RING-type domain-containing protein

Overview
NameRING-type domain-containing protein
Smed IDSMED30024395
Length (bp)853
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of RING-type domain-containing protein (SMED30024395) t-SNE clustered cells

Violin plots show distribution of expression levels for RING-type domain-containing protein (SMED30024395) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of RING-type domain-containing protein (SMED30024395) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for RING-type domain-containing protein (SMED30024395) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024395

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neoblastSMED30024395SMESG000036540.1 SMESG000065035.1 dd_Smed_v4_1180_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30024395SMESG000036540.1 SMESG000065035.1 dd_Smed_v4_1180_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30024395SMESG000036540.1 Contig42679newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30024395SMESG000036540.1 Contig42679uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30024395SMESG000036540.1 SMESG000065035.1 dd_Smed_v4_1180_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of RING-type domain-containing protein vs. Ensembl Human
Match: RNF126 (ring finger protein 126 [Source:HGNC Symbol;Acc:HGNC:21151])

HSP 1 Score: 116.316 bits (290), Expect = 3.407e-30
Identity = 69/248 (27.82%), Postives = 114/248 (45.97%), Query Frame = 3
Query:   33 ATINTDNYFCHKCNRD-VHISQDGKCVTCNDGFIERIESD----------NSMESDDDALNVFHIIRHI------------------------PSGSTTNETDGSFFITPRDHDNRNSVFGQLISNLF-----GGLLPLD-FRSDPSDYIFSDQSFDNFVTRIMNQFEQSGPPPANEADIEKLQVTKITE----ANDTCSICLSDYEVGDEVYELPCQHKYHVQCLKTWLIKHGTCPICRKDLSGNDT 641
            A+ +   YFCH C+ + V    D  C  C  GFIE +  +          ++  +D     + H+ +H+                        P G+  ++         RDH +R+ +  QL++ +        L P     S+P DY +     D  +T+++NQFE +GPPPA++  I+ L    +TE    +   C +C  DY +G+ V +LPC H +H  C+  WL +H +CP+CRK L+G +T
Sbjct:    4 ASPHPGRYFCHCCSVEIVPRLPDYICPRCESGFIEELPEETRSTENGSAPSTAPTDQSRPPLEHVDQHLFTLPQGYGQFAFGIFDDSFEIPTFPPGAQADDGRDPESRRERDHPSRHRIIQQLVNGIITPATIPSLGPWGVLHSNPMDYAWGANGLDAIITQLLNQFENTGPPPADKEKIQALPTVPVTEEHVGSGLECPVCKDDYALGERVRQLPCNHLFHDGCIVPWLEQHDSCPVCRKSLTGQNT 251          
BLAST of RING-type domain-containing protein vs. Ensembl Human
Match: RNF126 (ring finger protein 126 [Source:HGNC Symbol;Acc:HGNC:21151])

HSP 1 Score: 102.449 bits (254), Expect = 6.880e-25
Identity = 69/275 (25.09%), Postives = 114/275 (41.45%), Query Frame = 3
Query:   33 ATINTDNYFCHKCNRD-VHISQDGKCVTCNDGFIERIESD----------NSMESDDDALNVFHIIRHI------------------------PSGSTTNETDGSFFITPRDHDNRNSVFGQ-----------------------LISNLFGGLL---------PLD-FRSDPSDYIFSDQSFDNFVTRIMNQFEQSGPPPANEADIEKLQVTKITE----ANDTCSICLSDYEVGDEVYELPCQHKYHVQCLKTWLIKHGTCPICRKDLSGNDT 641
            A+ +   YFCH C+ + V    D  C  C  GFIE +  +          ++  +D     + H+ +H+                        P G+  ++         RDH +R+    +                       +I  L  G++         P     S+P DY +     D  +T+++NQFE +GPPPA++  I+ L    +TE    +   C +C  DY +G+ V +LPC H +H  C+  WL +H +CP+CRK L+G +T
Sbjct:    4 ASPHPGRYFCHCCSVEIVPRLPDYICPRCESGFIEELPEETRSTENGSAPSTAPTDQSRPPLEHVDQHLFTLPQGYGQFAFGIFDDSFEIPTFPPGAQADDGRDPESRRERDHPSRHRYGARQPRARLTTRRATGRHEGVPTLEGIIQQLVNGIITPATIPSLGPWGVLHSNPMDYAWGANGLDAIITQLLNQFENTGPPPADKEKIQALPTVPVTEEHVGSGLECPVCKDDYALGERVRQLPCNHLFHDGCIVPWLEQHDSCPVCRKSLTGQNT 278          
BLAST of RING-type domain-containing protein vs. Ensembl Human
Match: RNF115 (ring finger protein 115 [Source:HGNC Symbol;Acc:HGNC:18154])

HSP 1 Score: 98.5969 bits (244), Expect = 1.961e-23
Identity = 48/125 (38.40%), Postives = 68/125 (54.40%), Query Frame = 3
Query:  333 FRSDPSDYIFSDQSFDNFVTRIMNQFEQSGPPPANEADIEKLQVTKITE----ANDTCSICLSDYEVGDEVYELPCQHKYHVQCLKTWLIKHGTCPICRKDLSGNDTRLESHDHIAQSS---SND 686
              S+P DY +     D  VT+++ Q E +GPPPA++  I  L    +T+        C +C  DY V +EV +LPC H +H  C+  WL  H TCP+CRK L+G D+  +S    A +S   SND
Sbjct:  171 LHSNPGDYAWGQTGLDAIVTQLLGQLENTGPPPADKEKITSLPTVTVTQEQVDMGLECPVCKEDYTVEEEVRQLPCNHFFHSSCIVPWLELHDTCPVCRKSLNGEDSTRQSQSTEASASNRFSND 295          
BLAST of RING-type domain-containing protein vs. Ensembl Human
Match: RLIM (ring finger protein, LIM domain interacting [Source:HGNC Symbol;Acc:HGNC:13429])

HSP 1 Score: 69.707 bits (169), Expect = 9.036e-13
Identity = 31/84 (36.90%), Postives = 52/84 (61.90%), Query Frame = 3
Query:  396 IMNQFEQSGPPPANEADIEKLQVTKITE--ANDTCSICLSDYEVGDEVYELPCQHKYHVQCLKTWLIKHGTCPICRKDL--SGN 635
            ++N+ +   P    +  I+ L +    E  A  TCS+C+++Y  G+++ +LPC H+YHV C+  WL ++ TCPICR+ +  SGN
Sbjct:  536 LLNEDDDDQPRGLTKEQIDNLAMRSFGENDALKTCSVCITEYTEGNKLRKLPCSHEYHVHCIDRWLSENSTCPICRRAVLASGN 619          
BLAST of RING-type domain-containing protein vs. Ensembl Human
Match: RLIM (ring finger protein, LIM domain interacting [Source:HGNC Symbol;Acc:HGNC:13429])

HSP 1 Score: 69.707 bits (169), Expect = 9.036e-13
Identity = 31/84 (36.90%), Postives = 52/84 (61.90%), Query Frame = 3
Query:  396 IMNQFEQSGPPPANEADIEKLQVTKITE--ANDTCSICLSDYEVGDEVYELPCQHKYHVQCLKTWLIKHGTCPICRKDL--SGN 635
            ++N+ +   P    +  I+ L +    E  A  TCS+C+++Y  G+++ +LPC H+YHV C+  WL ++ TCPICR+ +  SGN
Sbjct:  536 LLNEDDDDQPRGLTKEQIDNLAMRSFGENDALKTCSVCITEYTEGNKLRKLPCSHEYHVHCIDRWLSENSTCPICRRAVLASGN 619          
BLAST of RING-type domain-containing protein vs. Ensembl Celegans
Match: H10E21.5 (pep chromosome:WBcel235:III:20531:23962:-1 gene:WBGene00019185.1 transcript:H10E21.5.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:H10E21.5)

HSP 1 Score: 61.6178 bits (148), Expect = 1.645e-10
Identity = 21/50 (42.00%), Postives = 33/50 (66.00%), Query Frame = 3
Query:  477 EANDTCSICLSDYEVGDEVYELPCQHKYHVQCLKTWLIKHGTCPICRKDL 626
            E    C++CL  Y++ D +  LPC+H YH  C+  WL++H TCP+C+ D+
Sbjct:  222 ELQSDCAVCLDPYQLQDVIRLLPCKHIYHKSCIDPWLLEHRTCPMCKNDI 271          
BLAST of RING-type domain-containing protein vs. Ensembl Celegans
Match: C01G6.4 (pep chromosome:WBcel235:II:9271265:9273042:-1 gene:WBGene00007226.1 transcript:C01G6.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C01G6.4)

HSP 1 Score: 54.6842 bits (130), Expect = 5.523e-9
Identity = 19/44 (43.18%), Postives = 30/44 (68.18%), Query Frame = 3
Query:  483 NDTCSICLSDYEVGDEVYELPCQHKYHVQCLKTWLIKHGTCPIC 614
            ++ C+IC+ D+E G+ +  LPC H +H +C+  WL+K  TCP C
Sbjct:   92 SNECAICMIDFEPGERIRFLPCMHSFHQECVDEWLMKSFTCPSC 135          
BLAST of RING-type domain-containing protein vs. Ensembl Celegans
Match: C18B12.4 (pep chromosome:WBcel235:X:15036662:15040602:-1 gene:WBGene00007666.1 transcript:C18B12.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C18B12.4)

HSP 1 Score: 56.225 bits (134), Expect = 8.060e-9
Identity = 27/88 (30.68%), Postives = 50/88 (56.82%), Query Frame = 3
Query:  435 NEADIEKLQVTKITEAND--TCSICLSDYEVGDEVYELPCQHKYHVQCLKTWLIK-HGTCPICRKDLSGNDTRLESHDHIAQSSSNDP 689
            ++ +++K+ V K    +D  TC+ICL  +  G+++  LPC+H +H  C+  WL +    CP+C++ + G D+  E   +   S+S  P
Sbjct:  226 SKRNLKKIPVKKYRLGDDPDTCAICLESFASGEKLRHLPCRHVFHCNCIDVWLTQTRKICPLCKRKI-GTDSDSECSTNDLASTSQGP 312          
BLAST of RING-type domain-containing protein vs. Ensembl Celegans
Match: toe-4 (Target Of ERK kinase MPK-1 [Source:UniProtKB/TrEMBL;Acc:Q9XUM8])

HSP 1 Score: 55.8398 bits (133), Expect = 1.344e-8
Identity = 20/50 (40.00%), Postives = 34/50 (68.00%), Query Frame = 3
Query:  477 EANDTCSICLSDYEVGDEVYELPCQHKYHVQCLKTWLIKHGTCPICRKDL 626
            E  DTC++CLS +E G+ + +L C H +H +C+  WL  +  CP+CR+++
Sbjct:  428 EDEDTCTVCLSSFEDGESIQKLRCNHVFHPECIYKWLDINKRCPMCREEI 477          
BLAST of RING-type domain-containing protein vs. Ensembl Celegans
Match: plr-1 (Probable E3 ubiquitin-protein ligase plr-1 [Source:UniProtKB/Swiss-Prot;Acc:Q9U2B7])

HSP 1 Score: 53.1434 bits (126), Expect = 8.101e-8
Identity = 20/49 (40.82%), Postives = 31/49 (63.27%), Query Frame = 3
Query:  480 ANDTCSICLSDYEVGDEVYELPCQHKYHVQCLKTWLIKHGTCPICRKDL 626
            A + C ICL +YE G E+  L C H++H +C+  WL+    CP+C+ D+
Sbjct:  313 AQERCVICLEEYEEGTELRVLFCGHEFHPKCVDPWLLSKRRCPLCQFDV 361          
BLAST of RING-type domain-containing protein vs. Ensembl Fly
Match: Iru (gene:FBgn0037653 transcript:FBtr0081965)

HSP 1 Score: 95.9005 bits (237), Expect = 2.431e-22
Identity = 46/109 (42.20%), Postives = 63/109 (57.80%), Query Frame = 3
Query:  333 FRSDPSDYIFSDQSFDNFVTRIMNQFEQSGPPPANEADIEKLQVTKIT--EANDT--CSICLSDYEVGDEVYELPCQHKYHVQCLKTWLIKHGTCPICRKDLS--GNDT 641
            F  +P DY +  +  D  VT+++NQ E SGPPP +   I ++   +I   E N    CSIC  D+++ + V +LPC H YH  C+  WL  H TCPICRK L+  GND 
Sbjct:  196 FMGNPGDYAWGREGLDTIVTQMLNQMETSGPPPLSAQRINEIPNVQINAEEVNRKIQCSICWDDFKIDETVRKLPCSHLYHENCIVPWLNLHSTCPICRKSLADDGNDA 304          
BLAST of RING-type domain-containing protein vs. Ensembl Fly
Match: CG7694 (gene:FBgn0038627 transcript:FBtr0290211)

HSP 1 Score: 59.3066 bits (142), Expect = 1.028e-10
Identity = 33/104 (31.73%), Postives = 54/104 (51.92%), Query Frame = 3
Query:  387 VTRIMNQFEQS-GPPPANEADIEKLQVTKITEAND----TCSICLSDYEVGDEVYELPCQHKYHVQCLKTWLIKHGTCPICRKDLSGNDTRLESHDHIAQSSSN 683
            V  IMN  +     P A++  I +L V +I ++++     CS+C    E G +   LPC+H++H +C+  WL K  +CP+CR +L  +D   E      Q  +N
Sbjct:   30 VLAIMNGIDMEIEVPEASKRAILELPVHEIVKSDEGGDLECSVCKEPAEEGQKYRILPCKHEFHEECILLWLKKTNSCPLCRYELETDDPVYEELRRFRQDEAN 133          
BLAST of RING-type domain-containing protein vs. Ensembl Fly
Match: CG7694 (gene:FBgn0038627 transcript:FBtr0083632)

HSP 1 Score: 59.3066 bits (142), Expect = 1.028e-10
Identity = 33/104 (31.73%), Postives = 54/104 (51.92%), Query Frame = 3
Query:  387 VTRIMNQFEQS-GPPPANEADIEKLQVTKITEAND----TCSICLSDYEVGDEVYELPCQHKYHVQCLKTWLIKHGTCPICRKDLSGNDTRLESHDHIAQSSSN 683
            V  IMN  +     P A++  I +L V +I ++++     CS+C    E G +   LPC+H++H +C+  WL K  +CP+CR +L  +D   E      Q  +N
Sbjct:   30 VLAIMNGIDMEIEVPEASKRAILELPVHEIVKSDEGGDLECSVCKEPAEEGQKYRILPCKHEFHEECILLWLKKTNSCPLCRYELETDDPVYEELRRFRQDEAN 133          
BLAST of RING-type domain-containing protein vs. Ensembl Fly
Match: CG7694 (gene:FBgn0038627 transcript:FBtr0344291)

HSP 1 Score: 59.3066 bits (142), Expect = 1.028e-10
Identity = 33/104 (31.73%), Postives = 54/104 (51.92%), Query Frame = 3
Query:  387 VTRIMNQFEQS-GPPPANEADIEKLQVTKITEAND----TCSICLSDYEVGDEVYELPCQHKYHVQCLKTWLIKHGTCPICRKDLSGNDTRLESHDHIAQSSSN 683
            V  IMN  +     P A++  I +L V +I ++++     CS+C    E G +   LPC+H++H +C+  WL K  +CP+CR +L  +D   E      Q  +N
Sbjct:   30 VLAIMNGIDMEIEVPEASKRAILELPVHEIVKSDEGGDLECSVCKEPAEEGQKYRILPCKHEFHEECILLWLKKTNSCPLCRYELETDDPVYEELRRFRQDEAN 133          
BLAST of RING-type domain-containing protein vs. Ensembl Fly
Match: gol (gene:FBgn0004919 transcript:FBtr0300179)

HSP 1 Score: 59.6918 bits (143), Expect = 8.225e-10
Identity = 21/48 (43.75%), Postives = 34/48 (70.83%), Query Frame = 3
Query:  483 NDTCSICLSDYEVGDEVYELPCQHKYHVQCLKTWLIKHGTCPICRKDL 626
            +D C+IC+  Y+  D +  LPC+H++H  C+  WLI+H TCP+C+ D+
Sbjct:  300 SDCCAICIEAYKPTDTIRILPCKHEFHKNCIDPWLIEHRTCPMCKLDV 347          
BLAST of RING-type domain-containing protein vs. Ensembl Zebrafish
Match: rnf126 (ring finger protein 126 [Source:ZFIN;Acc:ZDB-GENE-070209-292])

HSP 1 Score: 102.834 bits (255), Expect = 3.312e-25
Identity = 44/107 (41.12%), Postives = 64/107 (59.81%), Query Frame = 3
Query:  333 FRSDPSDYIFSDQSFDNFVTRIMNQFEQSGPPPANEADIEKLQVTKITE----ANDTCSICLSDYEVGDEVYELPCQHKYHVQCLKTWLIKHGTCPICRKDLSGNDT 641
              S+P DY +     D  +T+++NQFE +GPPPA++  I+ L   +I +    A   C +C  DY  G+ V +LPC H +H  C+  WL +H TCP+CRK LSG +T
Sbjct:  169 LHSNPMDYAWGANGLDAIITQLLNQFENTGPPPADKDKIKSLPTVQIKQEHVGAGLECPVCKEDYSAGENVRQLPCNHLFHNDCIVPWLEQHDTCPVCRKSLSGQNT 275          
BLAST of RING-type domain-containing protein vs. Ensembl Zebrafish
Match: rnf115 (ring finger protein 115 [Source:ZFIN;Acc:ZDB-GENE-061215-82])

HSP 1 Score: 100.523 bits (249), Expect = 2.524e-24
Identity = 49/137 (35.77%), Postives = 74/137 (54.01%), Query Frame = 3
Query:  282 VFGQLISNLFG-----GLLPLDF----RSDPSDYIFSDQSFDNFVTRIMNQFEQSGPPPANEADIEKLQVTKITE----ANDTCSICLSDYEVGDEVYELPCQHKYHVQCLKTWLIKHGTCPICRKDLSGNDTRLES 653
            +  Q ++ LF      G  P+ +     S+P DY +     D  +T+++ QFE +GPPPA +  I  L    IT+     N  C +C  DY VG+ V +LPC H +H  C+  WL  H TCP+CRK L+G+++  +S
Sbjct:  155 IVQQFLAGLFANSGVPGSPPVSWTSMLHSNPGDYAWGQGGLDAVITQLLGQFENTGPPPAEKEKISSLPTVIITQEHTDCNMECPVCKEDYTVGEPVRQLPCNHFFHSDCIVPWLELHDTCPVCRKSLNGDESGTQS 291          
BLAST of RING-type domain-containing protein vs. Ensembl Zebrafish
Match: si:ch211-81a5.1 (si:ch211-81a5.1 [Source:ZFIN;Acc:ZDB-GENE-060503-608])

HSP 1 Score: 92.8189 bits (229), Expect = 1.167e-21
Identity = 41/106 (38.68%), Postives = 56/106 (52.83%), Query Frame = 3
Query:  333 FRSDPSDYIFSDQSFDNFVTRIMNQFEQSGPPPANEADIEKLQVTKITEANDTC----SICLSDYEVGDEVYELPCQHKYHVQCLKTWLIKHGTCPICRKDLSGND 638
              S+P DY +     D  VT+++ Q E SGPPPA +  I  L    I+     C     +C  ++ VG+ V +LPC H +H  C+  WL  H TCP+CRK L G D
Sbjct:  145 LHSNPGDYAWGQGGLDAVVTQLLGQSENSGPPPAEKEMISSLPTVSISSEQAACRLECPVCREEFSVGESVRQLPCLHYFHSSCIVPWLQLHDTCPVCRKSLDGED 250          
BLAST of RING-type domain-containing protein vs. Ensembl Zebrafish
Match: si:ch211-81a5.1 (si:ch211-81a5.1 [Source:ZFIN;Acc:ZDB-GENE-060503-608])

HSP 1 Score: 92.8189 bits (229), Expect = 1.423e-21
Identity = 41/106 (38.68%), Postives = 56/106 (52.83%), Query Frame = 3
Query:  333 FRSDPSDYIFSDQSFDNFVTRIMNQFEQSGPPPANEADIEKLQVTKITEANDTC----SICLSDYEVGDEVYELPCQHKYHVQCLKTWLIKHGTCPICRKDLSGND 638
              S+P DY +     D  VT+++ Q E SGPPPA +  I  L    I+     C     +C  ++ VG+ V +LPC H +H  C+  WL  H TCP+CRK L G D
Sbjct:  168 LHSNPGDYAWGQGGLDAVVTQLLGQSENSGPPPAEKEMISSLPTVSISSEQAACRLECPVCREEFSVGESVRQLPCLHYFHSSCIVPWLQLHDTCPVCRKSLDGED 273          
BLAST of RING-type domain-containing protein vs. Ensembl Zebrafish
Match: si:ch211-59o9.10 (si:ch211-59o9.10 [Source:ZFIN;Acc:ZDB-GENE-101206-1])

HSP 1 Score: 69.707 bits (169), Expect = 4.649e-13
Identity = 33/98 (33.67%), Postives = 54/98 (55.10%), Query Frame = 3
Query:  357 IFSDQSFDNFVTRIMNQFEQSGPPPAN---EADIEKLQVTKI----TEANDTCSICLSDYEVGDEVYELPCQHKYHVQCLKTWLIKHGTCPICRKDLS 629
            +F+D   +N+   +  + +Q      N   +A+IE+L +       +     C IC S+Y+ G+ +  LPC H YHV+C+  WL ++ TCPICR D+S
Sbjct:  371 LFNDSQGNNYEALLAFEEQQGAVMAKNTLSKAEIERLPIKTYDPTHSAGKTDCQICFSEYKAGERLRMLPCLHDYHVKCIDRWLKENATCPICRADVS 468          
BLAST of RING-type domain-containing protein vs. Ensembl Xenopus
Match: rnf126 (ring finger protein 126 [Source:NCBI gene;Acc:448402])

HSP 1 Score: 108.612 bits (270), Expect = 4.780e-27
Identity = 50/119 (42.02%), Postives = 71/119 (59.66%), Query Frame = 3
Query:  297 ISNLFGGLLPLDFRSDPSDYIFSDQSFDNFVTRIMNQFEQSGPPPANEADIEKLQVTKITE----ANDTCSICLSDYEVGDEVYELPCQHKYHVQCLKTWLIKHGTCPICRKDLSGNDT 641
            +  L GG+L     S+P DY +     D  +T+++NQFE +GPPPA+   I+ L   +ITE    +   C +C  DY VG+ V +LPC H +H  C+  WL +H TCP+CRK LSG +T
Sbjct:  180 VPTLEGGVL----HSNPMDYAWGANGLDTIITQLLNQFENTGPPPADTEKIQALPTIQITEEHVGSGLECPVCKEDYTVGESVRQLPCNHLFHNDCIIPWLEQHDTCPVCRKSLSGQNT 294          
BLAST of RING-type domain-containing protein vs. Ensembl Xenopus
Match: rnf126 (ring finger protein 126 [Source:NCBI gene;Acc:448402])

HSP 1 Score: 107.071 bits (266), Expect = 2.353e-26
Identity = 51/120 (42.50%), Postives = 72/120 (60.00%), Query Frame = 3
Query:  297 ISNLFGGLLPLD-FRSDPSDYIFSDQSFDNFVTRIMNQFEQSGPPPANEADIEKLQVTKITE----ANDTCSICLSDYEVGDEVYELPCQHKYHVQCLKTWLIKHGTCPICRKDLSGNDT 641
            +SNL  G+ P     S+P DY +     D  +T+++NQFE +GPPPA+   I+ L   +ITE    +   C +C  DY VG+ V +LPC H +H  C+  WL +H TCP+CRK LSG +T
Sbjct:  185 MSNL--GVGPWGVLHSNPMDYAWGANGLDTIITQLLNQFENTGPPPADTEKIQALPTIQITEEHVGSGLECPVCKEDYTVGESVRQLPCNHLFHNDCIIPWLEQHDTCPVCRKSLSGQNT 302          
BLAST of RING-type domain-containing protein vs. Ensembl Xenopus
Match: stxbp3 (syntaxin binding protein 3 [Source:Xenbase;Acc:XB-GENE-963836])

HSP 1 Score: 97.8265 bits (242), Expect = 1.632e-23
Identity = 49/156 (31.41%), Postives = 78/156 (50.00%), Query Frame = 3
Query:  270 NRNSVFGQLISNLFGGLL----------PLDF----RSDPSDYIFSDQSFDNFVTRIMNQFEQSGPPPANEADIEKLQVTKITEANDT----CSICLSDYEVGDEVYELPCQHKYHVQCLKTWLIKHGTCPICRKDLSGNDTRLESHDHIAQSSSN 683
            +R+     +I  +F G+           PL +     S+P DY +     D+ VT+++ Q E +GPPPA++  I  L    +T         C +C  DY + ++V +LPC H +H  C+  WL  H TCP+CRK L+G D+  ++    A  S+N
Sbjct:  100 DRSPAIEGIIQQIFAGVFANPPFPGSPHPLSWSGMLHSNPGDYAWGQSGLDSIVTQLLGQLENTGPPPADKDKIVSLPTVTVTREQVAMGLECPVCKEDYAIEEQVRQLPCNHFFHGDCIVPWLELHDTCPVCRKSLNGEDSTRQAPSSEASGSNN 255          
BLAST of RING-type domain-containing protein vs. Ensembl Xenopus
Match: stxbp3 (syntaxin binding protein 3 [Source:Xenbase;Acc:XB-GENE-963836])

HSP 1 Score: 97.4413 bits (241), Expect = 3.007e-23
Identity = 49/156 (31.41%), Postives = 78/156 (50.00%), Query Frame = 3
Query:  270 NRNSVFGQLISNLFGGLL----------PLDF----RSDPSDYIFSDQSFDNFVTRIMNQFEQSGPPPANEADIEKLQVTKITEANDT----CSICLSDYEVGDEVYELPCQHKYHVQCLKTWLIKHGTCPICRKDLSGNDTRLESHDHIAQSSSN 683
            +R+     +I  +F G+           PL +     S+P DY +     D+ VT+++ Q E +GPPPA++  I  L    +T         C +C  DY + ++V +LPC H +H  C+  WL  H TCP+CRK L+G D+  ++    A  S+N
Sbjct:  111 DRSPAIEGIIQQIFAGVFANPPFPGSPHPLSWSGMLHSNPGDYAWGQSGLDSIVTQLLGQLENTGPPPADKDKIVSLPTVTVTREQVAMGLECPVCKEDYAIEEQVRQLPCNHFFHGDCIVPWLELHDTCPVCRKSLNGEDSTRQAPSSEASGSNN 266          
BLAST of RING-type domain-containing protein vs. Ensembl Xenopus
Match: stxbp3 (syntaxin binding protein 3 [Source:Xenbase;Acc:XB-GENE-963836])

HSP 1 Score: 97.0561 bits (240), Expect = 5.005e-23
Identity = 49/156 (31.41%), Postives = 78/156 (50.00%), Query Frame = 3
Query:  270 NRNSVFGQLISNLFGGLL----------PLDF----RSDPSDYIFSDQSFDNFVTRIMNQFEQSGPPPANEADIEKLQVTKITEANDT----CSICLSDYEVGDEVYELPCQHKYHVQCLKTWLIKHGTCPICRKDLSGNDTRLESHDHIAQSSSN 683
            +R+     +I  +F G+           PL +     S+P DY +     D+ VT+++ Q E +GPPPA++  I  L    +T         C +C  DY + ++V +LPC H +H  C+  WL  H TCP+CRK L+G D+  ++    A  S+N
Sbjct:  127 DRSPAIEGIIQQIFAGVFANPPFPGSPHPLSWSGMLHSNPGDYAWGQSGLDSIVTQLLGQLENTGPPPADKDKIVSLPTVTVTREQVAMGLECPVCKEDYAIEEQVRQLPCNHFFHGDCIVPWLELHDTCPVCRKSLNGEDSTRQAPSSEASGSNN 282          
BLAST of RING-type domain-containing protein vs. Ensembl Mouse
Match: Rnf126 (ring finger protein 126 [Source:MGI Symbol;Acc:MGI:1917544])

HSP 1 Score: 103.605 bits (257), Expect = 2.087e-25
Identity = 45/114 (39.47%), Postives = 68/114 (59.65%), Query Frame = 3
Query:  315 GLLPLD-FRSDPSDYIFSDQSFDNFVTRIMNQFEQSGPPPANEADIEKLQVTKITE----ANDTCSICLSDYEVGDEVYELPCQHKYHVQCLKTWLIKHGTCPICRKDLSGNDT 641
            GL P     S+P DY +     D  +T+++NQFE +GPPPA++  I+ L    +TE    +   C +C  DY +G+ V +LPC H +H  C+  WL +H +CP+CRK L+G +T
Sbjct:  167 GLGPWGVLHSNPMDYAWGANGLDTIITQLLNQFENTGPPPADKEKIQALPTVPVTEEHVGSGLECPVCKEDYALGESVRQLPCNHLFHDSCIVPWLEQHDSCPVCRKSLTGQNT 280          
BLAST of RING-type domain-containing protein vs. Ensembl Mouse
Match: Rnf115 (ring finger protein 115 [Source:MGI Symbol;Acc:MGI:1915095])

HSP 1 Score: 97.8265 bits (242), Expect = 2.371e-23
Identity = 69/273 (25.27%), Postives = 106/273 (38.83%), Query Frame = 3
Query:   54 YFCHKCNRDVHIS-QDGKCVTCNDGFIERIESDNSMESDDDALNVFHIIRHIPSGSTTNETDGSFFI---------TPRDHDNRNSVFGQ-------------------------------------LISNLFGGLL----------PLDF----RSDPSDYIFSDQSFDNFVTRIMNQFEQSGPPPANEADIEKLQVTKITE----ANDTCSICLSDYEVGDEVYELPCQHKYHVQCLKTWLIKHGTCPICRKDLSGNDTRLESHDHIAQSS 677
            +FCH C  +V+    +  C  C+ GFIE +  D+S      +        H       +  D + F+          P D DNR +  G                                      +I  +F G            P  +     S+P DY +     D  VT+++ Q E +GPPPA++  I  L    +T+        C +C  DY V ++V +LPC H +H  C+  WL  H TCP+CRK L+G D+  ++    A +S
Sbjct:   20 FFCHFCKGEVNPKLPEYICPRCDSGFIEEVTDDSSFLGGGGSRTDNSTATHF--AELWDHLDHTMFLQDFRPFLSSNPLDQDNRANERGHQTHTDFWGPSRPPRLPMTRRYRSRGSTRPDRSPAIEGIIQQIFAGFFANSAIPGSPHPFSWSGMLHSNPGDYAWGQTGLDAIVTQLLGQLENTGPPPADKEKITSLPTVTVTQEQVNTGLECPVCKEDYTVEEKVRQLPCNHFFHSSCIVPWLELHDTCPVCRKSLNGEDSTRQTQSSEASAS 290          
BLAST of RING-type domain-containing protein vs. Ensembl Mouse
Match: Rnf181 (ring finger protein 181 [Source:MGI Symbol;Acc:MGI:1913760])

HSP 1 Score: 72.0182 bits (175), Expect = 2.056e-15
Identity = 33/85 (38.82%), Postives = 48/85 (56.47%), Query Frame = 3
Query:  408 FEQSGPPPANEADIEKLQVTKITEAND--TCSICLSDYEVGDEVYELPCQHKYHVQCLKTWLIKHGTCPICRKDLSGNDTRLESH 656
            +E   PPPA +A +E L  T I+ A     C +CL ++E  + V E+PC H +H  C+  WL K  +CP+CR +L  +D   E H
Sbjct:   11 WEHHLPPPAAKAVVESLPRTVISSAKADLKCPVCLLEFEAEETVIEMPCHHLFHSNCILPWLSKTNSCPLCRHELPTDDDSYEEH 95          
BLAST of RING-type domain-containing protein vs. Ensembl Mouse
Match: Rnf181 (ring finger protein 181 [Source:MGI Symbol;Acc:MGI:1913760])

HSP 1 Score: 72.0182 bits (175), Expect = 2.056e-15
Identity = 33/85 (38.82%), Postives = 48/85 (56.47%), Query Frame = 3
Query:  408 FEQSGPPPANEADIEKLQVTKITEAND--TCSICLSDYEVGDEVYELPCQHKYHVQCLKTWLIKHGTCPICRKDLSGNDTRLESH 656
            +E   PPPA +A +E L  T I+ A     C +CL ++E  + V E+PC H +H  C+  WL K  +CP+CR +L  +D   E H
Sbjct:   11 WEHHLPPPAAKAVVESLPRTVISSAKADLKCPVCLLEFEAEETVIEMPCHHLFHSNCILPWLSKTNSCPLCRHELPTDDDSYEEH 95          
BLAST of RING-type domain-containing protein vs. Ensembl Mouse
Match: Rnf181 (ring finger protein 181 [Source:MGI Symbol;Acc:MGI:1913760])

HSP 1 Score: 72.0182 bits (175), Expect = 4.963e-15
Identity = 33/85 (38.82%), Postives = 48/85 (56.47%), Query Frame = 3
Query:  408 FEQSGPPPANEADIEKLQVTKITEAND--TCSICLSDYEVGDEVYELPCQHKYHVQCLKTWLIKHGTCPICRKDLSGNDTRLESH 656
            +E   PPPA +A +E L  T I+ A     C +CL ++E  + V E+PC H +H  C+  WL K  +CP+CR +L  +D   E H
Sbjct:   58 WEHHLPPPAAKAVVESLPRTVISSAKADLKCPVCLLEFEAEETVIEMPCHHLFHSNCILPWLSKTNSCPLCRHELPTDDDSYEEH 142          
BLAST of RING-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6DIP3|RN126_XENTR (E3 ubiquitin-protein ligase RNF126 OS=Xenopus tropicalis OX=8364 GN=rnf126 PE=2 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 9.096e-26
Identity = 51/120 (42.50%), Postives = 72/120 (60.00%), Query Frame = 3
Query:  297 ISNLFGGLLPLD-FRSDPSDYIFSDQSFDNFVTRIMNQFEQSGPPPANEADIEKLQVTKITE----ANDTCSICLSDYEVGDEVYELPCQHKYHVQCLKTWLIKHGTCPICRKDLSGNDT 641
            +SNL  G+ P     S+P DY +     D  +T+++NQFE +GPPPA+   I+ L   +ITE    +   C +C  DY VG+ V +LPC H +H  C+  WL +H TCP+CRK LSG +T
Sbjct:  159 MSNL--GVGPWGVLHSNPMDYAWGANGLDTIITQLLNQFENTGPPPADTEKIQALPTIQITEEHVGSGLECPVCKEDYTVGESVRQLPCNHLFHNDCIIPWLEQHDTCPVCRKSLSGQNT 276          
BLAST of RING-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6IRP0|R126B_XENLA (E3 ubiquitin-protein ligase RNF126-B OS=Xenopus laevis OX=8355 GN=rnf126-b PE=2 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 2.696e-25
Identity = 51/120 (42.50%), Postives = 72/120 (60.00%), Query Frame = 3
Query:  297 ISNLFGGLLPLD-FRSDPSDYIFSDQSFDNFVTRIMNQFEQSGPPPANEADIEKLQVTKITEAND----TCSICLSDYEVGDEVYELPCQHKYHVQCLKTWLIKHGTCPICRKDLSGNDT 641
            +SNL  G+ P     S+P DY +     D  +T+++NQFE +GPPPA+   I+ L   +ITE +      C +C  DY VG+ V +LPC H +H  C+  WL +H TCP+CRK LSG +T
Sbjct:  160 MSNL--GVGPWGVLHSNPMDYAWGANGLDTIITQLLNQFENTGPPPADTDKIQALPTIQITEEHVGFGLECPVCKEDYTVGESVRQLPCNHLFHNDCIIPWLEQHDTCPVCRKSLSGQNT 277          
BLAST of RING-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q7T0Q3|R126A_XENLA (E3 ubiquitin-protein ligase RNF126-A OS=Xenopus laevis OX=8355 GN=rnf126-a PE=2 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 3.113e-25
Identity = 51/120 (42.50%), Postives = 72/120 (60.00%), Query Frame = 3
Query:  297 ISNLFGGLLPLD-FRSDPSDYIFSDQSFDNFVTRIMNQFEQSGPPPANEADIEKLQVTKITE----ANDTCSICLSDYEVGDEVYELPCQHKYHVQCLKTWLIKHGTCPICRKDLSGNDT 641
            +SNL  G+ P     S+P DY +     D  +T+++NQFE +GPPPA+   I+ L   +ITE    +   C +C  DY VG+ V +LPC H +H  C+  WL +H TCP+CRK LSG +T
Sbjct:  160 MSNL--GVGPWGVLHSNPMDYAWGANGLDTIITQLLNQFENTGPPPADNEKIQALPTIQITEEHVGSGLECPVCKEDYTVGECVRQLPCNHLFHNDCIIPWLEQHDTCPVCRKSLSGQNT 277          
BLAST of RING-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q91YL2|RN126_MOUSE (E3 ubiquitin-protein ligase RNF126 OS=Mus musculus OX=10090 GN=Rnf126 PE=1 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 1.459e-24
Identity = 45/114 (39.47%), Postives = 68/114 (59.65%), Query Frame = 3
Query:  315 GLLPLD-FRSDPSDYIFSDQSFDNFVTRIMNQFEQSGPPPANEADIEKLQVTKITE----ANDTCSICLSDYEVGDEVYELPCQHKYHVQCLKTWLIKHGTCPICRKDLSGNDT 641
            GL P     S+P DY +     D  +T+++NQFE +GPPPA++  I+ L    +TE    +   C +C  DY +G+ V +LPC H +H  C+  WL +H +CP+CRK L+G +T
Sbjct:  167 GLGPWGVLHSNPMDYAWGANGLDTIITQLLNQFENTGPPPADKEKIQALPTVPVTEEHVGSGLECPVCKEDYALGESVRQLPCNHLFHDSCIVPWLEQHDSCPVCRKSLTGQNT 280          
BLAST of RING-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q0II22|RN126_BOVIN (E3 ubiquitin-protein ligase RNF126 OS=Bos taurus OX=9913 GN=RNF126 PE=2 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 2.511e-24
Identity = 48/120 (40.00%), Postives = 71/120 (59.17%), Query Frame = 3
Query:  297 ISNLFGGLLPLD-FRSDPSDYIFSDQSFDNFVTRIMNQFEQSGPPPANEADIEKLQVTKITE----ANDTCSICLSDYEVGDEVYELPCQHKYHVQCLKTWLIKHGTCPICRKDLSGNDT 641
            I NL  GL P     S+P DY +     D  +T+++NQFE +GPPPA++  I+ L    +TE    +   C +C  DY +G+ V +LPC H +H  C+  WL +H +CP+CRK L+G +T
Sbjct:  164 IPNL--GLGPWGVLHSNPMDYAWGANGLDAIITQLLNQFENTGPPPADKEKIQALPTVPVTEEHVGSGLECPVCKDDYGLGEHVRQLPCNHLFHDGCIVPWLEQHDSCPVCRKSLTGQNT 281          
BLAST of RING-type domain-containing protein vs. TrEMBL
Match: G4LWM6 (Zinc finger protein, putative OS=Schistosoma mansoni OX=6183 GN=Smp_049970.5 PE=4 SV=1)

HSP 1 Score: 123.635 bits (309), Expect = 7.199e-30
Identity = 82/256 (32.03%), Postives = 119/256 (46.48%), Query Frame = 3
Query:   30 MATINT-DNYFCHKCNRDVHIS-QDGKCVTCNDGFIERIESDNSMESDDDALNVFHIIRHIPSGSTTNETDGSFFITPRD----------------------------HDNRNSVFGQLI--SNLFGGLLPLD-----FR-----------SDPSDYIFSDQSFDNFVTRIMNQFEQSGPPPANEADIEKLQVTKITEAN----DTCSICLSDYEVGDEVYELPCQHKYHVQCLKTWLIKHGTCPICRKDLSGNDT 641
            MAT ++ D+Y+CH C  +V  + QD  C  C+ GFIE I   + + S+   L+   +I  +  GS ++     +F  PRD                               R  V+ ++    + F   + L      FR            D  +++F+   FD F+T +MN+  Q GPPPA E+ I  L    +TE        CSIC  D++  + V  LPC H YH  C+ TWL +HGTCP+CRKDLSG+DT
Sbjct:    1 MATGSSGDSYYCHSCEAEVVPNLQDFTCSACHSGFIEAISPGSGLSSNPTELDAMQMIGQLFGGSLSDNF-VRYFAAPRDDLSSTDDESLERESLSRRSRRSTRNSNHRSTRERVYTRVPDGRHAFSTRIQLSSVDHPFRLPFLSNFGSADGDMQNFVFNRAMFDQFITVLMNEL-QVGPPPAPESAIADLPTISLTEEQALKLGICSICFDDFKESESVIRLPCAHTYHQTCVTTWLKQHGTCPVCRKDLSGHDT 254          
BLAST of RING-type domain-containing protein vs. TrEMBL
Match: A0A2C9L8K4 (RING-type domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106065911 PE=4 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 3.262e-29
Identity = 80/240 (33.33%), Postives = 113/240 (47.08%), Query Frame = 3
Query:   48 DNYFCHKCNRDVHISQDG-KCVTCNDGFIERIE-----SDNSMESDDDALNVFHII---------RH---IPSGSTTNE----------------TDGSFFIT---PRDHDNRNSVFGQLISNLFGG--LLPLDFRSDPSDYIFSDQSFDNFVTRIMNQFEQSGPPPANEADIEKLQVTKI----TEANDTCSICLSDYEVGDEVYELPCQHKYHVQCLKTWLIKHGTCPICRKDLSGND 638
            + +FCH+C R V I+     C  CN GFIE +E     S  S+ + D A  +  +          RH    PS +  NE                 +  F  T   P  H   N V  +L ++L GG    P+    +P DY +     D  +++++N  E +G PPA    IE L+  +I     E    CSIC+ D+E+  EV +LPC H YH +C+  WL  HGTCP+CRKDL+G D
Sbjct:   11 NTFFCHQCMRVVVINIPAYTCSRCNSGFIEELERPQPSSSPSVHTSDTAAQISQVFPIFANVGTSRHRLNTPSVTRINEDFDVDLSDEDEIRSVGPNAVFHFTEPSPNLHGIINYVIQRLGTDLAGGGGRNPIILHGNPGDYAWGAGGLDAIISQLLNHLEGTGAPPAQREKIENLERVRINQTHIENTLQCSICMDDFELDLEVRKLPCDHLYHPECIIKWLEMHGTCPVCRKDLNGID 250          
BLAST of RING-type domain-containing protein vs. TrEMBL
Match: T1KM53 (RING-type domain-containing protein OS=Tetranychus urticae OX=32264 GN=107365553 PE=4 SV=1)

HSP 1 Score: 120.168 bits (300), Expect = 8.851e-29
Identity = 68/202 (33.66%), Postives = 107/202 (52.97%), Query Frame = 3
Query:   54 YFCHKCNRDVH-ISQDGKCVTCNDGFIERIESDNSME-SDDDALNVFHIIRHIPSGSTTNETDGSFFITPRDHDNRNSVFGQLISNLFGGLLPL--DFRSDPSDYIFSDQSFDNFVTRIMNQFEQSGPPPANEADIEKLQVTKI----TEANDTCSICLSDYEVGDEVYELPCQHKYHVQCLKTWLIKHGTCPICRKDLSGN 635
            YFCHKCN++++ +  + KC  C +GFIE + SD +++ S DD+ ++ +  R       T   +    +     D + +  G     +F   +P       +P DY +  Q  D  +T+++N  E +GPPP  + +IEKL    I     + N  C++C+ DY++ + V  LPC H YH  C+  WL  HGTCPICRK L+ N
Sbjct:   13 YFCHKCNQEINPVLPEFKCPGCREGFIEELTSDANLDISSDDSEHLENYERF----EDTRAGEILRVLQLFSGDQQANQRGNRGRGMFEMAIPYLQILHGNPGDYAWGSQGLDTIITQLLNTIENNGPPPMPKEEIEKLPTVNICQDNVDKNLQCTVCMEDYKLDEPVRVLPCNHVYHNDCIVPWLEMHGTCPICRKLLNEN 210          
BLAST of RING-type domain-containing protein vs. TrEMBL
Match: G4LWM7 (Zinc finger protein, putative OS=Schistosoma mansoni OX=6183 GN=Smp_049970.4 PE=4 SV=1)

HSP 1 Score: 120.168 bits (300), Expect = 1.218e-28
Identity = 83/256 (32.42%), Postives = 119/256 (46.48%), Query Frame = 3
Query:   30 MATINT-DNYFCHKCNRDVHIS-QDGKCVTCNDGFIERIESDNSMESDDDALNVFHIIRHIPSGSTTNETDGSFFITPRD----------------------------HDNRNSVFGQLI--SNLFGGLLPLD-----FR-----------SDPSDYIFSDQSFDNFVTRIMNQFEQSGPPPANEADIEKLQVTKITEAN----DTCSICLSDYEVGDEVYELPCQHKYHVQCLKTWLIKHGTCPICRKDLSGNDT 641
            MAT ++ D+Y+CH C  +V  + QD  C  C+ GFIE I S   + S+   L+   +I  +  GS ++     +F  PRD                               R  V+ ++    + F   + L      FR            D  +++F+   FD F+T +MN+  Q GPPPA E+ I  L    +TE        CSIC  D++  + V  LPC H YH  C+ TWL +HGTCP+CRKDLSG+DT
Sbjct:    1 MATGSSGDSYYCHSCEAEVVPNLQDFTCSACHSGFIEAI-SPGGLSSNPTELDAMQMIGQLFGGSLSDNF-VRYFAAPRDDLSSTDDESLERESLSRRSRRSTRNSNHRSTRERVYTRVPDGRHAFSTRIQLSSVDHPFRLPFLSNFGSADGDMQNFVFNRAMFDQFITVLMNEL-QVGPPPAPESAIADLPTISLTEEQALKLGICSICFDDFKESESVIRLPCAHTYHQTCVTTWLKQHGTCPVCRKDLSGHDT 253          
BLAST of RING-type domain-containing protein vs. TrEMBL
Match: A0A3R7FL85 (E3 ubiquitin-protein ligase OS=Clonorchis sinensis OX=79923 GN=RNF126 PE=4 SV=1)

HSP 1 Score: 117.087 bits (292), Expect = 2.032e-28
Identity = 53/110 (48.18%), Postives = 72/110 (65.45%), Query Frame = 3
Query:  333 FRSDPSDYIFSDQSFDNFVTRIMNQFEQSGPPPANEADIEKLQVTKITEAN----DTCSICLSDYEVGDEVYELPCQHKYHVQCLKTWLIKHGTCPICRKDLSGNDTRLE 650
             + D  DY  +   F+N +  + NQ    GPPPA+EA I++L V K+TE +     TCSIC  DY+V +EV +LPCQH YH  C+ TWL +H TCP+CRKDL+G DT ++
Sbjct:   64 IQGDIRDYALNQGMFENLLALLTNQL-HVGPPPASEATIQQLPVQKLTEDSVAQYKTCSICFEDYQVSEEVMQLPCQHVYHTTCVTTWLKQHATCPVCRKDLNGRDTSMD 172          
BLAST of RING-type domain-containing protein vs. Ensembl Cavefish
Match: rnf126 (ring finger protein 126 [Source:ZFIN;Acc:ZDB-GENE-070209-292])

HSP 1 Score: 107.071 bits (266), Expect = 8.182e-27
Identity = 46/107 (42.99%), Postives = 64/107 (59.81%), Query Frame = 3
Query:  333 FRSDPSDYIFSDQSFDNFVTRIMNQFEQSGPPPANEADIEKLQVTKITE----ANDTCSICLSDYEVGDEVYELPCQHKYHVQCLKTWLIKHGTCPICRKDLSGNDT 641
              S+P DY +     D  +T+++NQFE +GPPPA+   I+ L   +ITE    A   C +C  DY  G+ V +LPC H +H  C+  WL +H TCP+CRK LSG +T
Sbjct:  166 LHSNPMDYAWGANGLDAIITQLLNQFENTGPPPADREKIKSLPTVQITEEHVGAGLECPVCKEDYSAGESVRQLPCNHLFHNDCIVPWLEQHDTCPVCRKSLSGQNT 272          
BLAST of RING-type domain-containing protein vs. Ensembl Cavefish
Match: rnf126 (ring finger protein 126 [Source:ZFIN;Acc:ZDB-GENE-070209-292])

HSP 1 Score: 107.457 bits (267), Expect = 1.441e-26
Identity = 48/114 (42.11%), Postives = 67/114 (58.77%), Query Frame = 3
Query:  315 GLLPLD-FRSDPSDYIFSDQSFDNFVTRIMNQFEQSGPPPANEADIEKLQVTKITE----ANDTCSICLSDYEVGDEVYELPCQHKYHVQCLKTWLIKHGTCPICRKDLSGNDT 641
            G+ P     S+P DY +     D  +T+++NQFE +GPPPA+   I+ L   +ITE    A   C +C  DY  G+ V +LPC H +H  C+  WL +H TCP+CRK LSG +T
Sbjct:  226 GMGPWGMLHSNPMDYAWGANGLDAIITQLLNQFENTGPPPADREKIKSLPTVQITEEHVGAGLECPVCKEDYSAGESVRQLPCNHLFHNDCIVPWLEQHDTCPVCRKSLSGQNT 339          
BLAST of RING-type domain-containing protein vs. Ensembl Cavefish
Match: rnf126 (ring finger protein 126 [Source:ZFIN;Acc:ZDB-GENE-070209-292])

HSP 1 Score: 107.071 bits (266), Expect = 1.750e-26
Identity = 46/105 (43.81%), Postives = 64/105 (60.95%), Query Frame = 3
Query:  339 SDPSDYIFSDQSFDNFVTRIMNQFEQSGPPPANEADIEKLQVTKITE----ANDTCSICLSDYEVGDEVYELPCQHKYHVQCLKTWLIKHGTCPICRKDLSGNDT 641
            S+P DY +     D  +T+++NQFE +GPPPA+   I+ L   +ITE    A   C +C  DY  G+ V +LPC H +H  C+  WL +H TCP+CRK LSG +T
Sbjct:  221 SNPMDYAWGANGLDAIITQLLNQFENTGPPPADREKIKSLPTVQITEEHVGAGLECPVCKEDYSAGESVRQLPCNHLFHNDCIVPWLEQHDTCPVCRKSLSGQNT 325          
BLAST of RING-type domain-containing protein vs. Ensembl Cavefish
Match: rnf115 (ring finger protein 115 [Source:NCBI gene;Acc:107197307])

HSP 1 Score: 100.138 bits (248), Expect = 2.818e-24
Identity = 48/133 (36.09%), Postives = 72/133 (54.14%), Query Frame = 3
Query:  282 VFGQLISNLFG-----GLLPLDF----RSDPSDYIFSDQSFDNFVTRIMNQFEQSGPPPANEADIEKLQVTKITE----ANDTCSICLSDYEVGDEVYELPCQHKYHVQCLKTWLIKHGTCPICRKDLSGNDT 641
            +  Q ++ LF      G  PL +     S+P DY +     D  +T+++ QFE +GPPPA +  I  L    +++    ++  C +C  DY VG+ V +LPC H +H  C+  WL  H TCP+CRK LSG D+
Sbjct:  155 IVQQFLAGLFANSGVPGSPPLSWTGMLHSNPGDYAWGQGGLDAVITQLLGQFENTGPPPAEKEKISSLPTVIVSQEQADSSMECPVCKEDYTVGEPVRQLPCNHFFHSDCIVPWLELHDTCPVCRKSLSGEDS 287          
BLAST of RING-type domain-containing protein vs. Ensembl Cavefish
Match: si:ch211-81a5.1 (si:ch211-81a5.1 [Source:ZFIN;Acc:ZDB-GENE-060503-608])

HSP 1 Score: 95.9005 bits (237), Expect = 7.535e-23
Identity = 43/122 (35.25%), Postives = 64/122 (52.46%), Query Frame = 3
Query:  324 PLDFRSDPSDYIFSDQSFDNFVTRIMNQFEQSGPPPANEADIEKLQVTKITEANDTC----SICLSDYEVGDEVYELPCQHKYHVQCLKTWLIKHGTCPICRKDLSGNDTRLESHDHIAQSS 677
            P    S+P DY +    FD  +T+++ Q E +GPPPA +  I  L    ++     C     +C  +Y VG+ V +LPC H +H  C+  WL  H TCP+CRK L+G D   +S     ++S
Sbjct:  149 PGTLHSNPGDYAWGQGGFDAVITQLLGQSEIAGPPPAEKEMISSLPTVHVSSEQAACRLECPVCREEYSVGESVRQLPCLHCFHSDCIVPWLQLHDTCPVCRKSLNGEDHSFQSQPAPQETS 270          
BLAST of RING-type domain-containing protein vs. Ensembl Sea Lamprey
Match: rnf126 (ring finger protein 126 [Source:ZFIN;Acc:ZDB-GENE-070209-292])

HSP 1 Score: 106.301 bits (264), Expect = 2.903e-27
Identity = 53/157 (33.76%), Postives = 82/157 (52.23%), Query Frame = 3
Query:  216 STTNETDGSFFITPRDHDNRNSVFGQLISNLFGGLLPLDF------RSDPSDYIFSDQSFDNFVTRIMNQFEQSGPPPANEADIEKLQVTKIT----EANDTCSICLSDYEVGDEVYELPCQHKYHVQCLKTWLIKHGTCPICRKDLSGNDTRLESH 656
            ST+ ++ G+ F+  + H+ R      +I +L G  L   F       SDP DY++     D  +T+++ Q + SGPPPA++  I  +    I+    E    CS+C  D++ G++  +LPC+H YH  C+  WL  H TCP+CR  LSG  T    H
Sbjct:  125 STSRDSAGNTFL--QTHNGRAPSVEGIIQHLLGSFLGRQFAPWGALHSDPGDYVWGVNGIDQIITQLLGQLDNSGPPPADKDKIMAIPTISISSEQVECGLECSVCKEDFDEGEKARQLPCKHIYHTDCIIPWLEMHDTCPVCRTSLSGESTATAQH 279          
BLAST of RING-type domain-containing protein vs. Ensembl Sea Lamprey
Match: RNF115 (ring finger protein 115 [Source:HGNC Symbol;Acc:HGNC:18154])

HSP 1 Score: 92.8189 bits (229), Expect = 1.519e-22
Identity = 46/138 (33.33%), Postives = 69/138 (50.00%), Query Frame = 3
Query:  258 RDHDNRNSVFGQLISNLFGGL----------LPLD-FRSDPSDYIFSDQSFDNFVTRIMNQFEQSGPPPANEADIEKLQVTKITEANDTCS----ICLSDYEVGDEVYELPCQHKYHVQCLKTWLIKHGTCPICRKDL 626
            R    R+     +I  + GGL            LD   S P+DY++     D  +T+++ Q + +GPPPA++  I  L    I + +  CS    +C  DY VG+ V +LPC H +H  C+  WL  H +CP+CRK L
Sbjct:  111 RHRVERSPAIEGIIQQMLGGLWGPARSPFPPFTLDVLHSSPADYVWGAGGLDAIITQLLGQLDNTGPPPADKEKISSLPRITIAQEHLNCSMECAVCKEDYSVGESVRQLPCLHLFHSNCIVPWLEMHDSCPVCRKGL 248          
BLAST of RING-type domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006942.1 (pep scaffold:Pmarinus_7.0:GL476534:934671:936845:1 gene:ENSPMAG00000006277.1 transcript:ENSPMAT00000006942.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.1738 bits (178), Expect = 6.997e-17
Identity = 34/89 (38.20%), Postives = 48/89 (53.93%), Query Frame = 3
Query:  333 FRSDPSDYIFSDQSFDNFVTRIMNQFEQSGPPPANEADIEKLQVTKITE----ANDTCSICLSDYEVGDEVYELPCQHKYHVQCLKTWL 587
              SDP DY +     D  +T+++ Q + SGPPPA+ A I  L    IT+    A   CS+C  D+   + V +LPC+H YH  C+  WL
Sbjct:    3 LHSDPGDYAWGLNGLDRIITQLLEQLDTSGPPPADRARIHTLPNITITQQHVDAGLECSVCREDFAETEVVRQLPCKHMYHNDCIVPWL 91          
BLAST of RING-type domain-containing protein vs. Ensembl Sea Lamprey
Match: si:ch1073-392o20.1 (ring finger protein 122 [Source:HGNC Symbol;Acc:HGNC:21147])

HSP 1 Score: 53.1434 bits (126), Expect = 5.423e-10
Identity = 19/47 (40.43%), Postives = 29/47 (61.70%), Query Frame = 3
Query:  489 TCSICLSDYEVGDEVYELPCQHKYHVQCLKTWLIKHGTCPICRKDLS 629
            TC++CL D+   DE+   PC+H +H +CL  WL     CP+C K ++
Sbjct:   16 TCAVCLEDFREKDELAVCPCKHAFHRKCLVKWLEIRNACPMCNKPVA 62          
BLAST of RING-type domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003771.1 (pep scaffold:Pmarinus_7.0:GL488469:4:5386:-1 gene:ENSPMAG00000003449.1 transcript:ENSPMAT00000003771.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.1434 bits (126), Expect = 1.305e-9
Identity = 23/60 (38.33%), Postives = 37/60 (61.67%), Query Frame = 3
Query:  486 DTCSICLSDYEVGDEVYELPCQHKYHVQCLKTWLIKH-GTCPICRKDL---SGNDTRLES 653
            D C+ICL +YE G+ +  LPC H +H +C+  WL +    CP+C++ +    G+D+  ES
Sbjct:    5 DVCAICLEEYEEGERLRVLPCAHAFHCKCVDPWLTQQRKNCPVCKRKVVRSHGSDSESES 64          
BLAST of RING-type domain-containing protein vs. Ensembl Yeast
Match: YBR062C_mRNA (Protein of unknown function that interacts with Msb2p; may play a role in activation of the filamentous growth pathway [Source:SGD;Acc:S000000266])

HSP 1 Score: 57.7658 bits (138), Expect = 1.125e-10
Identity = 31/83 (37.35%), Postives = 51/83 (61.45%), Query Frame = 3
Query:  399 MNQFEQSGPPPANEADIEKLQVTKITEANDTCSICLSDYEVGDE---VYELP-CQHKYHVQCLKTWLIKHGTCPICRKDLSGN 635
            M++ + +G P    A + ++   K+ +A D CSIC ++Y + DE   V ELP C HK+ ++CL  WL +  TCP+CR ++ G+
Sbjct:   79 MDKGKSAGCPDTFAASLPRINKKKL-KATDNCSICYTNY-LEDEYPLVVELPHCHHKFDLECLSVWLSRSTTCPLCRDNVMGH 159          
BLAST of RING-type domain-containing protein vs. Ensembl Nematostella
Match: EDO32057 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SW71])

HSP 1 Score: 76.2554 bits (186), Expect = 7.077e-18
Identity = 32/91 (35.16%), Postives = 50/91 (54.95%), Query Frame = 3
Query:  327 LDFRSDPSDYIFSDQSFDNFVTRIMNQFEQSGPPPANEADIEKLQVTKITE----ANDTCSICLSDYEVGDEVYELPCQHKYHVQCLKTWL 587
            L    +P DY++     D+ +T+++NQ E +GPPPA    IE L   K+T+    +   C++C    ++ +EV  LPC H YH  C+  WL
Sbjct:    2 LQLHGNPGDYVWGTNGLDSIITQLLNQLEGAGPPPAENDKIENLPKVKVTQSLIDSRTECAVCQEQLKLHEEVLMLPCNHHYHKDCIIPWL 92          
BLAST of RING-type domain-containing protein vs. Ensembl Nematostella
Match: EDO45479 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSU5])

HSP 1 Score: 65.4698 bits (158), Expect = 1.178e-13
Identity = 28/81 (34.57%), Postives = 46/81 (56.79%), Query Frame = 3
Query:  426 PPANEADIEKLQVTKITE------ANDTCSICLSDYEVGDEVYELPCQHKYHVQCLKTWLIKHGTCPICRKDLSGNDTRLE 650
            PPA++  ++ L   K+T+      +  +C ICL DYE G+   ++PC H +H  C+  WL K  +CP+CR +L  ++   E
Sbjct:    1 PPASKEAVQALPAVKVTDKHLKELSTSSCPICLGDYEKGESTKQMPCDHLFHPGCILPWLEKTNSCPVCRHELPTDNEAYE 81          
BLAST of RING-type domain-containing protein vs. Ensembl Nematostella
Match: EDO29210 (pep supercontig:ASM20922v1:NEMVEscaffold_1403:17060:20569:-1 gene:NEMVEDRAFT_v1g145359 transcript:EDO29210 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.3882 bits (150), Expect = 1.182e-12
Identity = 27/80 (33.75%), Postives = 45/80 (56.25%), Query Frame = 3
Query:  429 PANEADIEKLQVTKITE------ANDTCSICLSDYEVGDEVYELPCQHKYHVQCLKTWLIKHGTCPICRKDLSGNDTRLE 650
            PA++  ++ L   K+T+      +  +C ICL DYE G+   ++PC H +H  C+  WL K  +CP+CR +L  ++   E
Sbjct:    2 PASKEAVQALPAVKVTDKHLKELSTSSCPICLGDYEKGESTKQMPCDHLFHPGCILPWLEKTNSCPVCRHELPTDNEAYE 81          
BLAST of RING-type domain-containing protein vs. Ensembl Nematostella
Match: EDO41758 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3E3])

HSP 1 Score: 58.9214 bits (141), Expect = 3.869e-10
Identity = 21/50 (42.00%), Postives = 34/50 (68.00%), Query Frame = 3
Query:  477 EANDTCSICLSDYEVGDEVYELPCQHKYHVQCLKTWLIKHGTCPICRKDL 626
            E  D+C +CL  Y+ G+ +  LPC H+YH  C+  WL++H TCP+C+ ++
Sbjct:  221 EEIDSCPVCLDGYKSGEVIRILPCNHEYHKLCIDPWLVEHRTCPMCKLNI 270          
BLAST of RING-type domain-containing protein vs. Ensembl Nematostella
Match: EDO36379 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIX4])

HSP 1 Score: 55.4546 bits (132), Expect = 6.275e-9
Identity = 22/49 (44.90%), Postives = 33/49 (67.35%), Query Frame = 3
Query:  477 EANDTCSICLSDYEVGDEVYELPCQHKYHVQCLKTWLIK-HGTCPICRK 620
            E  D C+ICL +Y+ GD++  LPC H YH +C+  WL +   TCP+C++
Sbjct:  261 EYYDVCAICLDEYKEGDKLRILPCDHAYHCKCVDPWLTEGKRTCPVCKR 309          
BLAST of RING-type domain-containing protein vs. Ensembl Medaka
Match: rnf126 (E3 ubiquitin-protein ligase RNF126 [Source:NCBI gene;Acc:101164752])

HSP 1 Score: 105.145 bits (261), Expect = 8.914e-26
Identity = 74/269 (27.51%), Postives = 111/269 (41.26%), Query Frame = 3
Query:   54 YFCHKCNRDVHIS-QDGKCVTCNDGFIERI---------------ESDNSMESDDD----------------ALNVFH----IIRHIPS------------------GSTTNETDGSFFITPRDHDNRN---SVFGQLISNLFGGLLPLD------------FRSDPSDYIFSDQSFDNFVTRIMNQFEQSGPPPANEADIEKLQVTKITE----ANDTCSICLSDYEVGDEVYELPCQHKYHVQCLKTWLIKHGTCPICRKDLSGNDT 641
            +FCH+C+ +V     D  C  CN GFIE +                SD + +S +D                AL +F     +   +PS                    +  +  G +F  PR    R+        +I  L  G++                 S+P DY +     D  +T+++NQFE +GPPPA+   I+ L    IT+    A   C +C  DY + + V +LPC H +H  C+  WL +H TCP+CRK LSG +T
Sbjct:   56 FFCHRCSAEVTPRLPDYTCPRCNSGFIEELPEEISSENRSASTSSASDQNRQSFEDMDHQHFFTFPSGYGPFALGIFDDNFDVRARLPSEDNREAENRREREMASRQRYSARQPRGRYF--PRRQGTRHEGVPTLEGIIQQLVNGIIAPTAMPNIGMGSWGMLHSNPMDYAWGANGLDAIITQLLNQFENTGPPPADRERIKSLPTISITQEHISAGLECPVCKEDYSIDERVRQLPCNHLFHNDCIVPWLEQHDTCPVCRKSLSGQNT 322          
BLAST of RING-type domain-containing protein vs. Ensembl Medaka
Match: RNF126 (ring finger protein 126 [Source:NCBI gene;Acc:101169433])

HSP 1 Score: 102.834 bits (255), Expect = 3.967e-25
Identity = 44/107 (41.12%), Postives = 65/107 (60.75%), Query Frame = 3
Query:  333 FRSDPSDYIFSDQSFDNFVTRIMNQFEQSGPPPANEADIEKLQVTKITE----ANDTCSICLSDYEVGDEVYELPCQHKYHVQCLKTWLIKHGTCPICRKDLSGNDT 641
              S+P DY +     D  +T+++NQFE +GPPPA+   I+ L   ++T+    +   C +C  DY VG+ V +LPC H +H  C+  WL +H TCP+CRK LSG +T
Sbjct:  172 LHSNPMDYAWGANGLDAIITQLLNQFENTGPPPADRDKIKSLPTVQVTDEHVASGLECPVCKEDYCVGENVRQLPCNHMFHNDCIVPWLEQHDTCPVCRKSLSGQNT 278          
BLAST of RING-type domain-containing protein vs. Ensembl Medaka
Match: rnf115 (ring finger protein 115 [Source:NCBI gene;Acc:101158133])

HSP 1 Score: 94.7449 bits (234), Expect = 2.760e-22
Identity = 46/132 (34.85%), Postives = 67/132 (50.76%), Query Frame = 3
Query:  282 VFGQLISNLFG-----GLLPLDF----RSDPSDYIFSDQSFDNFVTRIMNQFEQSGPPPANEADIEKLQVTKITEAND----TCSICLSDYEVGDEVYELPCQHKYHVQCLKTWLIKHGTCPICRKDLSGND 638
            +  Q ++ LF      G  PL +     S+P DY +     D  +T+++ Q E +GPPPA +  I  L    I++        C +C  D+ VG+ V +LPC H +H  C+  WL  H TCP+CR  LSG D
Sbjct:  160 IVQQFLAGLFANSGVPGSPPLSWTGMLHSNPGDYAWGQGGLDAVITQLLGQLENTGPPPAEKEKISSLPTVNISQEQADCCMECPVCKEDFTVGEPVRKLPCNHFFHSDCIVPWLEMHDTCPVCRMSLSGED 291          
BLAST of RING-type domain-containing protein vs. Ensembl Medaka
Match: rlim (ring finger protein, LIM domain interacting [Source:NCBI gene;Acc:101168551])

HSP 1 Score: 68.1662 bits (165), Expect = 1.812e-12
Identity = 23/49 (46.94%), Postives = 38/49 (77.55%), Query Frame = 3
Query:  474 TEANDTCSICLSDYEVGDEVYELPCQHKYHVQCLKTWLIKHGTCPICRK 620
            ++A  TCS+C+++Y  G+++ +LPC H+YHV C+  WL ++ TCPICR+
Sbjct:  591 SDALKTCSVCITEYAEGNKLRKLPCSHEYHVHCIDRWLSENSTCPICRR 639          
BLAST of RING-type domain-containing protein vs. Ensembl Medaka
Match: rnf181 (ring finger protein 181 [Source:NCBI gene;Acc:101167798])

HSP 1 Score: 62.003 bits (149), Expect = 1.372e-11
Identity = 30/88 (34.09%), Postives = 51/88 (57.95%), Query Frame = 3
Query:  399 MNQFEQSGPPPANEADIEKLQVTKIT-EANDT---CSICLSDYEVGDEVYELPCQHKYHVQCLKTWLIKHGTCPICRKDLSGNDTRLE 650
            ++ ++Q  PPPA +  ++ L V  I+ E  D    C +CL ++E  + V E+PC+H +H  C+  WL K  +CP+CR +L  ++   E
Sbjct:   45 LSDWDQRLPPPAAKTVVQSLTVVIISAEQADKGVKCPVCLLEFEEQETVREMPCKHLFHSGCILPWLGKTNSCPLCRLELPTDNPEYE 132          
BLAST of RING-type domain-containing protein vs. Planmine SMEST
Match: SMESG000036540.1 (SMESG000036540.1)

HSP 1 Score: 457.988 bits (1177), Expect = 2.007e-165
Identity = 220/220 (100.00%), Postives = 220/220 (100.00%), Query Frame = 3
Query:   30 MATINTDNYFCHKCNRDVHISQDGKCVTCNDGFIERIESDNSMESDDDALNVFHIIRHIPSGSTTNETDGSFFITPRDHDNRNSVFGQLISNLFGGLLPLDFRSDPSDYIFSDQSFDNFVTRIMNQFEQSGPPPANEADIEKLQVTKITEANDTCSICLSDYEVGDEVYELPCQHKYHVQCLKTWLIKHGTCPICRKDLSGNDTRLESHDHIAQSSSNDP 689
            MATINTDNYFCHKCNRDVHISQDGKCVTCNDGFIERIESDNSMESDDDALNVFHIIRHIPSGSTTNETDGSFFITPRDHDNRNSVFGQLISNLFGGLLPLDFRSDPSDYIFSDQSFDNFVTRIMNQFEQSGPPPANEADIEKLQVTKITEANDTCSICLSDYEVGDEVYELPCQHKYHVQCLKTWLIKHGTCPICRKDLSGNDTRLESHDHIAQSSSNDP
Sbjct:    1 MATINTDNYFCHKCNRDVHISQDGKCVTCNDGFIERIESDNSMESDDDALNVFHIIRHIPSGSTTNETDGSFFITPRDHDNRNSVFGQLISNLFGGLLPLDFRSDPSDYIFSDQSFDNFVTRIMNQFEQSGPPPANEADIEKLQVTKITEANDTCSICLSDYEVGDEVYELPCQHKYHVQCLKTWLIKHGTCPICRKDLSGNDTRLESHDHIAQSSSNDP 220          
BLAST of RING-type domain-containing protein vs. Planmine SMEST
Match: SMESG000028227.1 (SMESG000028227.1)

HSP 1 Score: 60.4622 bits (145), Expect = 3.395e-10
Identity = 31/121 (25.62%), Postives = 62/121 (51.24%), Query Frame = 3
Query:  270 NRNSVFGQLISNLFGGLLPLDFRSDPSDYIFSDQSFDNFVTRIMNQFEQSGPPPANEADIEKLQV--TKITEANDTCSICLSDYEVGDEVYELPCQHKYHVQCLKTWLIKHGTCPICRKDL 626
            NR SV    IS +   ++ L + +    Y      + +   R+  +   +     N+  ++ L     +++   D C+IC+ +Y+VG+ +  LPC+H +H  C+ +WLI+  +CP+C+ D+
Sbjct:  191 NRTSVLFVSISFILLMIISLVWLTF---YYIQRFRYMHAKERLSRRLANAAKKALNKIPVKILSSDDKEVSYDYDQCAICIDNYQVGETIRILPCKHIFHKICIDSWLIEQRSCPMCKVDI 308          
BLAST of RING-type domain-containing protein vs. Planmine SMEST
Match: SMESG000013169.1 (SMESG000013169.1)

HSP 1 Score: 59.6918 bits (143), Expect = 4.407e-10
Identity = 25/61 (40.98%), Postives = 38/61 (62.30%), Query Frame = 3
Query:  447 IEKLQVTKITEAND---TCSICLSDYEVGDEVYELPCQHKYHVQCLKTWLIKHG-TCPICR 617
            ++K+ + K  +  D   TC+ICL D++ GD++  LPC H YH  C+  WL+K    CPIC+
Sbjct:  172 LKKIPLKKFVKGRDPFETCAICLDDFKDGDKLRILPCNHAYHANCIDPWLLKQKRNCPICK 232          
BLAST of RING-type domain-containing protein vs. Planmine SMEST
Match: SMESG000013169.1 (SMESG000013169.1)

HSP 1 Score: 60.077 bits (144), Expect = 4.434e-10
Identity = 25/61 (40.98%), Postives = 38/61 (62.30%), Query Frame = 3
Query:  447 IEKLQVTKITEAND---TCSICLSDYEVGDEVYELPCQHKYHVQCLKTWLIKHG-TCPICR 617
            ++K+ + K  +  D   TC+ICL D++ GD++  LPC H YH  C+  WL+K    CPIC+
Sbjct:  191 LKKIPLKKFVKGRDPFETCAICLDDFKDGDKLRILPCNHAYHANCIDPWLLKQKRNCPICK 251          
BLAST of RING-type domain-containing protein vs. Planmine SMEST
Match: SMESG000013169.1 (SMESG000013169.1)

HSP 1 Score: 59.6918 bits (143), Expect = 4.927e-10
Identity = 25/61 (40.98%), Postives = 38/61 (62.30%), Query Frame = 3
Query:  447 IEKLQVTKITEAND---TCSICLSDYEVGDEVYELPCQHKYHVQCLKTWLIKHG-TCPICR 617
            ++K+ + K  +  D   TC+ICL D++ GD++  LPC H YH  C+  WL+K    CPIC+
Sbjct:  206 LKKIPLKKFVKGRDPFETCAICLDDFKDGDKLRILPCNHAYHANCIDPWLLKQKRNCPICK 266          
The following BLAST results are available for this feature:
BLAST of RING-type domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RNF1263.407e-3027.82ring finger protein 126 [Source:HGNC Symbol;Acc:HG... [more]
RNF1266.880e-2525.09ring finger protein 126 [Source:HGNC Symbol;Acc:HG... [more]
RNF1151.961e-2338.40ring finger protein 115 [Source:HGNC Symbol;Acc:HG... [more]
RLIM9.036e-1336.90ring finger protein, LIM domain interacting [Sourc... [more]
RLIM9.036e-1336.90ring finger protein, LIM domain interacting [Sourc... [more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
H10E21.51.645e-1042.00pep chromosome:WBcel235:III:20531:23962:-1 gene:WB... [more]
C01G6.45.523e-943.18pep chromosome:WBcel235:II:9271265:9273042:-1 gene... [more]
C18B12.48.060e-930.68pep chromosome:WBcel235:X:15036662:15040602:-1 gen... [more]
toe-41.344e-840.00Target Of ERK kinase MPK-1 [Source:UniProtKB/TrEM... [more]
plr-18.101e-840.82Probable E3 ubiquitin-protein ligase plr-1 [Sourc... [more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Iru2.431e-2242.20gene:FBgn0037653 transcript:FBtr0081965[more]
CG76941.028e-1031.73gene:FBgn0038627 transcript:FBtr0290211[more]
CG76941.028e-1031.73gene:FBgn0038627 transcript:FBtr0083632[more]
CG76941.028e-1031.73gene:FBgn0038627 transcript:FBtr0344291[more]
gol8.225e-1043.75gene:FBgn0004919 transcript:FBtr0300179[more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rnf1263.312e-2541.12ring finger protein 126 [Source:ZFIN;Acc:ZDB-GENE-... [more]
rnf1152.524e-2435.77ring finger protein 115 [Source:ZFIN;Acc:ZDB-GENE-... [more]
si:ch211-81a5.11.167e-2138.68si:ch211-81a5.1 [Source:ZFIN;Acc:ZDB-GENE-060503-6... [more]
si:ch211-81a5.11.423e-2138.68si:ch211-81a5.1 [Source:ZFIN;Acc:ZDB-GENE-060503-6... [more]
si:ch211-59o9.104.649e-1333.67si:ch211-59o9.10 [Source:ZFIN;Acc:ZDB-GENE-101206-... [more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rnf1264.780e-2742.02ring finger protein 126 [Source:NCBI gene;Acc:4484... [more]
rnf1262.353e-2642.50ring finger protein 126 [Source:NCBI gene;Acc:4484... [more]
stxbp31.632e-2331.41syntaxin binding protein 3 [Source:Xenbase;Acc:XB-... [more]
stxbp33.007e-2331.41syntaxin binding protein 3 [Source:Xenbase;Acc:XB-... [more]
stxbp35.005e-2331.41syntaxin binding protein 3 [Source:Xenbase;Acc:XB-... [more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rnf1262.087e-2539.47ring finger protein 126 [Source:MGI Symbol;Acc:MGI... [more]
Rnf1152.371e-2325.27ring finger protein 115 [Source:MGI Symbol;Acc:MGI... [more]
Rnf1812.056e-1538.82ring finger protein 181 [Source:MGI Symbol;Acc:MGI... [more]
Rnf1812.056e-1538.82ring finger protein 181 [Source:MGI Symbol;Acc:MGI... [more]
Rnf1814.963e-1538.82ring finger protein 181 [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of RING-type domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6DIP3|RN126_XENTR9.096e-2642.50E3 ubiquitin-protein ligase RNF126 OS=Xenopus trop... [more]
sp|Q6IRP0|R126B_XENLA2.696e-2542.50E3 ubiquitin-protein ligase RNF126-B OS=Xenopus la... [more]
sp|Q7T0Q3|R126A_XENLA3.113e-2542.50E3 ubiquitin-protein ligase RNF126-A OS=Xenopus la... [more]
sp|Q91YL2|RN126_MOUSE1.459e-2439.47E3 ubiquitin-protein ligase RNF126 OS=Mus musculus... [more]
sp|Q0II22|RN126_BOVIN2.511e-2440.00E3 ubiquitin-protein ligase RNF126 OS=Bos taurus O... [more]
back to top
BLAST of RING-type domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G4LWM67.199e-3032.03Zinc finger protein, putative OS=Schistosoma manso... [more]
A0A2C9L8K43.262e-2933.33RING-type domain-containing protein OS=Biomphalari... [more]
T1KM538.851e-2933.66RING-type domain-containing protein OS=Tetranychus... [more]
G4LWM71.218e-2832.42Zinc finger protein, putative OS=Schistosoma manso... [more]
A0A3R7FL852.032e-2848.18E3 ubiquitin-protein ligase OS=Clonorchis sinensis... [more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rnf1268.182e-2742.99ring finger protein 126 [Source:ZFIN;Acc:ZDB-GENE-... [more]
rnf1261.441e-2642.11ring finger protein 126 [Source:ZFIN;Acc:ZDB-GENE-... [more]
rnf1261.750e-2643.81ring finger protein 126 [Source:ZFIN;Acc:ZDB-GENE-... [more]
rnf1152.818e-2436.09ring finger protein 115 [Source:NCBI gene;Acc:1071... [more]
si:ch211-81a5.17.535e-2335.25si:ch211-81a5.1 [Source:ZFIN;Acc:ZDB-GENE-060503-6... [more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rnf1262.903e-2733.76ring finger protein 126 [Source:ZFIN;Acc:ZDB-GENE-... [more]
RNF1151.519e-2233.33ring finger protein 115 [Source:HGNC Symbol;Acc:HG... [more]
ENSPMAT00000006942.16.997e-1738.20pep scaffold:Pmarinus_7.0:GL476534:934671:936845:1... [more]
si:ch1073-392o20.15.423e-1040.43ring finger protein 122 [Source:HGNC Symbol;Acc:HG... [more]
ENSPMAT00000003771.11.305e-938.33pep scaffold:Pmarinus_7.0:GL488469:4:5386:-1 gene:... [more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
YBR062C_mRNA1.125e-1037.35Protein of unknown function that interacts with Ms... [more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO320577.077e-1835.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO454791.178e-1334.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO292101.182e-1233.75pep supercontig:ASM20922v1:NEMVEscaffold_1403:1706... [more]
EDO417583.869e-1042.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO363796.275e-944.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rnf1268.914e-2627.51E3 ubiquitin-protein ligase RNF126 [Source:NCBI ge... [more]
RNF1263.967e-2541.12ring finger protein 126 [Source:NCBI gene;Acc:1011... [more]
rnf1152.760e-2234.85ring finger protein 115 [Source:NCBI gene;Acc:1011... [more]
rlim1.812e-1246.94ring finger protein, LIM domain interacting [Sourc... [more]
rnf1811.372e-1134.09ring finger protein 181 [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of RING-type domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000036540.12.007e-165100.00SMESG000036540.1[more]
SMESG000028227.13.395e-1025.62SMESG000028227.1[more]
SMESG000013169.14.407e-1040.98SMESG000013169.1[more]
SMESG000013169.14.434e-1040.98SMESG000013169.1[more]
SMESG000013169.14.927e-1040.98SMESG000013169.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024395 ID=SMED30024395|Name=RING-type domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=853bp
CTTAAATTAATTATTTTTAAATTTGTTTAATGGCTACGATTAATACAGAT
AATTACTTTTGTCATAAATGCAACAGGGACGTTCACATATCTCAGGATGG
TAAATGTGTAACGTGCAATGATGGATTTATTGAAAGAATTGAATCTGATA
ACTCAATGGAAAGTGATGATGATGCCTTGAATGTTTTTCACATTATTCGT
CATATACCAAGTGGGAGCACTACAAATGAAACTGATGGTTCTTTTTTTAT
TACTCCAAGAGATCATGATAACAGAAATAGTGTATTTGGCCAATTAATAT
CAAATTTATTTGGTGGATTGTTACCTCTAGATTTTAGATCAGATCCGTCA
GATTATATATTTTCAGATCAAAGTTTCGACAATTTTGTAACGAGAATTAT
GAATCAATTTGAACAGAGCGGTCCTCCACCAGCAAATGAGGCAGACATTG
AGAAGCTACAAGTCACTAAGATCACCGAAGCTAATGATACATGTTCCATT
TGTCTGTCAGATTATGAAGTGGGCGATGAAGTCTACGAGTTACCCTGTCA
GCATAAATATCACGTTCAGTGTCTAAAAACGTGGTTGATAAAACACGGAA
CTTGTCCGATTTGTCGAAAAGATTTATCAGGAAACGATACGCGATTAGAG
AGCCATGATCATATTGCACAAAGTTCATCGAATGATCCTTAGATTTGGTT
TCTTGCTCTTCGAGATATAATTGTTTATATCAGTCTATTTGTATGCTGAA
GTCAATGATAAAGAATAAAATTTATGACATCAATTTGTTGTTTACTTTAC
ATTTAAAATTATAGGTCACCCTTTTTTGTTTTAGAAATAATGTATTTTTA
TAC
back to top

protein sequence of SMED30024395-orf-1

>SMED30024395-orf-1 ID=SMED30024395-orf-1|Name=SMED30024395-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=221bp
MATINTDNYFCHKCNRDVHISQDGKCVTCNDGFIERIESDNSMESDDDAL
NVFHIIRHIPSGSTTNETDGSFFITPRDHDNRNSVFGQLISNLFGGLLPL
DFRSDPSDYIFSDQSFDNFVTRIMNQFEQSGPPPANEADIEKLQVTKITE
ANDTCSICLSDYEVGDEVYELPCQHKYHVQCLKTWLIKHGTCPICRKDLS
GNDTRLESHDHIAQSSSNDP*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0016567protein ubiquitination
Vocabulary: molecular function
TermDefinition
GO:0061630ubiquitin protein ligase activity
GO:0005515protein binding
GO:0008270zinc ion binding
GO:0016874ligase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000429neoblast
Vocabulary: INTERPRO
TermDefinition
IPR039525RNF126-like_zinc-ribbon
IPR001841Znf_RING
IPR013083Znf_RING/FYVE/PHD
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001841Zinc finger, RING-typeSMARTSM00184ring_2coord: 155..195
e-value: 2.0E-6
score: 37.4
IPR001841Zinc finger, RING-typePFAMPF13639zf-RING_2coord: 153..196
e-value: 2.3E-14
score: 53.4
IPR001841Zinc finger, RING-typePROSITEPS50089ZF_RING_2coord: 155..196
score: 12.106
IPR039525E3 ubiquitin-protein ligase RNF126-like, zinc-ribbonPFAMPF14369zinc_ribbon_9coord: 9..37
e-value: 1.5E-7
score: 31.5
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 121..201
e-value: 1.2E-21
score: 78.1
NoneNo IPR availablePANTHERPTHR15710E3 UBIQUITIN-PROTEIN LIGASE PRAJAcoord: 100..211
NoneNo IPR availablePANTHERPTHR15710:SF48coord: 100..211
NoneNo IPR availableCDDcd16454RING-H2_PA-TM-RINGcoord: 154..196
e-value: 2.52295E-18
score: 73.1049
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 146..200