Centrosomal protein 295

Overview
NameCentrosomal protein 295
Smed IDSMED30024396
Length (bp)4745
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Centrosomal protein 295 (SMED30024396) t-SNE clustered cells

Violin plots show distribution of expression levels for Centrosomal protein 295 (SMED30024396) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Centrosomal protein 295 (SMED30024396) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Centrosomal protein 295 (SMED30024396) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024396

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30024396SMESG000023095.1 SmedASXL_013909SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30024396SMESG000023095.1 dd_Smed_v4_17079_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
pharynxSMED30024396SMESG000023095.1 dd_Smed_v4_11068_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30024396SMESG000023095.1 dd_Smed_v4_11068_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30024396SMESG000023095.1 dd_Smed_v4_11068_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30024396SMESG000023095.1 dd_Smed_v4_11068_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30024396SMESG000023095.1 dd_Smed_v6_17079_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30024396SMESG000023095.1 dd_Smed_v6_11068_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30024396SMESG000023095.1 dd_Smed_v4_11068_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Centrosomal protein 295 vs. Ensembl Human
Match: CEP295 (centrosomal protein 295 [Source:HGNC Symbol;Acc:HGNC:29366])

HSP 1 Score: 68.5514 bits (166), Expect = 1.402e-10
Identity = 77/296 (26.01%), Postives = 152/296 (51.35%), Query Frame = 1
Query:   70 RI*NSLMIRPSPNELERLRNEEIAKRRLMRLKEVREYSKANASKLRNLYKEHKLQVINKLAQTIQDQFNLEDSKKLNELKLKHSVQVNAVGNGHDNAADWVDPSIKTNEQLAINLAF-ADKRHQMALXXXXXXXXXXXXXXTARLKTMQLAMLIEKERAAEIANLPPPDIPLYLKESVINPEDMTPRVKVCDRNKFSVIESFENASYNVQRMNSDDQIFNFEADNAKSAAEFRQNEMIKMSTNLHVQAE----EQFIKAHLRGHKAIKKQLVHKDYQELVSDLEHVAKGEMAKRQR 942
            ++ N+  +R SPNE   +  E+  +RR +RL +VRE  +  A ++R   K+ + Q   +LA+ ++ ++    ++K+  L+  +   + ++G GH  A +  +P +    Q A      AD RH+ ALK  + +K+     +T  +K  + A+L+EKER+A+I +LPPP   L+  E++             +  + S +++  +  +++          N E D  +  A     E  K    L  QA     E+F KAH+RG +A+KK  + ++ ++L+ +L+ + + ++A+R++
Sbjct:    4 KVVNTHKLRLSPNEEAFILKEDYERRRKLRLLQVREQERDIALQIREDIKQRRNQQFTRLAEELRAEWEESQTQKIQNLEKLYLASLRSMGEGHRQAKE-NEPDLDALAQRAAERKRKADLRHKEALKVQKNQKEILLKQKTWHIKARKEALLVEKERSAKITSLPPPPPTLF--ENI-------------EVKRISAVKTNSSTYHHLHTF------VNRETDTKRPDARLAAEEEAKRLEELQKQAAQERMERFEKAHVRGFQAMKKIHLAQNQEKLMKELKQLQQEDLARRRQ 277          
BLAST of Centrosomal protein 295 vs. Ensembl Xenopus
Match: cep295 (centrosomal protein 295 [Source:NCBI gene;Acc:100379879])

HSP 1 Score: 82.8037 bits (203), Expect = 4.530e-15
Identity = 93/294 (31.63%), Postives = 167/294 (56.80%), Query Frame = 1
Query:   70 RI*NSLMIRPSPNELERLRNEEIAKRRLMRLKEVREYSKANASKLRNLYKEHKLQVINKLAQTIQDQFNLEDSKKLNELKLKHSVQVNAVGNGHDNAADWVDPSIKTNE-QLAINLAFADKRHQMALXXXXXXXXXXXXXXTARLKTMQLAMLIEKERAAEIANLPPPDIPLYLKESVINPEDMT--PRVKVCDRNKFSVIESFENASYNVQRMNSDDQIFNFEADNAKSAAEFRQNEMIKMSTNLHVQAEEQFIKAHLRGHKAIKKQLVHKDYQELVSDLEHVAKGEMAKRQR 942
            ++ N+ +IR SPNE   L  +E  +RR +RL++VRE  K  A ++R+  KE + Q +  LA+ ++ ++    ++KL  L+  +   ++A+G GH  A +  +P ++  E Q A N   A+KRH+ AL+EL++ K+++   +T  LK  + A++ EKERAA+IA+L     P    + + N E +   P VK+C+ + FSV      + Y++     D +  + E  +A+ AAE     +  +      +  E+  KAHLRG  A+KK L+ +D  +L+ +LE + + ++A+R++
Sbjct:    4 KVANTGVIRLSPNEEALLLKQERERRRKLRLQQVREQEKFIALQIRHNVKERREQELQNLAEELRLEWQASQAEKLRALEKLYVSSLSAIGEGHRQAKE-NEPDLQAVERQAAANRQKAEKRHREALRELKQHKEKQLREQTWLLKARRKALITEKERAAKIASL-----PPPPPDPLENIEVLRRFPTVKLCNVDGFSV------SHYHLPEPYVDRET-DTEQPDARVAAEEEAKRLDALQKEEERERRERMEKAHLRGSHALKKVLLTQDRDKLLKELEQMQQEDLAQRRQ 284          
BLAST of Centrosomal protein 295 vs. Ensembl Mouse
Match: Cep295 (centrosomal protein 295 [Source:MGI Symbol;Acc:MGI:2442521])

HSP 1 Score: 72.7886 bits (177), Expect = 4.154e-12
Identity = 73/285 (25.61%), Postives = 148/285 (51.93%), Query Frame = 1
Query:   91 IRPSPNELERLRNEEIAKRRLMRLKEVREYSKANASKLRNLYKEHKLQVINKLAQTIQDQFNLEDSKKLNELKLKHSVQVNAVGNGHDNAADWVDPSIKT-NEQLAINLAFADKRHQMALXXXXXXXXXXXXXXTARLKTMQLAMLIEKERAAEIANLPPPDIPLYLKESVINPEDMTPRVKVCDRNKFSVIESFENASYNVQRMNSDDQIFNFEADNAKSAAEFRQNEMIKMSTNLHVQAEEQFIKAHLRGHKAIKKQLVHKDYQELVSDLEHVAKGEMAKRQR 942
            +R SP+E   +  E+  +RR +RL +VRE  +  A ++R   K+ + Q ++ LA+ ++ ++    S+K+  L+  +   +  +G+GH  A +  +P +   + + A     A+ RH+ ALK  + +K+     +T  +K  + A+L+EK+R+A++A LPPP +P   +   +N      R+     N      ++ + S  V R     Q       +A  AAE     + ++      +  +QF +AH+RG +A+KK  + ++ + L+ +L+ + K ++A+R++
Sbjct:   58 LRLSPSEEAFILKEDYERRRKLRLLQVREQERGIAFQIREGIKQRRSQQVSHLAEELRAKWEEAQSQKIQNLEKLYLASLRHMGDGHRQAKE-NEPDLDALSRRAAERKRKAEVRHKEALKVQKNQKEMLMKQKTRHIKARKEAVLVEKQRSAKMARLPPP-VPSPFENIDVN------RIPSLKTNS----STYHHISTFVSRQMGTKQ------PDAHLAAEEEARRVERLRKQAAQERVKQFERAHVRGSQAMKKIHLAQNQERLMEELKQLQKEDLARRRQ 324          
BLAST of Centrosomal protein 295 vs. Ensembl Mouse
Match: Cep295 (centrosomal protein 295 [Source:MGI Symbol;Acc:MGI:2442521])

HSP 1 Score: 72.7886 bits (177), Expect = 4.464e-12
Identity = 73/285 (25.61%), Postives = 148/285 (51.93%), Query Frame = 1
Query:   91 IRPSPNELERLRNEEIAKRRLMRLKEVREYSKANASKLRNLYKEHKLQVINKLAQTIQDQFNLEDSKKLNELKLKHSVQVNAVGNGHDNAADWVDPSIKT-NEQLAINLAFADKRHQMALXXXXXXXXXXXXXXTARLKTMQLAMLIEKERAAEIANLPPPDIPLYLKESVINPEDMTPRVKVCDRNKFSVIESFENASYNVQRMNSDDQIFNFEADNAKSAAEFRQNEMIKMSTNLHVQAEEQFIKAHLRGHKAIKKQLVHKDYQELVSDLEHVAKGEMAKRQR 942
            +R SP+E   +  E+  +RR +RL +VRE  +  A ++R   K+ + Q ++ LA+ ++ ++    S+K+  L+  +   +  +G+GH  A +  +P +   + + A     A+ RH+ ALK  + +K+     +T  +K  + A+L+EK+R+A++A LPPP +P   +   +N      R+     N      ++ + S  V R     Q       +A  AAE     + ++      +  +QF +AH+RG +A+KK  + ++ + L+ +L+ + K ++A+R++
Sbjct:   58 LRLSPSEEAFILKEDYERRRKLRLLQVREQERGIAFQIREGIKQRRSQQVSHLAEELRAKWEEAQSQKIQNLEKLYLASLRHMGDGHRQAKE-NEPDLDALSRRAAERKRKAEVRHKEALKVQKNQKEMLMKQKTRHIKARKEAVLVEKQRSAKMARLPPP-VPSPFENIDVN------RIPSLKTNS----STYHHISTFVSRQMGTKQ------PDAHLAAEEEARRVERLRKQAAQERVKQFERAHVRGSQAMKKIHLAQNQERLMEELKQLQKEDLARRRQ 324          
BLAST of Centrosomal protein 295 vs. UniProt/SwissProt
Match: sp|A4L9P8|CE295_RAT (Centrosomal protein of 295 kDa OS=Rattus norvegicus OX=10116 GN=Cep295 PE=2 SV=2)

HSP 1 Score: 74.3294 bits (181), Expect = 9.653e-12
Identity = 79/285 (27.72%), Postives = 149/285 (52.28%), Query Frame = 1
Query:   91 IRPSPNELERLRNEEIAKRRLMRLKEVREYSKANASKLRNLYKEHKLQVINKLAQTIQDQFNLEDSKKLNELKLKHSVQVNAVGNGHDNAADWVDPSIKT-NEQLAINLAFADKRHQMALXXXXXXXXXXXXXXTARLKTMQLAMLIEKERAAEIANLPPPDIPLYLKESVINPEDMTPRVKVCDRNKFSVIESFENASYNVQRMNSDDQIFNFEADNAKSAAEFRQNEMIKMSTNLHVQAEEQFIKAHLRGHKAIKKQLVHKDYQELVSDLEHVAKGEMA-KRQ 939
            +R SPNE   +  E+  +RR +RL +VRE  +  A ++R   K+ + Q ++ LA+ ++ ++    S+K+  L+  +   +  +G+GH  A +  +P +   + + A     A+ RH+ ALK  +++K+     +T  +K  + A+L+EKER+A++A LPPP +P   +   IN     P +K  +R+ +  I +F      V R     Q       +A  AAE     + ++      +  EQ  +AH RG +A+KK  + ++ + L+ +L+ + + ++A KRQ
Sbjct:   10 LRLSPNEEAFILKEDYERRRKLRLLQVREQERGIAFQIREDIKQRRNQQVSHLAEELRAEWEEAQSQKIQNLEKLYLASLRHMGDGHQQAKE-NEPDLDALSRRAAERKTKAEARHKEALKAQKKQKEMLMKQKTRHIKARKEAVLVEKERSAKMARLPPP-VPSPFENIDIN---RIPSLKT-NRSTYHHISAF------VSRQMGTKQ------PDAHLAAEEEARRVERLRKQAAQERMEQSERAHARGSQAMKKIHLAQNQERLMEELKQLQREDLACKRQ 276          
BLAST of Centrosomal protein 295 vs. UniProt/SwissProt
Match: sp|Q8BQ48|CE295_MOUSE (Centrosomal protein of 295 kDa OS=Mus musculus OX=10090 GN=Cep295 PE=1 SV=3)

HSP 1 Score: 72.7886 bits (177), Expect = 3.062e-11
Identity = 73/285 (25.61%), Postives = 148/285 (51.93%), Query Frame = 1
Query:   91 IRPSPNELERLRNEEIAKRRLMRLKEVREYSKANASKLRNLYKEHKLQVINKLAQTIQDQFNLEDSKKLNELKLKHSVQVNAVGNGHDNAADWVDPSIKT-NEQLAINLAFADKRHQMALXXXXXXXXXXXXXXTARLKTMQLAMLIEKERAAEIANLPPPDIPLYLKESVINPEDMTPRVKVCDRNKFSVIESFENASYNVQRMNSDDQIFNFEADNAKSAAEFRQNEMIKMSTNLHVQAEEQFIKAHLRGHKAIKKQLVHKDYQELVSDLEHVAKGEMAKRQR 942
            +R SP+E   +  E+  +RR +RL +VRE  +  A ++R   K+ + Q ++ LA+ ++ ++    S+K+  L+  +   +  +G+GH  A +  +P +   + + A     A+ RH+ ALK  + +K+     +T  +K  + A+L+EK+R+A++A LPPP +P   +   +N      R+     N      ++ + S  V R     Q       +A  AAE     + ++      +  +QF +AH+RG +A+KK  + ++ + L+ +L+ + K ++A+R++
Sbjct:   10 LRLSPSEEAFILKEDYERRRKLRLLQVREQERGIAFQIREGIKQRRSQQVSHLAEELRAKWEEAQSQKIQNLEKLYLASLRHMGDGHRQAKE-NEPDLDALSRRAAERKRKAEVRHKEALKVQKNQKEMLMKQKTRHIKARKEAVLVEKQRSAKMARLPPP-VPSPFENIDVN------RIPSLKTNS----STYHHISTFVSRQMGTKQ------PDAHLAAEEEARRVERLRKQAAQERVKQFERAHVRGSQAMKKIHLAQNQERLMEELKQLQKEDLARRRQ 276          
BLAST of Centrosomal protein 295 vs. UniProt/SwissProt
Match: sp|Q9C0D2|CE295_HUMAN (Centrosomal protein of 295 kDa OS=Homo sapiens OX=9606 GN=CEP295 PE=1 SV=4)

HSP 1 Score: 68.5514 bits (166), Expect = 6.732e-10
Identity = 77/296 (26.01%), Postives = 152/296 (51.35%), Query Frame = 1
Query:   70 RI*NSLMIRPSPNELERLRNEEIAKRRLMRLKEVREYSKANASKLRNLYKEHKLQVINKLAQTIQDQFNLEDSKKLNELKLKHSVQVNAVGNGHDNAADWVDPSIKTNEQLAINLAF-ADKRHQMALXXXXXXXXXXXXXXTARLKTMQLAMLIEKERAAEIANLPPPDIPLYLKESVINPEDMTPRVKVCDRNKFSVIESFENASYNVQRMNSDDQIFNFEADNAKSAAEFRQNEMIKMSTNLHVQAE----EQFIKAHLRGHKAIKKQLVHKDYQELVSDLEHVAKGEMAKRQR 942
            ++ N+  +R SPNE   +  E+  +RR +RL +VRE  +  A ++R   K+ + Q   +LA+ ++ ++    ++K+  L+  +   + ++G GH  A +  +P +    Q A      AD RH+ ALK  + +K+     +T  +K  + A+L+EKER+A+I +LPPP   L+  E++             +  + S +++  +  +++          N E D  +  A     E  K    L  QA     E+F KAH+RG +A+KK  + ++ ++L+ +L+ + + ++A+R++
Sbjct:    4 KVVNTHKLRLSPNEEAFILKEDYERRRKLRLLQVREQERDIALQIREDIKQRRNQQFTRLAEELRAEWEESQTQKIQNLEKLYLASLRSMGEGHRQAKE-NEPDLDALAQRAAERKRKADLRHKEALKVQKNQKEILLKQKTWHIKARKEALLVEKERSAKITSLPPPPPTLF--ENI-------------EVKRISAVKTNSSTYHHLHTF------VNRETDTKRPDARLAAEEEAKRLEELQKQAAQERMERFEKAHVRGFQAMKKIHLAQNQEKLMKELKQLQQEDLARRRQ 277          
BLAST of Centrosomal protein 295 vs. TrEMBL
Match: A0A3S0Z9D0 (Uncharacterized protein (Fragment) OS=Elysia chlorotica OX=188477 GN=EGW08_018539 PE=4 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 6.526e-19
Identity = 88/296 (29.73%), Postives = 158/296 (53.38%), Query Frame = 1
Query:   94 RPSPNELERLRNEEIAKRRLMRLKEVREYSKANASKLRNLYKEHKLQVINKLAQTIQDQFNLEDSKKLNELKLKHSVQVNAVGNGHDNA---ADWVDPSIKTNEQLAINLAFADKRHQMALXXXXXXXXXXXXXXTARLKTMQLAMLIEKERAAEIANLPP--PDIPLYLKESVINPEDMTPRVKVCDRNKFSVIESFENASYNVQRMNSDDQIFN---FEADNAKSAAE-----FRQNEMIKMSTNLHVQAEEQFIKAHLRGHKAIKKQLVHKDYQELVSDLEHVAKGEMAKRQR 942
            R SPNE+ERL  EE  +R+ +R+ +VRE +KANA+ +RN  +  K +++ + +  +++Q   E  +K+ +L+LK+   +  +G+GH  A    D      +  +Q     A  D R + AL++ + +   +E+ E   +   Q A+ +E+ERA EIA LPP  PDI L L++           V++ D      +++F N  Y++     D Q+      E  NAKS AE      RQ+ + +   +LH Q E    +A +RG++A++K+++  D  +++ DL  + + +  +RQ+
Sbjct:    7 RLSPNEVERLVKEERERRKKLRIVQVREQAKANAAAIRNDVRREKERLLKEFSAEVEEQLTAEKDEKVRKLRLKYEGTLRGIGDGHREAYLKGDGYSAIEQMQKQQEAACAAQD-RFESALRKQRMEDAAREHEERRHILARQAALEVERERATEIAALPPPAPDICLELEKKSKRA------VQMMD------MKAFANTHYHI----PDYQVIRAGPHEQTNAKSDAEDTDLKLRQD-LAEKKRSLHEQKE----RARIRGNEALQKEMLKHDMGDMLQDLSLLQRNDRRRRQK 280          
BLAST of Centrosomal protein 295 vs. TrEMBL
Match: A0A4Z2CW57 (Centrosomal protein OS=Schistosoma japonicum OX=6182 GN=EWB00_007010 PE=4 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 2.459e-17
Identity = 91/302 (30.13%), Postives = 163/302 (53.97%), Query Frame = 1
Query:   97 PSPNELERLRNEEIAKRRLMRLKEVREYSKANASKLRNLYKEHKLQVINKLAQTIQDQFNLEDSKKLNELKLKHSVQVNAVGNGHDNAADWVDPSIKTNEQLAINLAFADKRHQMALXXXXXXXXXXXXXXTARLKTMQLAMLIEKERAAEIANLPPPDIPLYLKESVINPEDMTPRVKVCDRNKFSVIESFENASYNVQRMNSDDQIFNFEADNAKSAAE----------FRQNEMIKM---STNLHVQAEEQFIKAHLRGHKAIKKQLVHKDYQELVSDLEHVAKGEMAKRQREYHKNEL 963
            PS  EL +L++EEI +R+ MR+ +VR  +K +A K+R LY   K Q+ + +A+ +Q +   +D K L   K ++   +   G GH +A +W +P ++TN+ L++    A+ R  MAL +L E++  ++ I+    K ++    +EK+RAA IA+L PP   + +KE+        P V V D      IE+  NA +  Q M+S   + N + D A +  +          +++ E I+      N+H  A+E  IKA +RG +A++K+ +H+ YQ L++ L+ + + E   R+ + +   +
Sbjct:   11 PSLLELRQLKHEEIERRKKMRILQVRSQAKESARKVRMLYNVKKQQLSDLVAKKLQIKLAKDDIKLLEAKKCEYINVMQLYGIGHKSAENWNNPVLETNQNLSVARKRAEDRFNMALNKLHEERLNEDLIQHETQKRIKEVRNVEKKRAALIASL-PPSRSVLIKENSKPTLAYEPLVLVYD------IEA-RNAIH-TQNMSSKVLVNNIKVDEATAVGDKKAQNATISAYKEEERIQAVERENNIH--AQEDLIKADMRGRQAMRKERIHQHYQALLNRLDEIRRNETLLRRSQLYSGTI 301          
BLAST of Centrosomal protein 295 vs. TrEMBL
Match: A0A1S3H5Z9 (centrosomal protein of 295 kDa OS=Lingula unguis OX=7574 GN=LOC106151994 PE=4 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 1.099e-15
Identity = 84/282 (29.79%), Postives = 150/282 (53.19%), Query Frame = 1
Query:   94 RPSPNELERLRNEEIAKRRLMRLKEVREYSKANASKLRNLYKEHKLQVINKLAQTIQDQFNLEDSKKLNELKLKHSVQVNAVGNGHDNAADWVDPSIKTNEQLAINLAFADKRHQMALXXXXXXXXXXXXXXTARLKTMQLAMLIEKERAAEIANLPPPDIPLYLKESVINPEDMTPRVKVCDRNKFSVIESFENASYNVQRMNSDDQIFNFEADNAKSAAEFRQNEMIKMSTNLHVQAEEQFIKAHLRGHKAIKKQLVHKDYQELVSDLEHVAKGEMAKRQ 939
            R SPNE+++L  EE  KRR+ R+ +VRE +KA+A+K+R   K+ + + + KLA+ I D++  E ++K++EL+  +   +  +G GH  A  + D + +   +L  +   AD RH+ AL +++  K  K+  E   +   QLA+  E+ RAA IA+LPPP          ++   + P V++ D + FS         Y V R + ++       D   +A E  +    +   +L    +EQ  KA LR   A++++++ +DY+ L+  L  + + ++ KRQ
Sbjct:   10 RLSPNEVDQLVKEEKQKRRIARIVQVREQAKADAAKVRQAVKDARAKELQKLAEEIMDEYEKEKAEKIHELETLYENCLKTIGEGHREAEQFDDKAEEVYIKLREDTKMADMRHKKALAKVKRDKALKDQEENKHIVARQLALEQERVRAAMIASLPPPPPD--PLVLQLDTTKVKP-VQLTDVDAFSTTHYHLQEDYIVDRADREEW-----GDAKAAATEEAERIAERQLKDLR-SNQEQTEKARLRHQHAVQQEILKEDYKNLLVHLAELERADILKRQ 282          
BLAST of Centrosomal protein 295 vs. TrEMBL
Match: A0A210QLS1 (Uncharacterized protein OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT20697 PE=4 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 3.318e-15
Identity = 84/285 (29.47%), Postives = 149/285 (52.28%), Query Frame = 1
Query:   94 RPSPNELERLRNEEIAKRRLMRLKEVREYSKANASKLRNLYKEHKLQVINKLAQTIQDQFNLEDSKKLNELKLKHSVQVNAVGNGHDNAADWVDPSIKTNEQLAINLAFADKRHQMALXXXXXXXXXXXXXXTARLKTMQLAMLIEKERAAEIANL--PPPDIPLYLKESVINPEDMTPRVKVCDRNKFSVIESFENASYNVQRMNSDDQIFNFEADNAKSAAEFRQNEMIKMSTNLHVQAEEQFIKAHLRGHKAIKKQLVHKDYQELVSDLEHVAKGEMAKRQR 942
            R SPNE  +L  +E  +RR +RL +VRE +K NA+K+R   K+ K + I+KLA  +Q+Q   E  +K+  L+ ++   ++ +G G   A + VD   + +    ++   A+ R + A ++ +  K  +E  E   +   + A+ +EKERA++IA+L  PPPD  L L           P VK+ D N FS         Y V +   ++Q      ++A+ AAE  +  M +   +L     ++  +A +R +KA++ +L+  DY  +++DL  + + +  +RQR
Sbjct:   10 RLSPNEEAQLIKDETERRRKLRLVQVREQAKQNAAKIRQAVKQEKDRQIHKLAAELQNQLEKEKEEKVRHLEAQYENCLHTIGQGQLEAGEQVDQDAERHMVRQLDNQRAESRGKAATEKARRDKIYQEYEENKIIAAKKSALEMEKERASKIASLPAPPPDPVLNLGVP------KKPSVKMTDANAFSTTHYHLLEDYAVDKAGPNEQ------EDARRAAEEEEIRMKEQDQDLVRLHHDRLARARVRHNKALEAELLSHDYNNILADLSDLQRTDRERRQR 282          
BLAST of Centrosomal protein 295 vs. TrEMBL
Match: U3J570 (ALMS_motif domain-containing protein OS=Anas platyrhynchos platyrhynchos OX=8840 PE=4 SV=2)

HSP 1 Score: 92.8189 bits (229), Expect = 6.190e-15
Identity = 81/290 (27.93%), Postives = 150/290 (51.72%), Query Frame = 1
Query:   91 IRPSPNELERLRNEEIAKRRLMRLKEVREYSKANASKLRNLYKEHKLQVINKLAQTIQDQFNLEDSKKLNELKLKHSVQVNAVGNGHDNAADWVDPSIKT-NEQLAINLAFADKRHQMALXXXXXXXXXXXXXXTARLKTMQLAMLIEKERAAEIANLPPPDIPLYLKESVINPEDMTPRVKVCDRNKFSVIESFENASYNVQRMNSDDQIFNFEADNAKSAAEFRQNEMIKMSTNLHVQAE----EQFIKAHLRGHKAIKKQLVHKDYQELVSDLEHVAK-GEMAKRQR 942
            +R SPNE   L  EE  +RR +RL++VRE  K  A ++R   K+ + + +++L +T++ ++  E  +K+  L+      + AVG GH  A +  +P ++   +Q       A+KRH+ AL+E + +K++  + +T R+   + A+ +E+ERAA++A+L               P      ++  +  K   ++++   ++++ R +  +   + E D  +  A     E +K    LH +AE    EQ  KAHLRG  A+KK  + +D + L+ +LE +     M +RQR
Sbjct:   11 LRLSPNEETMLLKEEYERRRKLRLQQVREQQKYIALQIRQKVKQKREEQLHQLEETLRAEWQKEQDEKIKALEKLFLSSLRAVGEGHRQAKE-NEPDLEALAKQAEERKQRAEKRHRKALREQKFQKEKLLHEQTRRINARKHALDVERERAAKVASL---------------PPPPPHPLENFEAKKIPAVKAYGAGNFSITRYHISEPYVDREMDGEQPDARLAAEEEVKRLEELHREAEREKREQVAKAHLRGSHALKKVHLAQDRERLLKELEQMQNVDRMRRRQR 284          
BLAST of Centrosomal protein 295 vs. Ensembl Medaka
Match: ENSORLT00000034256.1 (centrosomal protein 295 [Source:NCBI gene;Acc:101173724])

HSP 1 Score: 72.4034 bits (176), Expect = 3.905e-12
Identity = 74/290 (25.52%), Postives = 157/290 (54.14%), Query Frame = 1
Query:   91 IRPSPNELERLRNEEIAKRRLMRLKEVREYSKANASKLRNLYKEHKLQVINKLAQTIQDQFNLEDSKKLNELKLKHSVQVNAVGNGHDNAADWVDPSIKT-NEQLAINLAFADKRHQMALXXXXXXXXXXXXXXTARLKTMQLAMLIEKERAAEIANLPPPDIPLYLKESVINPEDMTPRVKVCDRNKFSVIESFENASYNVQRMNSDDQIFNFEAD----NAKSAAEFRQNEMIKMSTNLHVQAEEQFIKAHLRGHKAIKKQLVHKDYQELVSDLEHVAKGEMAKRQRE 945
            +R SPNE   +  EE  +RR +RL +VRE  +  A ++R   +  + Q + +L + ++ ++  +  +KL+ L+  +   +  +G+GH NA +  +P +    E+   N A A++R + ALKELQ ++ + +  +   +   + A+  EKER+ ++A+LPPP          +NP      ++  D  K +V +  +++++   R +  +   + EAD    +A+  AE     ++++      +  EQ  KA LRG +A++++ + +D + L+++LEH+ + ++ +R+++
Sbjct:    8 LRLSPNEEALIIREEYERRRKLRLLQVREQQRCIALQIRREVEHRRQQELQQLEEELRKEWEQQQEEKLHTLQRLYQESLQLIGHGHRNAKE-NEPDLAALAEREMENHAKAEERFRDALKELQTQRLKHQEKQNQAINARKKALQAEKERSTKVASLPPPP---------LNP------IQNIDSKKLNVAKRSDSSAFASTRYHMTENAGDREADSTQPDAREEAEVEARRLLRLEQEERSKRAEQLEKARLRGKQALRREQLVQDREHLLTELEHMQQTDLLRRRQQ 281          
BLAST of Centrosomal protein 295 vs. Ensembl Medaka
Match: ENSORLT00000039695.1 (centrosomal protein 295 [Source:NCBI gene;Acc:101173724])

HSP 1 Score: 72.4034 bits (176), Expect = 4.441e-12
Identity = 74/290 (25.52%), Postives = 157/290 (54.14%), Query Frame = 1
Query:   91 IRPSPNELERLRNEEIAKRRLMRLKEVREYSKANASKLRNLYKEHKLQVINKLAQTIQDQFNLEDSKKLNELKLKHSVQVNAVGNGHDNAADWVDPSIKT-NEQLAINLAFADKRHQMALXXXXXXXXXXXXXXTARLKTMQLAMLIEKERAAEIANLPPPDIPLYLKESVINPEDMTPRVKVCDRNKFSVIESFENASYNVQRMNSDDQIFNFEAD----NAKSAAEFRQNEMIKMSTNLHVQAEEQFIKAHLRGHKAIKKQLVHKDYQELVSDLEHVAKGEMAKRQRE 945
            +R SPNE   +  EE  +RR +RL +VRE  +  A ++R   +  + Q + +L + ++ ++  +  +KL+ L+  +   +  +G+GH NA +  +P +    E+   N A A++R + ALKELQ ++ + +  +   +   + A+  EKER+ ++A+LPPP          +NP      ++  D  K +V +  +++++   R +  +   + EAD    +A+  AE     ++++      +  EQ  KA LRG +A++++ + +D + L+++LEH+ + ++ +R+++
Sbjct:    8 LRLSPNEEALIIREEYERRRKLRLLQVREQQRCIALQIRREVEHRRQQELQQLEEELRKEWEQQQEEKLHTLQRLYQESLQLIGHGHRNAKE-NEPDLAALAEREMENHAKAEERFRDALKELQTQRLKHQEKQNQAINARKKALQAEKERSTKVASLPPPP---------LNP------IQNIDSKKLNVAKRSDSSAFASTRYHMTENAGDREADSTQPDAREEAEVEARRLLRLEQEERSKRAEQLEKARLRGKQALRREQLVQDREHLLTELEHMQQTDLLRRRQQ 281          
BLAST of Centrosomal protein 295 vs. Planmine SMEST
Match: SMESG000023095.1 (SMESG000023095.1)

HSP 1 Score: 2835.83 bits (7350), Expect = 0.000e+0
Identity = 1480/1480 (100.00%), Postives = 1480/1480 (100.00%), Query Frame = 1
Query:   88 MIRPSPNELERLRNEEIAKRRLMRLKEVREYSKANASKLRNLYKEHKLQVINKLAQTIQDQFNLEDSKKLNELKLKHSVQVNAVGNGHDNAADWVDPSIKTNEQLAINLAFADKRHQMALXXXXXXXXXXXXXXTARLKTMQLAMLIEKERAAEIANLPPPDIPLYLKESVINPEDMTPRVKVCDRNKFSVIESFENASYNVQRMNSDDQIFNFEADNAKSAAEFRQNEMIKMSTNLHVQAEEQFIKAHLRGHKAIKKQLVHKDYQELVSDLEHVAKGEMAKRQREYHKNELIGPNSAGHFGVGHNAAKMMFKEKCRERAVEAVVMESLKDITNSEKQNNSNEFDNKLLQSEIVIDNSYTKPQHKLSCLYDKIRKQKENVHFQDEVSQLPSELAVVDEEKKRIPVENNKQNFVSSQDFRELQPNDVTCDLDAEESSNIIRHALSATGRSNIVLEKSTRQKERHHLEDDFLQIDKRFDQLSTNFHEWRDATSVRSESTIEINSQNHHIHNSIGIQESEAHSIGSRSEDTRESNSIIKIKDFQRRAIMKLNGQLNTTQIATLEKQIANFSVDSNSITESFSNSLKSYTESNHSESKHSRSVVNEWVNSQLLQTVDKIPDWVTRATPKFIPDLNLSFEXXXXXXXXXXXXXXXXXXXXXXXXXXXPRSSCNCPVHPSLTDISNEQNDYSESKHYLQSSKELLTSFDSKPIGNDSNNILLDDIMNENSLSIPPDEADRDLIDFQNTDDLSFSQDSKSNFMNIPEPQILEINTLGNYIDDATESNDNEITTILNLSNSNEAFYTADNICDSANNASLSEIASGAVMTASEITNASNANAELIINEYKRFLDNIAFKIDDSMLDKSEIKTGMLNIIPDEHESFDSFYSRDNPDAMNSVKKTQLLMKSGPPSDICSRIADNTATGEMASPPQHNNEMDNSNNNKFXXXXXXXXXXXXXXXXXDIQLDREENEIRNVDQLLPSACTANHDTISSGINQSYFALESIGAPFSNNHDSLSSDTDQLVSMSSMDSNANTNLQLHNEPIKKIPNILSSTMKANKTHVFPSSPDVSSIHSESSVLLKQQIMKDYFEKNKERLQEVLHPSNSTQTASSKPTDFVDDETPRNPDSGKASSRYTTEHSGQSTERMGNDDILMTGRNDSLLTEYTVRDQWSSSHSNFQTLSELISLQQNDNLNRSEENEKMFHNSCNFNSKTSVDLIDFNSNMDLHDVPTSYSTTVPPVCSQDLSGSNLEHHQATPTSQKLSTLSNILSPYDRNLIDNNLYSDKSTTDCNSSPYKCLESIHSSEELDFNDLSTEQVHEFETILQFEDKTDINCSIDSKSEADMSTLSLVSFLRNESACQEQFTASNRXXXXXXXXXXXXXXXXXXXXQEMKIQLEKWKKERLQRINNNPPNEIKKSHITKDDNMRRKDIVETKSRTTKLWNQLEEVQKMKQRKEAEKIKLDNQLRKKEYAEKLRRIKTEKQKKVEKL 4527
            MIRPSPNELERLRNEEIAKRRLMRLKEVREYSKANASKLRNLYKEHKLQVINKLAQTIQDQFNLEDSKKLNELKLKHSVQVNAVGNGHDNAADWVDPSIKTNEQLAINLAFADKRHQMALKELQEKKKEKENIETARLKTMQLAMLIEKERAAEIANLPPPDIPLYLKESVINPEDMTPRVKVCDRNKFSVIESFENASYNVQRMNSDDQIFNFEADNAKSAAEFRQNEMIKMSTNLHVQAEEQFIKAHLRGHKAIKKQLVHKDYQELVSDLEHVAKGEMAKRQREYHKNELIGPNSAGHFGVGHNAAKMMFKEKCRERAVEAVVMESLKDITNSEKQNNSNEFDNKLLQSEIVIDNSYTKPQHKLSCLYDKIRKQKENVHFQDEVSQLPSELAVVDEEKKRIPVENNKQNFVSSQDFRELQPNDVTCDLDAEESSNIIRHALSATGRSNIVLEKSTRQKERHHLEDDFLQIDKRFDQLSTNFHEWRDATSVRSESTIEINSQNHHIHNSIGIQESEAHSIGSRSEDTRESNSIIKIKDFQRRAIMKLNGQLNTTQIATLEKQIANFSVDSNSITESFSNSLKSYTESNHSESKHSRSVVNEWVNSQLLQTVDKIPDWVTRATPKFIPDLNLSFERSIISIRSNDSSMRSVSSNLSSNTIASPRSSCNCPVHPSLTDISNEQNDYSESKHYLQSSKELLTSFDSKPIGNDSNNILLDDIMNENSLSIPPDEADRDLIDFQNTDDLSFSQDSKSNFMNIPEPQILEINTLGNYIDDATESNDNEITTILNLSNSNEAFYTADNICDSANNASLSEIASGAVMTASEITNASNANAELIINEYKRFLDNIAFKIDDSMLDKSEIKTGMLNIIPDEHESFDSFYSRDNPDAMNSVKKTQLLMKSGPPSDICSRIADNTATGEMASPPQHNNEMDNSNNNKFLSLSELSENTSLNNESNDIQLDREENEIRNVDQLLPSACTANHDTISSGINQSYFALESIGAPFSNNHDSLSSDTDQLVSMSSMDSNANTNLQLHNEPIKKIPNILSSTMKANKTHVFPSSPDVSSIHSESSVLLKQQIMKDYFEKNKERLQEVLHPSNSTQTASSKPTDFVDDETPRNPDSGKASSRYTTEHSGQSTERMGNDDILMTGRNDSLLTEYTVRDQWSSSHSNFQTLSELISLQQNDNLNRSEENEKMFHNSCNFNSKTSVDLIDFNSNMDLHDVPTSYSTTVPPVCSQDLSGSNLEHHQATPTSQKLSTLSNILSPYDRNLIDNNLYSDKSTTDCNSSPYKCLESIHSSEELDFNDLSTEQVHEFETILQFEDKTDINCSIDSKSEADMSTLSLVSFLRNESACQEQFTASNREISSESTPKKTTTKTNIENNQEMKIQLEKWKKERLQRINNNPPNEIKKSHITKDDNMRRKDIVETKSRTTKLWNQLEEVQKMKQRKEAEKIKLDNQLRKKEYAEKLRRIKTEKQKKVEKL
Sbjct:    1 MIRPSPNELERLRNEEIAKRRLMRLKEVREYSKANASKLRNLYKEHKLQVINKLAQTIQDQFNLEDSKKLNELKLKHSVQVNAVGNGHDNAADWVDPSIKTNEQLAINLAFADKRHQMALKELQEKKKEKENIETARLKTMQLAMLIEKERAAEIANLPPPDIPLYLKESVINPEDMTPRVKVCDRNKFSVIESFENASYNVQRMNSDDQIFNFEADNAKSAAEFRQNEMIKMSTNLHVQAEEQFIKAHLRGHKAIKKQLVHKDYQELVSDLEHVAKGEMAKRQREYHKNELIGPNSAGHFGVGHNAAKMMFKEKCRERAVEAVVMESLKDITNSEKQNNSNEFDNKLLQSEIVIDNSYTKPQHKLSCLYDKIRKQKENVHFQDEVSQLPSELAVVDEEKKRIPVENNKQNFVSSQDFRELQPNDVTCDLDAEESSNIIRHALSATGRSNIVLEKSTRQKERHHLEDDFLQIDKRFDQLSTNFHEWRDATSVRSESTIEINSQNHHIHNSIGIQESEAHSIGSRSEDTRESNSIIKIKDFQRRAIMKLNGQLNTTQIATLEKQIANFSVDSNSITESFSNSLKSYTESNHSESKHSRSVVNEWVNSQLLQTVDKIPDWVTRATPKFIPDLNLSFERSIISIRSNDSSMRSVSSNLSSNTIASPRSSCNCPVHPSLTDISNEQNDYSESKHYLQSSKELLTSFDSKPIGNDSNNILLDDIMNENSLSIPPDEADRDLIDFQNTDDLSFSQDSKSNFMNIPEPQILEINTLGNYIDDATESNDNEITTILNLSNSNEAFYTADNICDSANNASLSEIASGAVMTASEITNASNANAELIINEYKRFLDNIAFKIDDSMLDKSEIKTGMLNIIPDEHESFDSFYSRDNPDAMNSVKKTQLLMKSGPPSDICSRIADNTATGEMASPPQHNNEMDNSNNNKFLSLSELSENTSLNNESNDIQLDREENEIRNVDQLLPSACTANHDTISSGINQSYFALESIGAPFSNNHDSLSSDTDQLVSMSSMDSNANTNLQLHNEPIKKIPNILSSTMKANKTHVFPSSPDVSSIHSESSVLLKQQIMKDYFEKNKERLQEVLHPSNSTQTASSKPTDFVDDETPRNPDSGKASSRYTTEHSGQSTERMGNDDILMTGRNDSLLTEYTVRDQWSSSHSNFQTLSELISLQQNDNLNRSEENEKMFHNSCNFNSKTSVDLIDFNSNMDLHDVPTSYSTTVPPVCSQDLSGSNLEHHQATPTSQKLSTLSNILSPYDRNLIDNNLYSDKSTTDCNSSPYKCLESIHSSEELDFNDLSTEQVHEFETILQFEDKTDINCSIDSKSEADMSTLSLVSFLRNESACQEQFTASNREISSESTPKKTTTKTNIENNQEMKIQLEKWKKERLQRINNNPPNEIKKSHITKDDNMRRKDIVETKSRTTKLWNQLEEVQKMKQRKEAEKIKLDNQLRKKEYAEKLRRIKTEKQKKVEKL 1480          
BLAST of Centrosomal protein 295 vs. Planmine SMEST
Match: SMESG000023095.1 (SMESG000023095.1)

HSP 1 Score: 2821.19 bits (7312), Expect = 0.000e+0
Identity = 1476/1480 (99.73%), Postives = 1476/1480 (99.73%), Query Frame = 1
Query:   88 MIRPSPNELERLRNEEIAKRRLMRLKEVREYSKANASKLRNLYKEHKLQVINKLAQTIQDQFNLEDSKKLNELKLKHSVQVNAVGNGHDNAADWVDPSIKTNEQLAINLAFADKRHQMALXXXXXXXXXXXXXXTARLKTMQLAMLIEKERAAEIANLPPPDIPLYLKESVINPEDMTPRVKVCDRNKFSVIESFENASYNVQRMNSDDQIFNFEADNAKSAAEFRQNEMIKMSTNLHVQAEEQFIKAHLRGHKAIKKQLVHKDYQELVSDLEHVAKGEMAKRQREYHKNELIGPNSAGHFGVGHNAAKMMFKEKCRERAVEAVVMESLKDITNSEKQNNSNEFDNKLLQSEIVIDNSYTKPQHKLSCLYDKIRKQKENVHFQDEVSQLPSELAVVDEEKKRIPVENNKQNFVSSQDFRELQPNDVTCDLDAEESSNIIRHALSATGRSNIVLEKSTRQKERHHLEDDFLQIDKRFDQLSTNFHEWRDATSVRSESTIEINSQNHHIHNSIGIQESEAHSIGSRSEDTRESNSIIKIKDFQRRAIMKLNGQLNTTQIATLEKQIANFSVDSNSITESFSNSLKSYTESNHSESKHSRSVVNEWVNSQLLQTVDKIPDWVTRATPKFIPDLNLSFEXXXXXXXXXXXXXXXXXXXXXXXXXXXPRSSCNCPVHPSLTDISNEQNDYSESKHYLQSSKELLTSFDSKPIGNDSNNILLDDIMNENSLSIPPDEADRDLIDFQNTDDLSFSQDSKSNFMNIPEPQILEINTLGNYIDDATESNDNEITTILNLSNSNEAFYTADNICDSANNASLSEIASGAVMTASEITNASNANAELIINEYKRFLDNIAFKIDDSMLDKSEIKTGMLNIIPDEHESFDSFYSRDNPDAMNSVKKTQLLMKSGPPSDICSRIADNTATGEMASPPQHNNEMDNSNNNKFXXXXXXXXXXXXXXXXXDIQLDREENEIRNVDQLLPSACTANHDTISSGINQSYFALESIGAPFSNNHDSLSSDTDQLVSMSSMDSNANTNLQLHNEPIKKIPNILSSTMKANKTHVFPSSPDVSSIHSESSVLLKQQIMKDYFEKNKERLQEVLHPSNSTQTASSKPTDFVDDETPRNPDSGKASSRYTTEHSGQSTERMGNDDILMTGRNDSLLTEYTVRDQWSSSHSNFQTLSELISLQQNDNLNRSEENEKMFHNSCNFNSKTSVDLIDFNSNMDLHDVPTSYSTTVPPVCSQDLSGSNLEHHQATPTSQKLSTLSNILSPYDRNLIDNNLYSDKSTTDCNSSPYKCLESIHSSEELDFNDLSTEQVHEFETILQFEDKTDINCSIDSKSEADMSTLSLVSFLRNESACQEQFTASNRXXXXXXXXXXXXXXXXXXXXQEMKIQLEKWKKERLQRINNNPPNEIKKSHITKDDNMRRKDIVETKSRTTKLWNQLEEVQKMKQRKEAEKIKLDNQLRKKEYAEKLRRIKTEKQKKVEKL 4527
            MIRPSPNELERLRNEEIAKRRLMRLKEVREYSKANASKLRNLYKEHKLQVINKLAQTIQDQFNLEDSKKLNELKLKHSVQVNAVGNGHDNAADWVDPSIKTNEQLAINLAFADKRHQMALKELQEKKKEKENIETARLKTMQLAMLIEKERAAEIANLPPPDIPLYLKESVINPEDMTPRVKVCDRNKFSVIESFENASYNVQRMNSDDQIFNFEADNAKSAAEFRQNEMIKMSTNLHVQAEEQFIKAHLRGHKAIKKQLVHKDYQELVSDLEHVAKGEMAKRQREYHKNELIGPNSAGHFGVGHNAAKMMFKEKCRERAVEAVVMESLKDITNSEKQNNSNEFDNKLLQSEIVIDNSYTKPQHKLSCLYDKIRKQKENVHFQDEVSQLPSELAVVDEEKKRIPVENNKQNFVSSQDFRELQPNDVTCDLDAEESSNIIRHALSATGRSNIVLEKSTRQKERHHLEDDFLQIDKRFDQLSTNFHEWRDATSVRSESTIEINSQNHHIHNSIGIQESEAHSIGSRSEDTRESNSIIKIKDFQRRAIMKLNGQLNTTQIATLEKQIANFSVDSNSITESFSNSLKSYTESNHSESKHSRSVVNEWVNSQLLQTVDKIPDWVTRATPKFIPDLNLSFERSIISIRSNDSSMRSVSSNLSSNTIASPRSSCNCPVHPSLTDISNEQNDYSESKHYLQSSKELLTSFDSKPIGNDSNNILLDDIMNENSLSIPPDEADRDLIDFQNTDDLSFSQDSKSNFMNIPEPQILEINTLGNYIDDATESNDNEITTILNLSNSNEAFYTADNICDSANNASLSEIASGAVMTASEITNASNANAELIINEYKRFLDNIAFKIDDSMLDKSEIKTGMLNIIPDEHESFDSFYSRDNPDAMNSVKKTQLLMKSGPPSDICSRIADNTATGEMASPPQHNNEMDNSNNNKFLSLSELSENTSLNNESNDIQLDREENEIRNVDQLLPSACTANHDTISSGINQSYFALESIGAPFSNNHDSLSSDTDQLVSMSSMDSNANTNLQLHNEPIKKIPNILSSTMKANKTHVFPSSPDVSSIHSESSVLLKQQIMKDYFEKNKERLQEVLHPSNSTQTASSKPTDFVDDETPRNPDSGKASSRYTTEHSGQSTERMGNDDILMTGRNDSLLTEYTVRDQWSSSHSNFQTLSELISLQQNDNLNRSEENEKMFHNSCNFNSKTSVDLIDFNSNMDLHDVPTSYSTTVPP    DLSGSNLEHHQATPTSQKLSTLSNILSPYDRNLIDNNLYSDKSTTDCNSSPYKCLESIHSSEELDFNDLSTEQVHEFETILQFEDKTDINCSIDSKSEADMSTLSLVSFLRNESACQEQFTASNREISSESTPKKTTTKTNIENNQEMKIQLEKWKKERLQRINNNPPNEIKKSHITKDDNMRRKDIVETKSRTTKLWNQLEEVQKMKQRKEAEKIKLDNQLRKKEYAEKLRRIKTEKQKKVEKL
Sbjct:    1 MIRPSPNELERLRNEEIAKRRLMRLKEVREYSKANASKLRNLYKEHKLQVINKLAQTIQDQFNLEDSKKLNELKLKHSVQVNAVGNGHDNAADWVDPSIKTNEQLAINLAFADKRHQMALKELQEKKKEKENIETARLKTMQLAMLIEKERAAEIANLPPPDIPLYLKESVINPEDMTPRVKVCDRNKFSVIESFENASYNVQRMNSDDQIFNFEADNAKSAAEFRQNEMIKMSTNLHVQAEEQFIKAHLRGHKAIKKQLVHKDYQELVSDLEHVAKGEMAKRQREYHKNELIGPNSAGHFGVGHNAAKMMFKEKCRERAVEAVVMESLKDITNSEKQNNSNEFDNKLLQSEIVIDNSYTKPQHKLSCLYDKIRKQKENVHFQDEVSQLPSELAVVDEEKKRIPVENNKQNFVSSQDFRELQPNDVTCDLDAEESSNIIRHALSATGRSNIVLEKSTRQKERHHLEDDFLQIDKRFDQLSTNFHEWRDATSVRSESTIEINSQNHHIHNSIGIQESEAHSIGSRSEDTRESNSIIKIKDFQRRAIMKLNGQLNTTQIATLEKQIANFSVDSNSITESFSNSLKSYTESNHSESKHSRSVVNEWVNSQLLQTVDKIPDWVTRATPKFIPDLNLSFERSIISIRSNDSSMRSVSSNLSSNTIASPRSSCNCPVHPSLTDISNEQNDYSESKHYLQSSKELLTSFDSKPIGNDSNNILLDDIMNENSLSIPPDEADRDLIDFQNTDDLSFSQDSKSNFMNIPEPQILEINTLGNYIDDATESNDNEITTILNLSNSNEAFYTADNICDSANNASLSEIASGAVMTASEITNASNANAELIINEYKRFLDNIAFKIDDSMLDKSEIKTGMLNIIPDEHESFDSFYSRDNPDAMNSVKKTQLLMKSGPPSDICSRIADNTATGEMASPPQHNNEMDNSNNNKFLSLSELSENTSLNNESNDIQLDREENEIRNVDQLLPSACTANHDTISSGINQSYFALESIGAPFSNNHDSLSSDTDQLVSMSSMDSNANTNLQLHNEPIKKIPNILSSTMKANKTHVFPSSPDVSSIHSESSVLLKQQIMKDYFEKNKERLQEVLHPSNSTQTASSKPTDFVDDETPRNPDSGKASSRYTTEHSGQSTERMGNDDILMTGRNDSLLTEYTVRDQWSSSHSNFQTLSELISLQQNDNLNRSEENEKMFHNSCNFNSKTSVDLIDFNSNMDLHDVPTSYSTTVPP----DLSGSNLEHHQATPTSQKLSTLSNILSPYDRNLIDNNLYSDKSTTDCNSSPYKCLESIHSSEELDFNDLSTEQVHEFETILQFEDKTDINCSIDSKSEADMSTLSLVSFLRNESACQEQFTASNREISSESTPKKTTTKTNIENNQEMKIQLEKWKKERLQRINNNPPNEIKKSHITKDDNMRRKDIVETKSRTTKLWNQLEEVQKMKQRKEAEKIKLDNQLRKKEYAEKLRRIKTEKQKKVEKL 1476          
The following BLAST results are available for this feature:
BLAST of Centrosomal protein 295 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CEP2951.402e-1026.01centrosomal protein 295 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of Centrosomal protein 295 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Centrosomal protein 295 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Centrosomal protein 295 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Centrosomal protein 295 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cep2954.530e-1531.63centrosomal protein 295 [Source:NCBI gene;Acc:1003... [more]
back to top
BLAST of Centrosomal protein 295 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Cep2954.154e-1225.61centrosomal protein 295 [Source:MGI Symbol;Acc:MGI... [more]
Cep2954.464e-1225.61centrosomal protein 295 [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of Centrosomal protein 295 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|A4L9P8|CE295_RAT9.653e-1227.72Centrosomal protein of 295 kDa OS=Rattus norvegicu... [more]
sp|Q8BQ48|CE295_MOUSE3.062e-1125.61Centrosomal protein of 295 kDa OS=Mus musculus OX=... [more]
sp|Q9C0D2|CE295_HUMAN6.732e-1026.01Centrosomal protein of 295 kDa OS=Homo sapiens OX=... [more]
back to top
BLAST of Centrosomal protein 295 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3S0Z9D06.526e-1929.73Uncharacterized protein (Fragment) OS=Elysia chlor... [more]
A0A4Z2CW572.459e-1730.13Centrosomal protein OS=Schistosoma japonicum OX=61... [more]
A0A1S3H5Z91.099e-1529.79centrosomal protein of 295 kDa OS=Lingula unguis O... [more]
A0A210QLS13.318e-1529.47Uncharacterized protein OS=Mizuhopecten yessoensis... [more]
U3J5706.190e-1527.93ALMS_motif domain-containing protein OS=Anas platy... [more]
back to top
BLAST of Centrosomal protein 295 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Centrosomal protein 295 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Centrosomal protein 295 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Centrosomal protein 295 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Centrosomal protein 295 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSORLT00000034256.13.905e-1225.52centrosomal protein 295 [Source:NCBI gene;Acc:1011... [more]
ENSORLT00000039695.14.441e-1225.52centrosomal protein 295 [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of Centrosomal protein 295 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000023095.10.000e+0100.00SMESG000023095.1[more]
SMESG000023095.10.000e+099.73SMESG000023095.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024396 ID=SMED30024396|Name=Centrosomal protein 295|organism=Schmidtea mediterranea sexual|type=transcript|length=4745bp
CTATATTCAGTTTTAGTTAGCAACAGATTAAATTATATTAATTTCATTAG
AAATTAACTTTGTATATAAAGAATTTAAAATTCCTTAATGATCCGACCGA
GTCCAAACGAACTTGAACGGTTGAGAAATGAAGAGATCGCTAAAAGACGT
TTGATGAGATTAAAAGAAGTTCGAGAATATTCAAAAGCAAACGCTTCTAA
ATTAAGAAATCTATACAAGGAGCATAAACTTCAAGTAATAAATAAACTTG
CCCAAACTATTCAAGACCAATTTAACTTGGAGGATTCTAAAAAACTTAAT
GAATTGAAATTGAAACACTCCGTTCAAGTGAATGCAGTCGGTAATGGTCA
TGACAATGCAGCAGATTGGGTTGATCCATCAATTAAAACTAATGAGCAAC
TTGCAATCAATCTAGCTTTTGCTGACAAACGGCATCAAATGGCTTTGAAA
GAATTGCAAGAAAAGAAAAAAGAAAAAGAAAACATAGAAACTGCTAGATT
AAAAACAATGCAATTGGCAATGCTAATAGAAAAAGAGCGGGCTGCTGAAA
TAGCAAATTTACCACCCCCTGATATACCGCTATATCTCAAGGAATCTGTT
ATAAACCCTGAAGATATGACTCCAAGAGTCAAAGTATGTGACAGAAATAA
ATTCTCAGTCATTGAAAGTTTTGAGAATGCCTCATACAATGTCCAACGAA
TGAATTCTGACGATCAAATTTTCAACTTTGAAGCTGATAATGCAAAAAGT
GCTGCTGAGTTTAGACAAAATGAAATGATTAAAATGTCTACAAACTTGCA
CGTTCAAGCAGAAGAACAATTCATTAAAGCTCATCTTAGGGGTCATAAAG
CTATAAAAAAACAGTTGGTGCATAAAGATTATCAAGAGCTCGTGTCAGAT
TTAGAGCACGTAGCCAAAGGTGAAATGGCTAAACGACAACGTGAATATCA
CAAAAATGAACTCATTGGACCAAATTCTGCCGGTCATTTTGGAGTCGGGC
ACAATGCTGCAAAGATGATGTTTAAAGAAAAATGCAGAGAACGAGCTGTA
GAAGCCGTAGTAATGGAATCATTGAAAGACATTACGAACAGTGAGAAGCA
AAACAACTCCAATGAATTCGATAATAAGTTATTACAGAGTGAAATTGTTA
TCGACAATTCTTATACAAAGCCCCAACACAAACTCTCTTGTCTCTACGAT
AAGATTAGAAAACAGAAAGAAAACGTTCATTTTCAAGATGAAGTTTCACA
ATTGCCTTCCGAATTGGCGGTTGTTGATGAGGAAAAGAAAAGAATACCTG
TTGAAAACAACAAACAAAACTTTGTTTCATCGCAGGACTTCAGAGAATTA
CAACCGAACGATGTAACATGTGACCTAGATGCTGAAGAATCCAGCAATAT
TATCCGACACGCTTTATCTGCAACTGGCCGATCTAATATTGTCCTTGAGA
AATCCACAAGACAGAAGGAACGGCATCATTTGGAAGATGATTTTCTTCAA
ATTGATAAAAGATTCGATCAACTTTCAACCAATTTCCACGAATGGCGTGA
CGCAACCTCTGTTCGTTCTGAAAGCACTATTGAAATCAATTCACAAAACC
ATCACATCCACAATTCGATTGGAATCCAGGAATCTGAGGCACATTCCATT
GGATCTAGATCAGAGGACACTCGAGAGTCAAATAGTATCATAAAAATCAA
AGACTTTCAAAGAAGAGCTATTATGAAATTGAACGGTCAGTTAAATACAA
CCCAAATAGCAACGTTAGAAAAACAAATCGCAAATTTTTCAGTTGATTCA
AACTCAATAACAGAAAGTTTCTCTAACTCCCTCAAATCTTACACCGAATC
CAATCATTCTGAATCGAAGCATTCAAGATCAGTTGTCAATGAATGGGTAA
ACAGCCAGCTATTGCAGACAGTAGACAAAATACCAGATTGGGTTACCAGA
GCAACTCCCAAATTCATTCCTGATTTAAATCTGTCATTTGAGCGCAGCAT
AATAAGCATAAGATCAAATGATTCTTCAATGAGATCAGTTTCATCGAATC
TCTCATCTAATACAATCGCTAGTCCGAGGAGCTCATGCAATTGCCCTGTC
CACCCAAGTTTAACGGACATAAGTAATGAGCAGAATGATTATTCCGAATC
TAAACATTATCTTCAATCTTCAAAAGAACTTTTAACCTCTTTTGATTCAA
AACCAATTGGAAATGATTCAAATAATATATTATTAGATGATATAATGAAT
GAGAATTCCTTGTCCATTCCTCCTGATGAGGCAGACAGAGATTTAATTGA
TTTCCAAAATACGGACGACTTAAGTTTTTCTCAAGATTCCAAATCAAACT
TTATGAATATACCTGAACCTCAAATCTTGGAAATAAATACATTAGGTAAT
TACATCGATGATGCAACAGAGAGCAATGACAATGAAATTACAACCATTTT
AAATCTTTCTAATTCGAATGAAGCCTTTTACACTGCCGACAATATTTGCG
ATAGTGCAAATAATGCGTCCCTGAGTGAAATTGCCTCTGGTGCGGTAATG
ACCGCTAGTGAGATCACTAATGCCAGTAATGCTAACGCTGAATTAATAAT
CAATGAATATAAGAGATTTCTTGATAACATTGCCTTTAAAATTGATGATT
CAATGCTTGATAAGAGCGAAATCAAAACCGGAATGCTAAATATTATTCCC
GATGAACATGAATCCTTTGACTCATTCTATTCCCGAGACAACCCGGATGC
GATGAACTCAGTGAAAAAAACCCAATTATTAATGAAATCAGGGCCTCCAT
CTGATATATGCAGTCGCATTGCAGATAATACCGCAACGGGGGAAATGGCT
TCTCCACCTCAACACAACAATGAAATGGATAATTCAAATAACAATAAATT
TCTTTCTCTTTCGGAATTATCAGAAAATACTTCATTGAACAATGAGAGTA
ACGATATACAGCTTGATAGGGAGGAGAACGAGATCAGAAATGTTGACCAA
TTATTGCCATCCGCCTGCACCGCCAATCATGATACGATATCATCAGGAAT
AAACCAATCATATTTTGCTCTTGAATCCATTGGTGCTCCATTCTCCAATA
ATCACGATTCATTATCCAGTGATACCGATCAGTTGGTATCTATGTCTTCC
ATGGATTCCAACGCAAACACGAATTTGCAGCTCCACAACGAGCCTATTAA
GAAAATCCCTAATATTCTCTCATCCACAATGAAGGCAAATAAAACTCATG
TTTTCCCATCTTCTCCCGACGTCAGCTCGATTCACAGCGAGTCCTCGGTT
CTACTTAAACAGCAAATTATGAAAGATTACTTTGAGAAAAACAAAGAACG
TCTGCAAGAAGTTTTGCATCCAAGCAATTCGACACAGACGGCTAGCTCCA
AACCCACCGATTTTGTTGATGATGAAACTCCAAGGAATCCGGATTCAGGA
AAAGCCAGCTCTAGGTATACAACGGAACATTCTGGCCAAAGCACAGAACG
AATGGGAAATGATGACATATTAATGACAGGACGCAATGACAGCCTGCTGA
CAGAGTACACAGTTCGTGACCAGTGGTCATCATCCCACAGCAACTTCCAG
ACTCTCTCTGAGTTGATTTCATTGCAGCAAAATGACAACTTAAATAGGTC
GGAAGAAAATGAAAAAATGTTCCATAACTCTTGCAATTTCAATTCCAAAA
CAAGTGTGGATTTAATAGATTTTAATTCCAATATGGATCTGCATGACGTC
CCAACCTCTTATTCCACAACTGTTCCACCAGTATGTTCTCAAGATCTTTC
GGGTTCCAATCTTGAACATCATCAAGCAACTCCGACCAGTCAAAAACTGT
CTACATTGTCCAATATTCTGTCACCGTACGACAGAAATCTAATTGATAAC
AATCTGTATTCCGACAAGTCGACAACCGATTGTAATTCCTCACCGTATAA
ATGTCTCGAATCAATCCATTCATCCGAAGAATTGGATTTCAATGACCTAT
CCACAGAACAAGTCCATGAATTCGAGACCATCTTACAATTTGAGGATAAA
ACTGATATCAACTGTTCAATTGATTCAAAATCCGAGGCTGATATGAGCAC
TCTATCTTTGGTATCGTTTTTGAGGAATGAATCTGCCTGTCAAGAACAAT
TTACGGCATCAAACAGGGAAATCAGCAGTGAGAGTACTCCGAAAAAAACT
ACTACCAAAACCAACATTGAAAACAATCAAGAAATGAAAATTCAACTTGA
AAAATGGAAAAAAGAAAGACTGCAGAGAATTAATAACAATCCTCCTAATG
AGATCAAAAAGTCCCATATAACTAAAGATGATAATATGCGTCGAAAAGAT
ATCGTTGAGACAAAATCTAGAACAACCAAATTATGGAATCAACTGGAAGA
AGTTCAAAAAATGAAGCAAAGAAAAGAAGCAGAAAAAATCAAACTGGATA
ACCAGTTGCGTAAGAAGGAATATGCTGAAAAGCTTAGGCGTATTAAAACG
GAAAAGCAAAAGAAAGTTGAAAAACTATAATAATACTGATAGGAAAAGCT
GTAAATTTCTATCACCACTATTCGATTATTTGGTGAAATGAGTTATTTGA
ATTTTTTTACCGAATTTATATATGAATATATCTTGCTTCTTCCCTTGCAT
CTCCATGATTCTATTTATTTTTTTAGCAATCTTGCGATCCACTGCTGCAG
TAATTATCTTCATTCCATCAATATCAGATTTGTGTAGAGCTTAAT
back to top

protein sequence of SMED30024396-orf-1

>SMED30024396-orf-1 ID=SMED30024396-orf-1|Name=SMED30024396-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1481bp
MIRPSPNELERLRNEEIAKRRLMRLKEVREYSKANASKLRNLYKEHKLQV
INKLAQTIQDQFNLEDSKKLNELKLKHSVQVNAVGNGHDNAADWVDPSIK
TNEQLAINLAFADKRHQMALKELQEKKKEKENIETARLKTMQLAMLIEKE
RAAEIANLPPPDIPLYLKESVINPEDMTPRVKVCDRNKFSVIESFENASY
NVQRMNSDDQIFNFEADNAKSAAEFRQNEMIKMSTNLHVQAEEQFIKAHL
RGHKAIKKQLVHKDYQELVSDLEHVAKGEMAKRQREYHKNELIGPNSAGH
FGVGHNAAKMMFKEKCRERAVEAVVMESLKDITNSEKQNNSNEFDNKLLQ
SEIVIDNSYTKPQHKLSCLYDKIRKQKENVHFQDEVSQLPSELAVVDEEK
KRIPVENNKQNFVSSQDFRELQPNDVTCDLDAEESSNIIRHALSATGRSN
IVLEKSTRQKERHHLEDDFLQIDKRFDQLSTNFHEWRDATSVRSESTIEI
NSQNHHIHNSIGIQESEAHSIGSRSEDTRESNSIIKIKDFQRRAIMKLNG
QLNTTQIATLEKQIANFSVDSNSITESFSNSLKSYTESNHSESKHSRSVV
NEWVNSQLLQTVDKIPDWVTRATPKFIPDLNLSFERSIISIRSNDSSMRS
VSSNLSSNTIASPRSSCNCPVHPSLTDISNEQNDYSESKHYLQSSKELLT
SFDSKPIGNDSNNILLDDIMNENSLSIPPDEADRDLIDFQNTDDLSFSQD
SKSNFMNIPEPQILEINTLGNYIDDATESNDNEITTILNLSNSNEAFYTA
DNICDSANNASLSEIASGAVMTASEITNASNANAELIINEYKRFLDNIAF
KIDDSMLDKSEIKTGMLNIIPDEHESFDSFYSRDNPDAMNSVKKTQLLMK
SGPPSDICSRIADNTATGEMASPPQHNNEMDNSNNNKFLSLSELSENTSL
NNESNDIQLDREENEIRNVDQLLPSACTANHDTISSGINQSYFALESIGA
PFSNNHDSLSSDTDQLVSMSSMDSNANTNLQLHNEPIKKIPNILSSTMKA
NKTHVFPSSPDVSSIHSESSVLLKQQIMKDYFEKNKERLQEVLHPSNSTQ
TASSKPTDFVDDETPRNPDSGKASSRYTTEHSGQSTERMGNDDILMTGRN
DSLLTEYTVRDQWSSSHSNFQTLSELISLQQNDNLNRSEENEKMFHNSCN
FNSKTSVDLIDFNSNMDLHDVPTSYSTTVPPVCSQDLSGSNLEHHQATPT
SQKLSTLSNILSPYDRNLIDNNLYSDKSTTDCNSSPYKCLESIHSSEELD
FNDLSTEQVHEFETILQFEDKTDINCSIDSKSEADMSTLSLVSFLRNESA
CQEQFTASNREISSESTPKKTTTKTNIENNQEMKIQLEKWKKERLQRINN
NPPNEIKKSHITKDDNMRRKDIVETKSRTTKLWNQLEEVQKMKQRKEAEK
IKLDNQLRKKEYAEKLRRIKTEKQKKVEKL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005814centriole
GO:0005829cytosol
GO:0005856cytoskeleton
GO:0005886plasma membrane
GO:1990498mitotic spindle microtubule
GO:0005813centrosome
Vocabulary: molecular function
TermDefinition
GO:0008017microtubule binding
Vocabulary: biological process
TermDefinition
GO:0010825positive regulation of centrosome duplication
GO:1901985positive regulation of protein acetylation
GO:1903724positive regulation of centriole elongation
GO:1904951positive regulation of establishment of protein localization
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 1436..1479
NoneNo IPR availableCOILSCoilCoilcoord: 109..136
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1093..1144
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1120..1141
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1093..1108
NoneNo IPR availablePANTHERPTHR21553:SF34coord: 3..285
NoneNo IPR availablePANTHERPTHR21553ALMS1-RELATEDcoord: 3..285