

HSP 1 Score: 202.216 bits (513), Expect = 8.515e-58
Identity = 152/376 (40.43%), Postives = 225/376 (59.84%), Query Frame = 1
Query:  142 KRGSLVTIFSIYNTMMGATIISMPWXXXXXXXXXXXXXXXXXXXXTLYTAILVLKSTNYIIRTRHCILEFSDACGFYLGRIGEISAIISSIFVLMSSLIVYYVLLCNFLFLTVLYVFNYIIDSPNYAFPENDFPTNTTNPQCFNWLNNSLTSYYVVSKDPLSHLNNVERYQISGNSSVVLLKALWSENLTVPFWVLIIIFPLISIKSATFVSRFNAFGTISVIYLIILIMFKFIKWGVHLD---FANPRNHVTNFGNHFTALTGICSLAFFIHNAIHYIMSNQDKPENNVRDVSIAYSLVALTYLVIGVLFYIIF---PFDKECIQXXXXXXXXXXXXXAVIGRLMLLFQIITVFPLLVNILRTQFMYHLFKTSYP 1251
            K  S+VTIF+I+NTMMG +I+S+PW I+QAG  LGI++++ +G LTLY    VLKST  I        EF D C +Y G  G+ S+++ S+  L+ +++VY+VL+ NFLF T  +++NY+    N    +++F TN T+     + +           +P  + +  +    S NS+ V     WS+  T+PF+++I++ PL++ +SA+F +RF   GTISVIYLI L+  K ++ G HL+   F +    V  F   F  LTG+ +LAFFIHN +  +M N    ENNVRD+S+AY LV LTYL +GVL +  F   P  KEC++ N L+N   +D    + R  LLFQ+ TV+PLL  ++R Q M  LF   YP
Sbjct:  107 KNPSIVTIFAIWNTMMGTSILSIPWGIKQAGFTLGIIIVILMGLLTLYCCYRVLKSTKSIPYIDTSDWEFPDVCKYYFGAFGQWSSLLFSLVSLIGAMVVYWVLMSNFLFNTGKFIYNYV---HNVNMSDSEFGTNGTDRVVCPYPD----------LNPHRNSSLDQYSSSSDNSTAVF-DHWWSKTNTIPFYLIILLLPLLNFRSASFFARFTFLGTISVIYLITLVTIKAVRLGFHLEFHWFHSTEFFVPEFRLLFPQLTGVLTLAFFIHNCVITLMKNNKNQENNVRDLSLAYLLVGLTYLYVGVLIFAAFPSPPLSKECLEPNFLDNFPSSDIWVFVARTFLLFQMTTVYPLLGYLVRVQLMSQLFGDHYP 468          
BLAST of slc38a-6 vs. Ensembl Cavefish
Match: slc38a9 (solute carrier family 38 member 9 [Source:NCBI gene;Acc:103041902])

HSP 1 Score: 117.472 bits (293), Expect = 5.185e-28
Identity = 73/160 (45.62%), Postives = 96/160 (60.00%), Query Frame = 1
Query:  790 FGTISVIYLIILIMFKFIKWGVHLDFA---NPRNHVTNFGNHFTALTGICSLAFFIHNAIHYIMSNQDKPENNVRDVSIAYSLVALTYLVIGVLFYIIF---PFDKECIQXXXXXXXXXXXXXAVIGRLMLLFQIITVFPLLVNILRTQFMYHLFKTSYP 1251
            + TISVIYLI L+  K ++ G HL+F    +    V  F   F  LTG+ +LAFFIHN +  +M N    ENNVRD+S+AY LV LTYL +GVL +  F   P  KEC++ N L+N   +D    + R  LLFQ+ TV+PLL  ++R Q M  LF   YP
Sbjct:  214 YSTISVIYLITLVTIKAVRLGFHLEFHWFHSTEFFVPEFRLLFPQLTGVLTLAFFIHNCVITLMKNNKNQENNVRDLSLAYLLVGLTYLYVGVLIFAAFPSPPLSKECLEPNFLDNFPSSDIWVFVARTFLLFQMTTVYPLLGYLVRVQLMSQLFGDHYP 373          

HSP 2 Score: 73.559 bits (179), Expect = 1.488e-13
Identity = 54/120 (45.00%), Postives = 82/120 (68.33%), Query Frame = 1
Query:  142 KRGSLVTIFSIYNTMMGATIISMPWXXXXXXXXXXXXXXXXXXXXTLYTAILVLKSTNYIIRTRHCILEFSDACGFYLGRIGEISAIISSIFVLMSSLIVYYVLLCNFLFLTVLYVFNYI 501
            K  S+VTIF+I+NTMMG +I+S+PW I+QAG  LGI++++ +G LTLY    VLKST  I        EF D C +Y G  G+ S+++ S+  L+ +++VY+VL+ NFLF T  ++++ I
Sbjct:   98 KNPSIVTIFAIWNTMMGTSILSIPWGIKQAGFTLGIIIVILMGLLTLYCCYRVLKSTKSIPYIDTSDWEFPDVCKYYFGAFGQWSSLLFSLVSLIGAMVVYWVLMSNFLFNTGKFIYSTI 217          
BLAST of slc38a-6 vs. Ensembl Sea Lamprey
Match: slc38a9 (solute carrier family 38 member 9 [Source:NCBI gene;Acc:562137])

HSP 1 Score: 208.764 bits (530), Expect = 3.108e-61
Identity = 148/377 (39.26%), Postives = 226/377 (59.95%), Query Frame = 1
Query:  142 KRGSLVTIFSIYNTMMGATIISMPWXXXXXXXXXXXXXXXXXXXXTLYTAILVLKSTNYIIRTRHCILEFSDACGFYLGRIGEISAIISSIFVLMSSLIVYYVLLCNFLFLTVLYVFNYIIDSPNYAFPENDFPTNTTNPQCFNWLNNSLTSYYVVSKDPLSHLNNVERYQISGNSSVVLLKALWSENLTVPFWVLIIIFPLISIKSATFVSRFNAFGTISVIYLIILIMFKFIKWGVHLDF----ANPRNHVTNFGNHFTALTGICSLAFFIHNAIHYIMSNQDKPENNVRDVSIAYSLVALTYLVIGVLFYIIFPFD---KECIQXXXXXXXXXXXXXAVIGRLMLLFQIITVFPLLVNILRTQFMYHLFKTSYP 1251
            K+ SLVTIF+I+NTMMG +I+S+PWA+ QAG  LGI+++  +G +TLY+   +L+S   I       ++F   CG Y GR+G+  +++ S+  L  +LIVY+VL+ NF++ T  ++++    +      +N   TN ++P         + +  V    P + L          N S     A WS+  TVP +++ ++ PL++ +SA F +RFN  GT+SV+YL+IL+  K  +WG+HLDF     + R+ V  F   F A+TGI +LAFF+HN +  ++ N   PENNVRD+SIAY LV  TYL +G+L +  FP     K CIQ+N L+NL  +D +A++ R+ LLFQ+ TVFP+L  I R Q    ++  SYP
Sbjct:   84 KQPSLVTIFAIWNTMMGTSILSIPWAMMQAGFTLGIIIIFLMGLITLYSCYRILQSPKAIDGGED--MDFPQVCGHYFGRLGQWISLLFSLVSLAGALIVYWVLMSNFMYNTGRFIYD---KACGINMTDNIPRTNGSHP---------VLAPGVFEGPPEAGLRGPT------NGSFETFNAFWSQTNTVPLYLVPLLLPLLNFRSAAFFARFNNLGTVSVVYLLILVTVKASQWGIHLDFHWISTSDRHFVPEFRQFFPAMTGILTLAFFLHNCVITLVKNNRHPENNVRDLSIAYGLVGFTYLYVGILVFASFPSPPLWKSCIQENFLDNLPNDDIMALLARVFLLFQMSTVFPMLAYIFRVQIFTQIWGKSYP 440          
BLAST of slc38a-6 vs. Ensembl Nematostella
Match: EDO34495 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SP81])

HSP 1 Score: 226.868 bits (577), Expect = 3.620e-68
Identity = 158/374 (42.25%), Postives = 221/374 (59.09%), Query Frame = 1
Query:  136 PE-KRGSLVTIFSIYNTMMGATIISMPWXXXXXXXXXXXXXXXXXXXXTLYTAILVLKSTNYIIRT-RHCILEFSDACGFYLGRIGEISAIISSIFVLMSSLIVYYVLLCNFLFLTVLYVFNYIIDSPNYAFPENDFPTNTTNPQCFNWLNNSLTSYYVVSKDPLSHLNNVERYQISGNSSVVLLKALWSENLTVPFWVLIIIFPLISIKSATFVSRFNAFGTISVIYLIILIMFKFIKWGVHLDFANPRNHVTNFGNHFTALTGICSLAFFIHNAIHYIMSNQDKPENNVRDVSIAYSLVALTYLVIGVLFYIIFPFDKECIQXXXXXXXXXXXXXAVIGRLMLLFQIITVFPLLVNILRTQFMYHLFKTSYP 1251
            PE K+ SLVTIF+I+NTMMG +++SMPWA+ QAG G GI L++ I  L LYT  LVLKS+       +   ++F+D C  Y GR GE+ A I SI  +  + +V++VL+ NFLF +  ++   I D    AFP+N      T       ++ SL         P+   NN     +  NS        W    T+PF+++ ++FPL S+KS TF ++FN+ GT++VIY+II +  K   WG+++DFA     +  F   F ALTG  +LAFFIHN I  I+S+Q  PE N RD+SIAY LVA TY  +G LFY  FP +K CI    L+N+  ND +    R+ L FQ++TVFPL++ I+R QFM   F + YP
Sbjct:   52 PEAKQSSLVTIFAIWNTMMGTSLLSMPWALSQAGFGCGIGLMVGIAGLCLYTCYLVLKSSYPFGELFKSGFIKFADICRKYFGRTGELVATIFSIAAIAGAAVVFWVLMSNFLFNSGKFIHESIYD----AFPKNMSKLEGTV------IHTSLIC-------PVPSANNTSPNTMP-NSDTTGFYRYWQGQKTIPFFLIALMFPLCSVKSPTFFTKFNSLGTLAVIYIIIFVSIKASIWGINMDFAK----IPEFQLTFPALTGTLTLAFFIHNCILSILSHQKTPEYNARDLSIAYGLVAFTYTFVGALFYAAFPLEKSCIHQVFLDNMPANDIMTFGARIGLFFQLVTVFPLVIYIVRVQFMLFFFGSPYP 403          
BLAST of slc38a-6 vs. Ensembl Medaka
Match: slc38a9 (solute carrier family 38 member 9 [Source:NCBI gene;Acc:110014194])

HSP 1 Score: 188.348 bits (477), Expect = 1.087e-52
Identity = 149/383 (38.90%), Postives = 227/383 (59.27%), Query Frame = 1
Query:  124 EINYPEKRGSLVTIFSIYNTMMGATIISMPWXXXXXXXXXXXXXXXXXXXXTLYTAILVLKSTNYIIRTRHCILEFSDACGFYLGRIGEISAIISSIFVLMSSLIVYYVLLCNFLFLTVLYVFNYIIDSPNYAFPENDFPTNTTNPQCFNWLNNSLTSYYVVSKDPLSHLNNVERYQISGNS-SVVLLKALWSENLTVPFWVLIIIFPLISIKSATFVSRFNAFGTISVIYLIILIMFKFIKWGVHLDFA--NPRN-HVTNFGNHFTALTGICSLAFFIHNAIHYIMSNQDKPENNVRDVSIAYSLVALTYLVIGVLFYIIFPFD---KECIQXXXXXXXXXXXXXAVIGRLMLLFQIITVFPLLVNILRTQFMYHLFKTSYP 1251
            E +   K  SL++IF+I+NTMMG +I+S+PW I+QAG  LG+++L+  G LTLY   +VLKS   I        EF D C  Y G+ G+ S+++ S+  L+ +++VY+VL+ NFLF T  +++N    + N    ++ F  N ++               V+   P+ H    +     G++ + +     WS+  TVP ++++++ PL+S +SA+F +RF   GTISV+YLI+L+  K ++ G HL+F   +P + +V  F   F  LTG+ +LAFFIHN I  +M N    ENNVRD+S+AY LV LTYL +GVL +  FP     K+CIQ N L+N   ND L  + R+ LLFQ++TV+P+L  ++R Q M   F   YP
Sbjct:  101 EGDQTSKNSSLISIFAIWNTMMGTSILSIPWGIKQAGFTLGVVILVLTGLLTLYCCYIVLKSPRTIKSVDTTDWEFPDVCRHYFGKFGQWSSLLFSLVSLLGAMVVYWVLMSNFLFNTGQFIYN---QAHNINVSDSQFGNNGSD--------------QVICPYPVIHPEGDDCGSGGGDAGNDISFGRYWSKTNTVPLYLIVLLLPLLSFRSASFFARFTFLGTISVVYLIVLVTIKAVRLGFHLEFHWFDPTHFYVPEFRALFPQLTGVLTLAFFIHNCIITLMKNNKHQENNVRDLSVAYLLVGLTYLYVGVLIFGSFPSPPLVKDCIQPNFLDNFPSNDVLVFVARMCLLFQMVTVYPMLGYLVRVQVMGQFFGNHYP 466          
BLAST of slc38a-6 vs. Ensembl Medaka
Match: slc38a9 (solute carrier family 38 member 9 [Source:NCBI gene;Acc:110014194])

HSP 1 Score: 188.348 bits (477), Expect = 1.087e-52
Identity = 149/383 (38.90%), Postives = 227/383 (59.27%), Query Frame = 1
Query:  124 EINYPEKRGSLVTIFSIYNTMMGATIISMPWXXXXXXXXXXXXXXXXXXXXTLYTAILVLKSTNYIIRTRHCILEFSDACGFYLGRIGEISAIISSIFVLMSSLIVYYVLLCNFLFLTVLYVFNYIIDSPNYAFPENDFPTNTTNPQCFNWLNNSLTSYYVVSKDPLSHLNNVERYQISGNS-SVVLLKALWSENLTVPFWVLIIIFPLISIKSATFVSRFNAFGTISVIYLIILIMFKFIKWGVHLDFA--NPRN-HVTNFGNHFTALTGICSLAFFIHNAIHYIMSNQDKPENNVRDVSIAYSLVALTYLVIGVLFYIIFPFD---KECIQXXXXXXXXXXXXXAVIGRLMLLFQIITVFPLLVNILRTQFMYHLFKTSYP 1251
            E +   K  SL++IF+I+NTMMG +I+S+PW I+QAG  LG+++L+  G LTLY   +VLKS   I        EF D C  Y G+ G+ S+++ S+  L+ +++VY+VL+ NFLF T  +++N    + N    ++ F  N ++               V+   P+ H    +     G++ + +     WS+  TVP ++++++ PL+S +SA+F +RF   GTISV+YLI+L+  K ++ G HL+F   +P + +V  F   F  LTG+ +LAFFIHN I  +M N    ENNVRD+S+AY LV LTYL +GVL +  FP     K+CIQ N L+N   ND L  + R+ LLFQ++TV+P+L  ++R Q M   F   YP
Sbjct:  101 EGDQTSKNSSLISIFAIWNTMMGTSILSIPWGIKQAGFTLGVVILVLTGLLTLYCCYIVLKSPRTIKSVDTTDWEFPDVCRHYFGKFGQWSSLLFSLVSLLGAMVVYWVLMSNFLFNTGQFIYN---QAHNINVSDSQFGNNGSD--------------QVICPYPVIHPEGDDCGSGGGDAGNDISFGRYWSKTNTVPLYLIVLLLPLLSFRSASFFARFTFLGTISVVYLIVLVTIKAVRLGFHLEFHWFDPTHFYVPEFRALFPQLTGVLTLAFFIHNCIITLMKNNKHQENNVRDLSVAYLLVGLTYLYVGVLIFGSFPSPPLVKDCIQPNFLDNFPSNDVLVFVARMCLLFQMVTVYPMLGYLVRVQVMGQFFGNHYP 466          
BLAST of slc38a-6 vs. Ensembl Medaka
Match: slc38a9 (solute carrier family 38 member 9 [Source:NCBI gene;Acc:110014194])

HSP 1 Score: 179.489 bits (454), Expect = 9.284e-50
Identity = 149/382 (39.01%), Postives = 220/382 (57.59%), Query Frame = 1
Query:  124 EINYPEKRGSLVTIFSIYNTMMGATIISMPWXXXXXXXXXXXXXXXXXXXXTLYTAILVLKSTNYIIRTRHCILEFSDACGFYLGRIGEISAIISSIFVLMSSLIVYYVLLCNFLFLTVLYVFNYIIDSPNYAFPENDFPTNTTNPQCFNWLNNSLTSYYVVSKDPLSHLNNVERYQISGNSSVVLLKALWSENLTVPFWVLIIIFPLISIKSATFVSRFNAFGTISVIYLIILIMFKFIKWGVHLDFA--NPRN-HVTNFGNHFTALTGICSLAFFIHNAIHYIMSNQDKPENNVRDVSIAYSLVALTYLVIGVLFYIIF---PFDKECIQXXXXXXXXXXXXXAVIGRLMLLFQIITVFPLLVNILRTQFMYHLFKTSYP 1251
            E +   K  SL++IF+I+NTMMG +I+S+PW I+QAG  LG+++L+  G LTLY   +VLKS   I        EF D C  Y G+ G+ S+++ S+  L+ +++VY+VL+ NFLF T  ++  YII            P    +P+  +  +    +   +S           RY              WS+  TVP ++++++ PL+S +SA+F +RF   GTISV+YLI+L+  K ++ G HL+F   +P + +V  F   F  LTG+ +LAFFIHN I  +M N    ENNVRD+S+AY LV LTYL +GVL +  F   P  K+CIQ N L+N   ND L  + R+ LLFQ++TV+P+L  ++R Q M   F   YP
Sbjct:   79 EGDQTSKNSSLISIFAIWNTMMGTSILSIPWGIKQAGFTLGVVILVLTGLLTLYCCYIVLKSPRTIKSVDTTDWEFPDVCRHYFGKFGQWSSLLFSLVSLLGAMVVYWVLMSNFLFNTGQFI--YII-----------CPYPVIHPEGDDCGSGGGDAGNDIS---------FGRY--------------WSKTNTVPLYLIVLLLPLLSFRSASFFARFTFLGTISVVYLIVLVTIKAVRLGFHLEFHWFDPTHFYVPEFRALFPQLTGVLTLAFFIHNCIITLMKNNKHQENNVRDLSVAYLLVGLTYLYVGVLIFGSFPSPPLVKDCIQPNFLDNFPSNDVLVFVARMCLLFQMVTVYPMLGYLVRVQVMGQFFGNHYP 424          
BLAST of slc38a-6 vs. Planmine SMEST
Match: SMESG000016671.1 (SMESG000016671.1)

HSP 1 Score: 711.449 bits (1835), Expect = 0.000e+0
Identity = 405/408 (99.26%), Postives = 406/408 (99.51%), Query Frame = 1
Query:   28 MLNKVNENTSLINPILIKYEXXXXXXXXXXXXEINYPEKRGSLVTIFSIYNTMMGATIISMPWXXXXXXXXXXXXXXXXXXXXTLYTAILVLKSTNYIIRTRHCILEFSDACGFYLGRIGEISAIISSIFVLMSSLIVYYVLLCNFLFLTVLYVFNYIIDSPNYAFPENDFPTNTTNPQCFNWLNNSLTSYYVVSKDPLSHLNNVERYQISGNSSVVLLKALWSENLTVPFWVLIIIFPLISIKSATFVSRFNAFGTISVIYLIILIMFKFIKWGVHLDFANPRNHVTNFGNHFTALTGICSLAFFIHNAIHYIMSNQDKPENNVRDVSIAYSLVALTYLVIGVLFYIIFPFDKECIQXXXXXXXXXXXXXAVIGRLMLLFQIITVFPLLVNILRTQFMYHLFKTSYP 1251
            MLNKVNENTSLINPILIKYESDSDSDRSRNSSEINYPEKRGSLVTIFSIYNTMMGATIISMPWAIQQAGLGLGILLLLFIGALTLYTAILVLKSTNYIIRTR CILEFSDACGFYLGRIGEISAIISSIFVLMSSLIVYYVLLCNFLFLTVLYVFNYIIDSPNYAFPENDFPTNTTNPQCFNWLNNSLTSYYVVSKDPLSHLNN+ERYQ SGNSSVVLLKALWSENLTVPFWVLIIIFPLISIKSATFVSRFNAFGTISVIYLIILIMFKFIKWGVHLDFANPRNHVTNFGNHFTALTGICSLAFFIHNAIHYIMSNQDKPENNVRDVSIAYSLVALTYLVIGVLFYIIFPFDKECIQDNLLNNLSVNDSLAVIGRLMLLFQIITVFPLLVNILRTQFMYHLFKTSYP
Sbjct:    1 MLNKVNENTSLINPILIKYESDSDSDRSRNSSEINYPEKRGSLVTIFSIYNTMMGATIISMPWAIQQAGLGLGILLLLFIGALTLYTAILVLKSTNYIIRTRQCILEFSDACGFYLGRIGEISAIISSIFVLMSSLIVYYVLLCNFLFLTVLYVFNYIIDSPNYAFPENDFPTNTTNPQCFNWLNNSLTSYYVVSKDPLSHLNNIERYQTSGNSSVVLLKALWSENLTVPFWVLIIIFPLISIKSATFVSRFNAFGTISVIYLIILIMFKFIKWGVHLDFANPRNHVTNFGNHFTALTGICSLAFFIHNAIHYIMSNQDKPENNVRDVSIAYSLVALTYLVIGVLFYIIFPFDKECIQDNLLNNLSVNDSLAVIGRLMLLFQIITVFPLLVNILRTQFMYHLFKTSYP 408          
BLAST of slc38a-6 vs. Planmine SMEST
Match: SMESG000016671.1 (SMESG000016671.1)

HSP 1 Score: 397.127 bits (1019), Expect = 7.715e-136
Identity = 210/212 (99.06%), Postives = 211/212 (99.53%), Query Frame = 1
Query:  616 DPLSHLNNVERYQISGNSSVVLLKALWSENLTVPFWVLIIIFPLISIKSATFVSRFNAFGTISVIYLIILIMFKFIKWGVHLDFANPRNHVTNFGNHFTALTGICSLAFFIHNAIHYIMSNQDKPENNVRDVSIAYSLVALTYLVIGVLFYIIFPFDKECIQXXXXXXXXXXXXXAVIGRLMLLFQIITVFPLLVNILRTQFMYHLFKTSYP 1251
            DPLSHLNN+ERYQ SGNSSVVLLKALWSENLTVPFWVLIIIFPLISIKSATFVSRFNAFGTISVIYLIILIMFKFIKWGVHLDFANPRNHVTNFGNHFTALTGICSLAFFIHNAIHYIMSNQDKPENNVRDVSIAYSLVALTYLVIGVLFYIIFPFDKECIQDNLLNNLSVNDSLAVIGRLMLLFQIITVFPLLVNILRTQFMYHLFKTSYP
Sbjct:   36 DPLSHLNNIERYQTSGNSSVVLLKALWSENLTVPFWVLIIIFPLISIKSATFVSRFNAFGTISVIYLIILIMFKFIKWGVHLDFANPRNHVTNFGNHFTALTGICSLAFFIHNAIHYIMSNQDKPENNVRDVSIAYSLVALTYLVIGVLFYIIFPFDKECIQDNLLNNLSVNDSLAVIGRLMLLFQIITVFPLLVNILRTQFMYHLFKTSYP 247          
BLAST of slc38a-6 vs. Planmine SMEST
Match: SMESG000016671.1 (SMESG000016671.1)

HSP 1 Score: 396.356 bits (1017), Expect = 9.470e-136
Identity = 210/212 (99.06%), Postives = 211/212 (99.53%), Query Frame = 1
Query:  616 DPLSHLNNVERYQISGNSSVVLLKALWSENLTVPFWVLIIIFPLISIKSATFVSRFNAFGTISVIYLIILIMFKFIKWGVHLDFANPRNHVTNFGNHFTALTGICSLAFFIHNAIHYIMSNQDKPENNVRDVSIAYSLVALTYLVIGVLFYIIFPFDKECIQXXXXXXXXXXXXXAVIGRLMLLFQIITVFPLLVNILRTQFMYHLFKTSYP 1251
            DPLSHLNN+ERYQ SGNSSVVLLKALWSENLTVPFWVLIIIFPLISIKSATFVSRFNAFGTISVIYLIILIMFKFIKWGVHLDFANPRNHVTNFGNHFTALTGICSLAFFIHNAIHYIMSNQDKPENNVRDVSIAYSLVALTYLVIGVLFYIIFPFDKECIQDNLLNNLSVNDSLAVIGRLMLLFQIITVFPLLVNILRTQFMYHLFKTSYP
Sbjct:   20 DPLSHLNNIERYQTSGNSSVVLLKALWSENLTVPFWVLIIIFPLISIKSATFVSRFNAFGTISVIYLIILIMFKFIKWGVHLDFANPRNHVTNFGNHFTALTGICSLAFFIHNAIHYIMSNQDKPENNVRDVSIAYSLVALTYLVIGVLFYIIFPFDKECIQDNLLNNLSVNDSLAVIGRLMLLFQIITVFPLLVNILRTQFMYHLFKTSYP 231          
BLAST of slc38a-6 vs. Planmine SMEST
Match: SMESG000016959.1 (SMESG000016959.1)

HSP 1 Score: 276.944 bits (707), Expect = 6.347e-86
Identity = 194/372 (52.15%), Postives = 246/372 (66.13%), Query Frame = 1
Query:  136 PEKRGSLVTIFSIYNTMMGATIISMPWXXXXXXXXXXXXXXXXXXXXTLYTAILVLKSTNYII----RTRHCILEFSDACGFYLGRIGEISAIISSIFVLMSSLIVYYVLLCNFLFLTVLYVFNYIIDSPNY-AFPENDFPTNTTNPQCFNWLNNSLTSYYVVSKDPLSHLNNVER----YQISGNSSVVLLKALWSENLTVPFWVLIIIFPLISIKSATFVSRFNAFGTISVIYLIILIMFKFIKWGVHLDFANPR--NHVTNFGNHFTALTGICSLAFFIHNAIHYIMSNQDKPENNVRDVSIAYSLVALTYLVIGVLFYIIFPFDKECIQXXXXXXXXXXXXXAVIGRLMLLFQIITVFPLLVNILRTQ 1218
            P  + S VTIFSI+NTMMG +++SMPWAIQQ+G  LGI L++ +GAL  YTA LVL+S   +     RT     +FSDAC FYLG+ GEI +I+ S   L+S ++VYYVLLCNFL+ T+ Y+  +II+  N    P      N T+  C          Y V+    LS+ +  E       I  +SS  +   LWS+  TVPFW+LIII PL+SIKS TF ++FNA GTISV YL +L+  K +KWG+H+DF +    + + N    F  LTGI SLAFFIHNAIH I+ NQ KP+NNVRD+ IAY  VA+TYL IG+LFYI FPF K+CIQDNLLNNLS ND LA I R+ L FQ++TV PLL+ ILRTQ
Sbjct:  109 PGTQSSFVTIFSIWNTMMGTSLLSMPWAIQQSGFALGIFLMMLVGALAFYTAYLVLQSIEDLPLEPGRTAFNS-DFSDACRFYLGKTGEIVSIVFSFLALLSGMVVYYVLLCNFLYFTINYLHGFIINKMNLPQIPPITIYENHTDVIC------PTIPYIVIHNTSLSNFSIYETLFLSGSIHSHSSNSIFGKLWSQTHTVPFWLLIIILPLVSIKSPTFFTKFNALGTISVAYLFLLVFIKVVKWGIHMDFNSTTYPSVIPNARGTFIVLTGIGSLAFFIHNAIHSIVRNQAKPQNNVRDLLIAYICVAITYLGIGILFYISFPFAKDCIQDNLLNNLSENDLLAFIARVSLFFQMLTVLPLLMYILRTQ 473          
The following BLAST results are available for this feature:
BLAST of slc38a-6 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC38A92.084e-5739.15solute carrier family 38 member 9 [Source:HGNC Sym... [more]
SLC38A95.143e-5739.15solute carrier family 38 member 9 [Source:HGNC Sym... [more]
SLC38A95.143e-5739.15solute carrier family 38 member 9 [Source:HGNC Sym... [more]
SLC38A95.311e-5438.32solute carrier family 38 member 9 [Source:HGNC Sym... [more]
SLC38A95.838e-4838.41solute carrier family 38 member 9 [Source:HGNC Sym... [more]
back to top
BLAST of slc38a-6 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
F13H10.32.780e-6941.47Sodium-coupled neutral amino acid transporter 9 ho... [more]
F13H10.32.780e-6941.47Sodium-coupled neutral amino acid transporter 9 ho... [more]
F13H10.32.837e-6941.47Sodium-coupled neutral amino acid transporter 9 ho... [more]
F13H10.32.837e-6941.47Sodium-coupled neutral amino acid transporter 9 ho... [more]
F13H10.35.060e-6941.47Sodium-coupled neutral amino acid transporter 9 ho... [more]
back to top
BLAST of slc38a-6 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc38a-6 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
slc38a91.442e-6341.05solute carrier family 38 member 9 [Source:NCBI gen... [more]
back to top
BLAST of slc38a-6 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc38a93.531e-5639.16solute carrier family 38 member 9 [Source:NCBI gen... [more]
slc38a94.119e-5639.05solute carrier family 38 member 9 [Source:NCBI gen... [more]
slc38a95.636e-5639.05solute carrier family 38 member 9 [Source:NCBI gen... [more]
slc38a99.051e-5639.16solute carrier family 38 member 9 [Source:NCBI gen... [more]
slc38a91.401e-4638.44solute carrier family 38 member 9 [Source:NCBI gen... [more]
back to top
BLAST of slc38a-6 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Slc38a92.934e-5439.05solute carrier family 38, member 9 [Source:MGI Sym... [more]
back to top
BLAST of slc38a-6 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q19425|S38A9_CAEEL7.301e-6841.47Sodium-coupled neutral amino acid transporter 9 ho... [more]
sp|Q08BA4|S38A9_DANRE1.088e-6241.05Sodium-coupled neutral amino acid transporter 9 OS... [more]
sp|Q6DFK0|S38A9_XENLA6.196e-6039.16Sodium-coupled neutral amino acid transporter 9 OS... [more]
sp|Q3B8Q3|S38A9_RAT5.977e-5839.26Sodium-coupled neutral amino acid transporter 9 OS... [more]
sp|Q8NBW4|S38A9_HUMAN2.470e-5639.15Sodium-coupled neutral amino acid transporter 9 OS... [more]
back to top
BLAST of slc38a-6 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YFB30.000e+0100.00Slc38a-6 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A0H3YJE42.282e-8252.15Slc38a-2 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
V4ALV42.631e-7643.20Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
A0A1S3KA104.379e-7543.34sodium-coupled neutral amino acid transporter 9 is... [more]
A0A1S3KAJ64.752e-7543.34sodium-coupled neutral amino acid transporter 9 is... [more]
back to top
BLAST of slc38a-6 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
slc38a98.515e-5840.43solute carrier family 38 member 9 [Source:NCBI gen... [more]
slc38a95.185e-2845.63solute carrier family 38 member 9 [Source:NCBI gen... [more]
back to top
BLAST of slc38a-6 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
slc38a93.108e-6139.26solute carrier family 38 member 9 [Source:NCBI gen... [more]
back to top
BLAST of slc38a-6 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc38a-6 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO344953.620e-6842.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc38a-6 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
slc38a91.087e-5238.90solute carrier family 38 member 9 [Source:NCBI gen... [more]
slc38a91.087e-5238.90solute carrier family 38 member 9 [Source:NCBI gen... [more]
slc38a99.284e-5039.01solute carrier family 38 member 9 [Source:NCBI gen... [more]
back to top
BLAST of slc38a-6 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000016671.10.000e+099.26SMESG000016671.1[more]
SMESG000016671.17.715e-13699.06SMESG000016671.1[more]
SMESG000016671.19.470e-13699.06SMESG000016671.1[more]
SMESG000016959.16.347e-8652.15SMESG000016959.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30024398
GenBankAKN21665.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024398 ID=SMED30024398|Name=slc38a-6|organism=Schmidtea mediterranea sexual|type=transcript|length=1579bp
ATTAGATTAAATTTTAAATAATTCGCAATGTTGAATAAAGTTAACGAAAA
TACCAGTTTAATAAATCCGATTTTGATCAAATACGAAAGTGACAGTGACA
GTGATAGAAGTCGTAATTCATCTGAAATCAACTATCCAGAAAAGCGCGGT
AGTTTAGTTACAATATTTTCCATTTATAATACAATGATGGGAGCCACAAT
TATTTCTATGCCGTGGGCTATTCAACAGGCTGGATTAGGACTGGGGATAC
TGTTGCTCTTATTCATTGGGGCCCTAACTCTTTATACTGCTATATTGGTT
TTAAAATCTACAAATTACATAATTCGTACCCGGCATTGTATTTTGGAATT
TTCGGACGCTTGTGGATTTTATCTTGGACGTATTGGGGAGATTTCAGCAA
TTATTTCTTCTATTTTTGTTTTAATGAGTAGTTTAATTGTCTACTACGTT
CTCCTTTGCAATTTTCTTTTTCTTACAGTTCTTTATGTGTTTAATTATAT
CATTGACTCTCCGAATTATGCTTTTCCAGAAAACGATTTTCCAACAAACA
CAACGAATCCTCAATGTTTTAATTGGTTAAATAATTCTTTAACATCTTAT
TATGTTGTTTCGAAAGACCCTTTATCTCATTTAAATAATGTTGAAAGGTA
TCAAATATCCGGGAATTCATCAGTTGTTTTGTTGAAAGCTTTATGGTCAG
AAAACTTAACTGTTCCTTTTTGGGTTCTAATTATAATTTTCCCCTTAATT
TCTATAAAATCCGCAACTTTTGTTAGTAGATTCAATGCTTTCGGCACCAT
ATCAGTGATTTATTTAATCATTTTAATTATGTTCAAATTTATTAAATGGG
GAGTTCATTTGGATTTTGCAAACCCTCGGAATCATGTTACAAATTTTGGA
AATCATTTCACAGCCTTGACAGGAATTTGCAGTTTAGCATTTTTTATTCA
CAACGCAATTCATTACATCATGTCCAATCAAGATAAGCCAGAAAATAATG
TAAGAGATGTTTCGATAGCTTATTCACTGGTAGCTCTGACCTATCTCGTG
ATTGGGGTTTTGTTTTATATTATATTTCCCTTTGACAAGGAATGTATACA
GGACAATTTATTGAATAATTTGTCAGTGAACGATTCTTTAGCAGTGATTG
GTCGGCTAATGCTTCTTTTCCAGATCATAACTGTGTTTCCGTTGCTTGTA
AATATCCTTCGGACCCAATTCATGTATCATTTGTTTAAAACGTCTTATCC
AAGGTGAGGAAATATAAATTAATAATTTTTTAATTGATTAACTTTTAATA
CTAATAAATCTTTCTGACAAGGAGATGTATGTTTATTTTACAACAGGCTT
TGAGTTTTGGTACCGAAGGTAGCAATATTCGGATTCTACGTACAAAATTA
CATAGGTTTAGTCTAGTAAAGGAAAAAAATTATCTATGATTATTACATGG
CCTGTAAATTATAGCCGTAATTCCCAAATCTGTTGTAACAAAATACATGT
AGCTCCATGTGAGAGCTAGGAATCTTAGGAAATATTTCTTTTATATTTCT
TCAAAAATAAATAACATCAAGTAGCATTG
back to top

protein sequence of SMED30024398-orf-1

>SMED30024398-orf-1 ID=SMED30024398-orf-1|Name=SMED30024398-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=410bp
MLNKVNENTSLINPILIKYESDSDSDRSRNSSEINYPEKRGSLVTIFSIY
NTMMGATIISMPWAIQQAGLGLGILLLLFIGALTLYTAILVLKSTNYIIR
TRHCILEFSDACGFYLGRIGEISAIISSIFVLMSSLIVYYVLLCNFLFLT
VLYVFNYIIDSPNYAFPENDFPTNTTNPQCFNWLNNSLTSYYVVSKDPLS
HLNNVERYQISGNSSVVLLKALWSENLTVPFWVLIIIFPLISIKSATFVS
RFNAFGTISVIYLIILIMFKFIKWGVHLDFANPRNHVTNFGNHFTALTGI
CSLAFFIHNAIHYIMSNQDKPENNVRDVSIAYSLVALTYLVIGVLFYIIF
PFDKECIQDNLLNNLSVNDSLAVIGRLMLLFQIITVFPLLVNILRTQFMY
HLFKTSYPR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR013057AA_transpt_TM
Vocabulary: biological process
TermDefinition
GO:0003333amino acid transmembrane transport
GO:0006810transport
GO:0006865amino acid transport
GO:0032008positive regulation of TOR signaling
GO:0071230cellular response to amino acid stimulus
Vocabulary: cellular component
TermDefinition
GO:0005764lysosome
GO:0005765lysosomal membrane
GO:0005768endosome
GO:0005770late endosome
GO:0016020membrane
GO:0016021integral component of membrane
GO:0031902late endosome membrane
Vocabulary: molecular function
TermDefinition
GO:0015171amino acid transmembrane transporter activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013057Amino acid transporter, transmembrane domainPFAMPF01490Aa_transcoord: 45..142
e-value: 4.6E-12
score: 45.4
coord: 225..401
e-value: 2.9E-11
score: 42.7
NoneNo IPR availablePANTHERPTHR22950:SF244SODIUM-COUPLED NEUTRAL AMINO ACID TRANSPORTER 9coord: 17..401
NoneNo IPR availablePANTHERPTHR22950AMINO ACID TRANSPORTERcoord: 17..401
NoneNo IPR availableTMHMMTMhelixcoord: 256..278
NoneNo IPR availableTMHMMTMhelixcoord: 43..65
NoneNo IPR availableTMHMMTMhelixcoord: 293..315
NoneNo IPR availableTMHMMTMhelixcoord: 70..92
NoneNo IPR availableTMHMMTMhelixcoord: 227..249
NoneNo IPR availableTMHMMTMhelixcoord: 372..394
NoneNo IPR availableTMHMMTMhelixcoord: 328..350
NoneNo IPR availableTMHMMTMhelixcoord: 137..159