Synaptotagmin like 4

Overview
NameSynaptotagmin like 4
Smed IDSMED30024390
Length (bp)2280
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Synaptotagmin like 4 (SMED30024390) t-SNE clustered cells

Violin plots show distribution of expression levels for Synaptotagmin like 4 (SMED30024390) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Synaptotagmin like 4 (SMED30024390) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Synaptotagmin like 4 (SMED30024390) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024390

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30024390SMESG000042371.1 dd_Smed_v4_7945_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30024390SMESG000042371.1 dd_Smed_v4_7945_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30024390SMESG000042371.1 dd_Smed_v4_7945_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30024390SMESG000042371.1 dd_Smed_v4_7945_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30024390SMESG000042371.1 dd_Smed_v4_7945_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Synaptotagmin like 4 vs. Ensembl Human
Match: MYRIP (myosin VIIA and Rab interacting protein [Source:HGNC Symbol;Acc:HGNC:19156])

HSP 1 Score: 91.2781 bits (225), Expect = 2.589e-18
Identity = 44/137 (32.12%), Postives = 76/137 (55.47%), Query Frame = 1
Query:  103 INLNFLKEDEVEAIVSVIEKDFEVKAAEKARICKLRKQLINKDHKAELLSQ-SPFEGSFCVLCCSKFFIIFNPKYVCASCGMQICQSCSIYVKMFNHIICAICQQQQDLMAMNCSWFYETIRRKFMEGGSQIVANSL 510
            ++L+ L +DE E ++ V+++DF ++  E+ R+ +L+++L  +  K  +LS+   F    C+ CCS F  + N K  C  C   +C+SC  Y K     +C +CQQ + L A +  WFY  ++ +F   GS  V  +L
Sbjct:    5 LDLSGLTDDETEHVLQVVQRDFNLRKKEEERLSELKQKLDEEGSKCSILSKHQQFVEHCCMRCCSPFTFLVNTKRQCGDCKFNVCKSCCSYQKHEKAWVCCVCQQARLLRAQSLEWFYNNVKSRFKRFGSAKVLKNL 141          
BLAST of Synaptotagmin like 4 vs. Ensembl Human
Match: MYRIP (myosin VIIA and Rab interacting protein [Source:HGNC Symbol;Acc:HGNC:19156])

HSP 1 Score: 91.2781 bits (225), Expect = 3.372e-18
Identity = 44/137 (32.12%), Postives = 76/137 (55.47%), Query Frame = 1
Query:  103 INLNFLKEDEVEAIVSVIEKDFEVKAAEKARICKLRKQLINKDHKAELLSQ-SPFEGSFCVLCCSKFFIIFNPKYVCASCGMQICQSCSIYVKMFNHIICAICQQQQDLMAMNCSWFYETIRRKFMEGGSQIVANSL 510
            ++L+ L +DE E ++ V+++DF ++  E+ R+ +L+++L  +  K  +LS+   F    C+ CCS F  + N K  C  C   +C+SC  Y K     +C +CQQ + L A +  WFY  ++ +F   GS  V  +L
Sbjct:    5 LDLSGLTDDETEHVLQVVQRDFNLRKKEEERLSELKQKLDEEGSKCSILSKHQQFVEHCCMRCCSPFTFLVNTKRQCGDCKFNVCKSCCSYQKHEKAWVCCVCQQARLLRAQSLEWFYNNVKSRFKRFGSAKVLKNL 141          
BLAST of Synaptotagmin like 4 vs. Ensembl Human
Match: MYRIP (myosin VIIA and Rab interacting protein [Source:HGNC Symbol;Acc:HGNC:19156])

HSP 1 Score: 91.2781 bits (225), Expect = 3.372e-18
Identity = 44/137 (32.12%), Postives = 76/137 (55.47%), Query Frame = 1
Query:  103 INLNFLKEDEVEAIVSVIEKDFEVKAAEKARICKLRKQLINKDHKAELLSQ-SPFEGSFCVLCCSKFFIIFNPKYVCASCGMQICQSCSIYVKMFNHIICAICQQQQDLMAMNCSWFYETIRRKFMEGGSQIVANSL 510
            ++L+ L +DE E ++ V+++DF ++  E+ R+ +L+++L  +  K  +LS+   F    C+ CCS F  + N K  C  C   +C+SC  Y K     +C +CQQ + L A +  WFY  ++ +F   GS  V  +L
Sbjct:    5 LDLSGLTDDETEHVLQVVQRDFNLRKKEEERLSELKQKLDEEGSKCSILSKHQQFVEHCCMRCCSPFTFLVNTKRQCGDCKFNVCKSCCSYQKHEKAWVCCVCQQARLLRAQSLEWFYNNVKSRFKRFGSAKVLKNL 141          
BLAST of Synaptotagmin like 4 vs. Ensembl Human
Match: MYRIP (myosin VIIA and Rab interacting protein [Source:HGNC Symbol;Acc:HGNC:19156])

HSP 1 Score: 90.5077 bits (223), Expect = 3.544e-18
Identity = 44/137 (32.12%), Postives = 76/137 (55.47%), Query Frame = 1
Query:  103 INLNFLKEDEVEAIVSVIEKDFEVKAAEKARICKLRKQLINKDHKAELLSQ-SPFEGSFCVLCCSKFFIIFNPKYVCASCGMQICQSCSIYVKMFNHIICAICQQQQDLMAMNCSWFYETIRRKFMEGGSQIVANSL 510
            ++L+ L +DE E ++ V+++DF ++  E+ R+ +L+++L  +  K  +LS+   F    C+ CCS F  + N K  C  C   +C+SC  Y K     +C +CQQ + L A +  WFY  ++ +F   GS  V  +L
Sbjct:    5 LDLSGLTDDETEHVLQVVQRDFNLRKKEEERLSELKQKLDEEGSKCSILSKHQQFVEHCCMRCCSPFTFLVNTKRQCGDCKFNVCKSCCSYQKHEKAWVCCVCQQARLLRAQSLEWFYNNVKSRFKRFGSAKVLKNL 141          
BLAST of Synaptotagmin like 4 vs. Ensembl Human
Match: MYRIP (myosin VIIA and Rab interacting protein [Source:HGNC Symbol;Acc:HGNC:19156])

HSP 1 Score: 68.5514 bits (166), Expect = 2.131e-13
Identity = 34/105 (32.38%), Postives = 60/105 (57.14%), Query Frame = 1
Query:  103 INLNFLKEDEVEAIVSVIEKDFEVKAAEKARICKLRKQLINKDHKAELLSQ-SPFEGSFCVLCCSKFFIIFNPKYVCASCGMQICQSCSIYVKMFNHIICAICQQ 414
            ++L+ L +DE E ++ V+++DF ++  E+ R+ +L+++L  +  K  +LS+   F    C+ CCS F  + N K  C  C   +C+SC  Y K     +C +CQQ
Sbjct:    5 LDLSGLTDDETEHVLQVVQRDFNLRKKEEERLSELKQKLDEEGSKCSILSKHQQFVEHCCMRCCSPFTFLVNTKRQCGDCKFNVCKSCCSYQKHEKAWVCCVCQQ 109          
BLAST of Synaptotagmin like 4 vs. Ensembl Fly
Match: Rph (gene:FBgn0030230 transcript:FBtr0071502)

HSP 1 Score: 58.5362 bits (140), Expect = 1.916e-8
Identity = 33/125 (26.40%), Postives = 62/125 (49.60%), Query Frame = 1
Query:  118 LKEDEVEAIVSVIEKDFEVKAAEKARICKLRKQLIN-KDHKAELLSQSPFEGSFCVLCCSKFFIIFNPKYV-CASCGMQICQSCSIYVKMFNHI--------ICAICQQQQDLMAMNCSWFYETI 462
            L+ +E EAI+SVI ++ E++ AE+ R+ +L +++   K H  E        G  C   C   F I  P+ + C  C   +C  CS+ + +  H         +C IC + +++   + +WF++ +
Sbjct:   40 LRPEEQEAIISVIRRNEEIEVAERQRVGRLVERVEKIKQHAVE-------RGPNCCRLCGDTFGILRPQRILCEDCRQSVCTKCSVDINIRYHTSERSREIWLCRICSETREMWKKSGAWFFKGL 157          
BLAST of Synaptotagmin like 4 vs. Ensembl Zebrafish
Match: si:ch211-106h4.9 (si:ch211-106h4.9 [Source:ZFIN;Acc:ZDB-GENE-070705-17])

HSP 1 Score: 93.5893 bits (231), Expect = 2.718e-20
Identity = 47/157 (29.94%), Postives = 84/157 (53.50%), Query Frame = 1
Query:  103 INLNFLKEDEVEAIVSVIEKDFEVKAAEKARICKLRKQLINKDHKAELLS-QSPFEGSFCVLCCSKFFIIFNPKYVCASCGMQICQSCSIYVKMFNHIICAICQQQQDLMAMNCSWFYETIRRKFMEGGSQIVANSLSEYPKKNAISPYILNMVKGA 570
            ++L+ L + E E ++ V+++D +++  E+ R+ +++K L+ +  ++ LLS Q  F    C+ CCS F  + N K  C  C   IC+SC  Y K     +C+ CQ+ + L   +  WFY  +RR+F   GS  V  +L  Y +  A    +  + +G+
Sbjct:    5 LDLSGLTDVEAEHVMQVVQRDMQLRKTEETRLFEMKKALVEEGSRSVLLSRQHRFNERCCIRCCSPFTFLLNTKRSCLDCSYNICKSCCTYSKKDKAWLCSSCQKTRLLKTQSLEWFYNNVRRRFKRFGSAKVLKNL--YRRHAAERGGLAELTEGS 159          
BLAST of Synaptotagmin like 4 vs. Ensembl Zebrafish
Match: si:ch211-106h4.9 (si:ch211-106h4.9 [Source:ZFIN;Acc:ZDB-GENE-070705-17])

HSP 1 Score: 97.0561 bits (240), Expect = 4.074e-20
Identity = 47/157 (29.94%), Postives = 84/157 (53.50%), Query Frame = 1
Query:  103 INLNFLKEDEVEAIVSVIEKDFEVKAAEKARICKLRKQLINKDHKAELLS-QSPFEGSFCVLCCSKFFIIFNPKYVCASCGMQICQSCSIYVKMFNHIICAICQQQQDLMAMNCSWFYETIRRKFMEGGSQIVANSLSEYPKKNAISPYILNMVKGA 570
            ++L+ L + E E ++ V+++D +++  E+ R+ +++K L+ +  ++ LLS Q  F    C+ CCS F  + N K  C  C   IC+SC  Y K     +C+ CQ+ + L   +  WFY  +RR+F   GS  V  +L  Y +  A    +  + +G+
Sbjct:    5 LDLSGLTDVEAEHVMQVVQRDMQLRKTEETRLFEMKKALVEEGSRSVLLSRQHRFNERCCIRCCSPFTFLLNTKRSCLDCSYNICKSCCTYSKKDKAWLCSSCQKTRLLKTQSLEWFYNNVRRRFKRFGSAKVLKNL--YRRHAAERGGLAELTEGS 159          
BLAST of Synaptotagmin like 4 vs. Ensembl Zebrafish
Match: myrip (Danio rerio myosin VIIA and Rab interacting protein (myrip), mRNA. [Source:RefSeq mRNA;Acc:NM_001353925])

HSP 1 Score: 91.6633 bits (226), Expect = 7.695e-20
Identity = 43/137 (31.39%), Postives = 75/137 (54.74%), Query Frame = 1
Query:  103 INLNFLKEDEVEAIVSVIEKDFEVKAAEKARICKLRKQLINKDHKAELLS-QSPFEGSFCVLCCSKFFIIFNPKYVCASCGMQICQSCSIYVKMFNHIICAICQQQQDLMAMNCSWFYETIRRKFMEGGSQIVANSL 510
            ++L+ L  +E E ++ V+++D +++  E+ R+ +++++L  +  +  LLS Q  F    C+ CCS F  + NPK  C  C   IC+SC  Y +     ICA CQ+ + L   +  WFY  ++ +F   GS  V  +L
Sbjct:    5 LDLSGLSNNEAEHVLRVVQRDMQLRKKEEERLSEMKQELEEEGSRCLLLSKQQKFNEHCCIRCCSPFTFLLNPKRQCLDCHYNICKSCCSYSQSERGYICAACQKSRHLRTQSLEWFYNNVKSRFKRFGSAKVLKTL 141          
BLAST of Synaptotagmin like 4 vs. Ensembl Zebrafish
Match: si:ch211-106h4.9 (si:ch211-106h4.9 [Source:ZFIN;Acc:ZDB-GENE-070705-17])

HSP 1 Score: 94.7449 bits (234), Expect = 8.348e-20
Identity = 63/233 (27.04%), Postives = 111/233 (47.64%), Query Frame = 1
Query:  103 INLNFLKEDEVEAIVSVIEKDFEVKAAEKARICKLRKQLINKDHKAELLS-QSPFEGSFCVLCCSKFFIIFNPKYVCASCGMQICQSCSIYVKMFNHIICAICQQQQDLMAMNCSWFYETIRRKFMEGGSQIVANSLSEYPKKNAISPYILNMVKGAQI--------------TKFRHQIEDAS--STILDSLRKVEGNLSDENIKSVRYDELIKKFSENLKMILHNTGQVIQ 750
            ++L+ L + E E ++ V+++D +++  E+ R+ +++K L+ +  ++ LLS Q  F    C+ CCS F  + N K  C  C   IC+SC  Y K     +C+ CQ+ + L   +  WFY  +RR+F   GS  V  +L  Y +  A    +  + +G+                + F  QIE+ S   TI  +LR  E  + DE I         ++     + +  N G++I+
Sbjct:    5 LDLSGLTDVEAEHVMQVVQRDMQLRKTEETRLFEMKKALVEEGSRSVLLSRQHRFNERCCIRCCSPFTFLLNTKRSCLDCSYNICKSCCTYSKKDKAWLCSSCQKTRLLKTQSLEWFYNNVRRRFKRFGSAKVLKNL--YRRHAAERGGLAELTEGSAYEESVCNESSVYESDSTFYKQIEEHSMAETISVALRVAEEAI-DEAIAQAESQTDNQEKQNEAQYLRQNRGELIE 234          
BLAST of Synaptotagmin like 4 vs. Ensembl Zebrafish
Match: myrip (myosin VIIA and Rab interacting protein [Source:NCBI gene;Acc:567049])

HSP 1 Score: 95.5153 bits (236), Expect = 9.654e-20
Identity = 43/137 (31.39%), Postives = 75/137 (54.74%), Query Frame = 1
Query:  103 INLNFLKEDEVEAIVSVIEKDFEVKAAEKARICKLRKQLINKDHKAELLS-QSPFEGSFCVLCCSKFFIIFNPKYVCASCGMQICQSCSIYVKMFNHIICAICQQQQDLMAMNCSWFYETIRRKFMEGGSQIVANSL 510
            ++L+ L  +E E ++ V+++D +++  E+ R+ +++++L  +  +  LLS Q  F    C+ CCS F  + NPK  C  C   IC+SC  Y +     ICA CQ+ + L   +  WFY  ++ +F   GS  V  +L
Sbjct:    5 LDLSGLSNNEAEHVLRVVQRDMQLRKKEEERLSEMKQELEEEGSRCLLLSKQHKFNEHCCIRCCSPFTFLLNPKRQCLDCHYNICKSCCSYSQSERGYICAACQKSRHLRTQSLEWFYNNVKSRFKRFGSAKVLKTL 141          
BLAST of Synaptotagmin like 4 vs. Ensembl Xenopus
Match: selenon (selenoprotein N [Source:Xenbase;Acc:XB-GENE-6456840])

HSP 1 Score: 97.4413 bits (241), Expect = 3.627e-20
Identity = 50/156 (32.05%), Postives = 86/156 (55.13%), Query Frame = 1
Query:  103 INLNFLKEDEVEAIVSVIEKDFEVKAAEKARICKLRKQLINKDHKAELLS-QSPFEGSFCVLCCSKFFIIFNPKYVCASCGMQICQSCSIYVKMFNHIICAICQQQQDLMAMNCSWFYETIRRKFMEGGSQIVANSLSEYPKKNAISPYILNMVKG 567
            ++L+ L EDE E ++ V+++DF ++  E+ R+ +L+++L  + +K  +L+ Q  F    C+ CCS F  + N K  C+ C   IC++CS Y K     IC +CQQ + L   +  W+Y  ++ +F   GS  V  +L  Y K    S    ++V+G
Sbjct:    5 LDLSGLTEDEAEHVLQVVQRDFSLRKKEEERLSELKQKLDEEGNKCSILAKQQKFNEHCCIRCCSPFTFLINSKRQCSDCKFNICKNCSSYQKKEKAWICNVCQQTRLLRTQSLEWYYNNVKSRFKRFGSAKVLKNL--YRKHRLESGACADIVEG 158          
BLAST of Synaptotagmin like 4 vs. Ensembl Xenopus
Match: selenon (selenoprotein N [Source:Xenbase;Acc:XB-GENE-6456840])

HSP 1 Score: 95.9005 bits (237), Expect = 8.959e-20
Identity = 45/137 (32.85%), Postives = 78/137 (56.93%), Query Frame = 1
Query:  103 INLNFLKEDEVEAIVSVIEKDFEVKAAEKARICKLRKQLINKDHKAELLS-QSPFEGSFCVLCCSKFFIIFNPKYVCASCGMQICQSCSIYVKMFNHIICAICQQQQDLMAMNCSWFYETIRRKFMEGGSQIVANSL 510
            ++L+ L EDE E ++ V+++DF ++  E+ R+ +L+++L  + +K  +L+ Q  F    C+ CCS F  + N K  C+ C   IC++CS Y K     IC +CQQ + L   +  W+Y  ++ +F   GS  V  +L
Sbjct:    5 LDLSGLTEDEAEHVLQVVQRDFSLRKKEEERLSELKQKLDEEGNKCSILAKQQKFNEHCCIRCCSPFTFLINSKRQCSDCKFNICKNCSSYQKKEKAWICNVCQQTRLLRTQSLEWYYNNVKSRFKRFGSAKVLKNL 141          
BLAST of Synaptotagmin like 4 vs. Ensembl Xenopus
Match: selenon (selenoprotein N [Source:Xenbase;Acc:XB-GENE-6456840])

HSP 1 Score: 95.9005 bits (237), Expect = 1.065e-19
Identity = 45/137 (32.85%), Postives = 78/137 (56.93%), Query Frame = 1
Query:  103 INLNFLKEDEVEAIVSVIEKDFEVKAAEKARICKLRKQLINKDHKAELLS-QSPFEGSFCVLCCSKFFIIFNPKYVCASCGMQICQSCSIYVKMFNHIICAICQQQQDLMAMNCSWFYETIRRKFMEGGSQIVANSL 510
            ++L+ L EDE E ++ V+++DF ++  E+ R+ +L+++L  + +K  +L+ Q  F    C+ CCS F  + N K  C+ C   IC++CS Y K     IC +CQQ + L   +  W+Y  ++ +F   GS  V  +L
Sbjct:    5 LDLSGLTEDEAEHVLQVVQRDFSLRKKEEERLSELKQKLDEEGNKCSILAKQQKFNEHCCIRCCSPFTFLINSKRQCSDCKFNICKNCSSYQKKEKAWICNVCQQTRLLRTQSLEWYYNNVKSRFKRFGSAKVLKNL 141          
BLAST of Synaptotagmin like 4 vs. Ensembl Xenopus
Match: selenon (selenoprotein N [Source:Xenbase;Acc:XB-GENE-6456840])

HSP 1 Score: 95.1301 bits (235), Expect = 1.761e-19
Identity = 45/137 (32.85%), Postives = 78/137 (56.93%), Query Frame = 1
Query:  103 INLNFLKEDEVEAIVSVIEKDFEVKAAEKARICKLRKQLINKDHKAELLS-QSPFEGSFCVLCCSKFFIIFNPKYVCASCGMQICQSCSIYVKMFNHIICAICQQQQDLMAMNCSWFYETIRRKFMEGGSQIVANSL 510
            ++L+ L EDE E ++ V+++DF ++  E+ R+ +L+++L  + +K  +L+ Q  F    C+ CCS F  + N K  C+ C   IC++CS Y K     IC +CQQ + L   +  W+Y  ++ +F   GS  V  +L
Sbjct:    5 LDLSGLTEDEAEHVLQVVQRDFSLRKKEEERLSELKQKLDEEGNKCSILAKQQKFNEHCCIRCCSPFTFLINSKRQCSDCKFNICKNCSSYQKKEKAWICNVCQQTRLLRTQSLEWYYNNVKSRFKRFGSAKVLKNL 141          
BLAST of Synaptotagmin like 4 vs. Ensembl Xenopus
Match: selenon (selenoprotein N [Source:Xenbase;Acc:XB-GENE-6456840])

HSP 1 Score: 74.7146 bits (182), Expect = 1.225e-15
Identity = 37/105 (35.24%), Postives = 63/105 (60.00%), Query Frame = 1
Query:  103 INLNFLKEDEVEAIVSVIEKDFEVKAAEKARICKLRKQLINKDHKAELLS-QSPFEGSFCVLCCSKFFIIFNPKYVCASCGMQICQSCSIYVKMFNHIICAICQQ 414
            ++L+ L EDE E ++ V+++DF ++  E+ R+ +L+++L  + +K  +L+ Q  F    C+ CCS F  + N K  C+ C   IC++CS Y K     IC +CQQ
Sbjct:    5 LDLSGLTEDEAEHVLQVVQRDFSLRKKEEERLSELKQKLDEEGNKCSILAKQQKFNEHCCIRCCSPFTFLINSKRQCSDCKFNICKNCSSYQKKEKAWICNVCQQ 109          
BLAST of Synaptotagmin like 4 vs. Ensembl Mouse
Match: Myrip (myosin VIIA and Rab interacting protein [Source:MGI Symbol;Acc:MGI:2384407])

HSP 1 Score: 87.8113 bits (216), Expect = 3.262e-19
Identity = 45/157 (28.66%), Postives = 83/157 (52.87%), Query Frame = 1
Query:  103 INLNFLKEDEVEAIVSVIEKDFEVKAAEKARICKLRKQLINKDHKAELLSQ-SPFEGSFCVLCCSKFFIIFNPKYVCASCGMQICQSCSIYVKMFNHIICAICQQQQDLMAMNCSWFYETIRRKFMEGGSQIVANSLSEYPKKNAISPYILNMVKGA 570
            ++L+ L +DE E ++ V+++DF ++  E+ R+ +++++L  ++ K  +LS+   F    C+ CCS F  + N +  C  C   +C+SC  Y K     +C +CQQ + L   +  WFY  ++ +F   GS  V  +L  Y K    S    +++ G 
Sbjct:    5 LDLSGLTDDETEHVLQVVQRDFNLRKKEEDRLSEMKQRLAEENSKCSILSKHQKFVERCCMRCCSPFTFLVNARRRCGECKFSVCKSCCSYQKHEKLWVCCVCQQARLLRTQSLEWFYNNVKSRFKRFGSAKVLKNL--YRKHRLESGACFDILGGG 159          
BLAST of Synaptotagmin like 4 vs. Ensembl Mouse
Match: Myrip (myosin VIIA and Rab interacting protein [Source:MGI Symbol;Acc:MGI:2384407])

HSP 1 Score: 88.5817 bits (218), Expect = 1.421e-17
Identity = 41/137 (29.93%), Postives = 76/137 (55.47%), Query Frame = 1
Query:  103 INLNFLKEDEVEAIVSVIEKDFEVKAAEKARICKLRKQLINKDHKAELLSQ-SPFEGSFCVLCCSKFFIIFNPKYVCASCGMQICQSCSIYVKMFNHIICAICQQQQDLMAMNCSWFYETIRRKFMEGGSQIVANSL 510
            ++L+ L +DE E ++ V+++DF ++  E+ R+ +++++L  ++ K  +LS+   F    C+ CCS F  + N +  C  C   +C+SC  Y K     +C +CQQ + L   +  WFY  ++ +F   GS  V  +L
Sbjct:    5 LDLSGLTDDETEHVLQVVQRDFNLRKKEEDRLSEMKQRLAEENSKCSILSKHQKFVERCCMRCCSPFTFLVNARRRCGECKFSVCKSCCSYQKHEKLWVCCVCQQARLLRTQSLEWFYNNVKSRFKRFGSAKVLKNL 141          
BLAST of Synaptotagmin like 4 vs. Ensembl Mouse
Match: Mlph (melanophilin [Source:MGI Symbol;Acc:MGI:2176380])

HSP 1 Score: 69.707 bits (169), Expect = 7.467e-12
Identity = 35/137 (25.55%), Postives = 71/137 (51.82%), Query Frame = 1
Query:  103 INLNFLKEDEVEAIVSVIEKDFEVKAAEKARICKLRKQLINKDHKAELLSQSP-FEGSFCVLCCSKFFIIFNPKYVCASCGMQICQSCSIYVKMFNHIICAICQQQQDLMAMNCSWFYETIRRKFMEGGSQIVANSL 510
            ++L+ L ++E E + +V+++DF+++  E+ R+  L+ ++  +  K ELLS +     + C  C   + ++ N +  C  C + +C+SCS         +C  C   + +   +  W+Y+ +R +F   GS  V  SL
Sbjct:    5 LDLSTLTDEEAEHVWAVVQRDFDLRRREEERLQGLKGKIQKESSKRELLSDTAHLNETHCARCLQPYRLLLNSRRQCLECSLFVCKSCSHAHPEEQGWLCDPCHLARVVKIGSLEWYYQHVRARFKRFGSAKVIRSL 141          
BLAST of Synaptotagmin like 4 vs. Ensembl Mouse
Match: Sytl3 (synaptotagmin-like 3 [Source:MGI Symbol;Acc:MGI:1933367])

HSP 1 Score: 63.5438 bits (153), Expect = 4.400e-11
Identity = 37/148 (25.00%), Postives = 69/148 (46.62%), Query Frame = 1
Query:  103 INLNFLKEDEVEAIVSVIEKDFEVKAAEKARICKLRKQLINKDHKAELLSQSPFEGSFCVLCCSKFFIIFNPKYVCASCGMQICQSCSIYVKMFNHIICAICQQQQDLMAMNCSWFYETIRRKFMEGGSQIVANS--LSEYPKKNAIS 540
            ++L   KE E + I+ V+ +D  V++ E+ R+ KL+  L +   K    S   ++   C  C     ++ N   VC  C  ++C  C ++++      C +C + +++      WF+E   RKF   G +  A +  L  Y + + IS
Sbjct:    5 VDLESFKELERDIILRVLYRDQTVQSTEEERVRKLKSHLQHLRWKGAKSSSQEYKEKCCARCQRALGLLLNRGAVCQGCSHRVCSECRVFLRRTRAWKCTVCFEDRNVKIKTGEWFFEERARKFPTAGRRETAGAKLLQSYQRLSKIS 152          
BLAST of Synaptotagmin like 4 vs. Ensembl Mouse
Match: Sytl3 (synaptotagmin-like 3 [Source:MGI Symbol;Acc:MGI:1933367])

HSP 1 Score: 65.855 bits (159), Expect = 1.518e-10
Identity = 37/148 (25.00%), Postives = 69/148 (46.62%), Query Frame = 1
Query:  103 INLNFLKEDEVEAIVSVIEKDFEVKAAEKARICKLRKQLINKDHKAELLSQSPFEGSFCVLCCSKFFIIFNPKYVCASCGMQICQSCSIYVKMFNHIICAICQQQQDLMAMNCSWFYETIRRKFMEGGSQIVANS--LSEYPKKNAIS 540
            ++L   KE E + I+ V+ +D  V++ E+ R+ KL+  L +   K    S   ++   C  C     ++ N   VC  C  ++C  C ++++      C +C + +++      WF+E   RKF   G +  A +  L  Y + + IS
Sbjct:    5 VDLESFKELERDIILRVLYRDQTVQSTEEERVRKLKSHLQHLRWKGAKSSSQEYKEKCCARCQRALGLLLNRGAVCQGCSHRVCSECRVFLRRTRAWKCTVCFEDRNVKIKTGEWFFEERARKFPTAGRRETAGAKLLQSYQRLSKIS 152          
BLAST of Synaptotagmin like 4 vs. UniProt/SwissProt
Match: sp|A8T6P4|MYRIP_DANRE (Rab effector MyRIP OS=Danio rerio OX=7955 GN=myrip PE=1 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 7.300e-19
Identity = 43/137 (31.39%), Postives = 75/137 (54.74%), Query Frame = 1
Query:  103 INLNFLKEDEVEAIVSVIEKDFEVKAAEKARICKLRKQLINKDHKAELLS-QSPFEGSFCVLCCSKFFIIFNPKYVCASCGMQICQSCSIYVKMFNHIICAICQQQQDLMAMNCSWFYETIRRKFMEGGSQIVANSL 510
            ++L+ L  +E E ++ V+++D +++  E+ R+ +++++L  +  +  LLS Q  F    C+ CCS F  + NPK  C  C   IC+SC  Y +     ICA CQ+ + L   +  WFY  ++ +F   GS  V  +L
Sbjct:    5 LDLSGLSNNEAEHVLRVVQRDMQLRKKEEERLSEMKQELEEEGSRCLLLSKQQKFNEHCCIRCCSPFTFLLNPKRQCLDCHYNICKSCCSYSQSERGYICAACQKSRHLRTQSLEWFYNNVKSRFKRFGSAKVLKTL 141          
BLAST of Synaptotagmin like 4 vs. UniProt/SwissProt
Match: sp|Q8NFW9|MYRIP_HUMAN (Rab effector MyRIP OS=Homo sapiens OX=9606 GN=MYRIP PE=1 SV=2)

HSP 1 Score: 91.2781 bits (225), Expect = 1.619e-17
Identity = 44/137 (32.12%), Postives = 76/137 (55.47%), Query Frame = 1
Query:  103 INLNFLKEDEVEAIVSVIEKDFEVKAAEKARICKLRKQLINKDHKAELLSQ-SPFEGSFCVLCCSKFFIIFNPKYVCASCGMQICQSCSIYVKMFNHIICAICQQQQDLMAMNCSWFYETIRRKFMEGGSQIVANSL 510
            ++L+ L +DE E ++ V+++DF ++  E+ R+ +L+++L  +  K  +LS+   F    C+ CCS F  + N K  C  C   +C+SC  Y K     +C +CQQ + L A +  WFY  ++ +F   GS  V  +L
Sbjct:    5 LDLSGLTDDETEHVLQVVQRDFNLRKKEEERLSELKQKLDEEGSKCSILSKHQQFVEHCCMRCCSPFTFLVNTKRQCGDCKFNVCKSCCSYQKHEKAWVCCVCQQARLLRAQSLEWFYNNVKSRFKRFGSAKVLKNL 141          
BLAST of Synaptotagmin like 4 vs. UniProt/SwissProt
Match: sp|Q7TNY7|MYRIP_RAT (Rab effector MyRIP OS=Rattus norvegicus OX=10116 GN=Myrip PE=1 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 9.043e-17
Identity = 41/137 (29.93%), Postives = 76/137 (55.47%), Query Frame = 1
Query:  103 INLNFLKEDEVEAIVSVIEKDFEVKAAEKARICKLRKQLINKDHKAELLSQ-SPFEGSFCVLCCSKFFIIFNPKYVCASCGMQICQSCSIYVKMFNHIICAICQQQQDLMAMNCSWFYETIRRKFMEGGSQIVANSL 510
            ++L+ L +DE E ++ V+++DF ++  E+ R+ +++++L  ++ K  +LS+   F    C+ CCS F  + N +  C  C   +C+SC  Y K     +C +CQQ + L   +  WFY  ++ +F   GS  V  +L
Sbjct:    5 LDLSGLTDDETEHVLQVVQRDFNLRKKEEDRLSEMKQRLAEENSKCSILSKHQKFVERCCMRCCSPFTFLVNARRRCGECKFSVCKSCCSYQKHEKLWVCCVCQQARLLRTQSLEWFYNNVKTRFKRFGSAKVLKNL 141          
BLAST of Synaptotagmin like 4 vs. UniProt/SwissProt
Match: sp|Q8K3I4|MYRIP_MOUSE (Rab effector MyRIP OS=Mus musculus OX=10090 GN=Myrip PE=1 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 9.941e-17
Identity = 41/137 (29.93%), Postives = 76/137 (55.47%), Query Frame = 1
Query:  103 INLNFLKEDEVEAIVSVIEKDFEVKAAEKARICKLRKQLINKDHKAELLSQ-SPFEGSFCVLCCSKFFIIFNPKYVCASCGMQICQSCSIYVKMFNHIICAICQQQQDLMAMNCSWFYETIRRKFMEGGSQIVANSL 510
            ++L+ L +DE E ++ V+++DF ++  E+ R+ +++++L  ++ K  +LS+   F    C+ CCS F  + N +  C  C   +C+SC  Y K     +C +CQQ + L   +  WFY  ++ +F   GS  V  +L
Sbjct:    5 LDLSGLTDDETEHVLQVVQRDFNLRKKEEDRLSEMKQRLAEENSKCSILSKHQKFVERCCMRCCSPFTFLVNARRRCGECKFSVCKSCCSYQKHEKLWVCCVCQQARLLRTQSLEWFYNNVKSRFKRFGSAKVLKNL 141          
BLAST of Synaptotagmin like 4 vs. UniProt/SwissProt
Match: sp|Q91V27|MELPH_MOUSE (Melanophilin OS=Mus musculus OX=10090 GN=Mlph PE=1 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 5.089e-11
Identity = 35/137 (25.55%), Postives = 71/137 (51.82%), Query Frame = 1
Query:  103 INLNFLKEDEVEAIVSVIEKDFEVKAAEKARICKLRKQLINKDHKAELLSQSP-FEGSFCVLCCSKFFIIFNPKYVCASCGMQICQSCSIYVKMFNHIICAICQQQQDLMAMNCSWFYETIRRKFMEGGSQIVANSL 510
            ++L+ L ++E E + +V+++DF+++  E+ R+  L+ ++  +  K ELLS +     + C  C   + ++ N +  C  C + +C+SCS         +C  C   + +   +  W+Y+ +R +F   GS  V  SL
Sbjct:    5 LDLSTLTDEEAEHVWAVVQRDFDLRRREEERLQGLKGKIQKESSKRELLSDTAHLNETHCARCLQPYRLLLNSRRQCLECSLFVCKSCSHAHPEEQGWLCDPCHLARVVKIGSLEWYYQHVRARFKRFGSAKVIRSL 141          
BLAST of Synaptotagmin like 4 vs. TrEMBL
Match: A0A183QJ30 (RabBD domain-containing protein OS=Schistosoma rodhaini OX=6188 PE=4 SV=1)

HSP 1 Score: 138.272 bits (347), Expect = 2.095e-31
Identity = 93/287 (32.40%), Postives = 151/287 (52.61%), Query Frame = 1
Query:  103 INLNFLKEDEVEAIVSVIEKDFEVKAAEKARICKLRKQLINKDHK--AELLSQSPFEGSFCVLCCSKFFIIFNPKYVCASCGMQICQSCSIYVKMFNHIICAICQQQQDLMAMNCSWFYETIRRKFMEGGSQIVANSL--SEY--------------------PKKNAISP------YILNMVKGAQITKFRHQIEDASSTILDSLRKVEGN--LSDENIKSVRYDELIKKFSENLKMILHNTGQVIQITLEXXXXXXXXXXXXXXLQVLRILHDEVELLVGKKIDV 867
            +NLN+L EDE + ++ V++KDFEV+A E+ R+ + R  ++ +D +  A+ L+ S  E + C+LC   F ++ NPK +C +C  +IC++CS  +  +N   C +C ++++  AM C+WFYET+ ++F E GS  VA SL  S Y                     KKN+I        Y  +  + AQI K R+++E      L  L  VE N  LS   I + +++ L  KF +N    + N  Q++ IT E      G+N +NI   V+  L  E+  +VG  + +
Sbjct:   52 LNLNYLNEDERQKVLCVVKKDFEVRAKERERLNRFRSSILRRDRELAAKHLT-SLTESTSCLLCGRPFILLINPKRICYNCKREICRNCSESINQYNEFFCRMCLKEKNYRAMTCNWFYETVIQRFREFGSTAVAKSLFGSRYKQVQNMAEEELWNLLFRTSSSKKNSIESKESETFYSADQAREAQIKKLRNRLEKLMEETLTELNAVEKNDSLSPRQI-TWQHESLSMKFKKNACREMRNFIQILYITTEKERMSQGMNTKNITPYVMDTLECEIGRMVGYSVKL 336          
BLAST of Synaptotagmin like 4 vs. TrEMBL
Match: A0A3Q0KQC8 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 3.590e-31
Identity = 102/334 (30.54%), Postives = 168/334 (50.30%), Query Frame = 1
Query:   79 SIEKYMYCINLNFLKEDEVEAIVSVIEKDFEVKAAEKARICKLRKQLINKDHK--AELLSQSPFEGSFCVLCCSKFFIIFNPKYVCASCGMQICQSCSIYVKMFNHIICAICQQQQDLMAMNCSWFYETIRRKFMEGGSQIVANSL----------------------SEYPKKNAISP------YILNMVKGAQITKFRHQIEDASSTILDSLRKVEGN--LSDENIKSVRYDELIKKFSENLKMILHNTGQVIQITLEXXXXXXXXXXXXXXLQVLRILHDEVELLVGKKI-DVKDLQEKLRKTRKAFETADLRDKTEMTLANAIVEKLISD 981
            SI+  +  +NLN+L EDE + ++ V++KDFEV+A E+ R+ + R  ++ +D +  A+ L+ S  E + C+LC   F ++ NPK +C +C  +IC++CS  +  +N   C +C ++++  AM C+WFYET+ ++F E GS  VA SL                      +   K+N+I        Y  +  + AQI K R+++E      L  L  VE N  LS   I + +++ +  KF +N    + N  Q++ +T E      G+N +NI   V+  L  E+  +VG  +  + D      +  K   T   RD  E  LA  +  KL SD
Sbjct:   44 SIQNDIENLNLNYLNEDERQKVLCVVKKDFEVRAKERERLNRFRSSILRRDRELAAKHLT-SLTESTSCLLCGRPFILLINPKRICYNCKREICRNCSESINQYNEFFCRMCLKEKNYRAMTCNWFYETVIQRFREFGSTAVAKSLFGSRFKQVQDMAEEELWNLLFRTSSSKRNSIESKESETFYSADQAREAQIKKLRNRLEKLMEETLTELNAVEKNDSLSPRQI-TWQHESVSMKFKKNACREMRNFIQILYVTTEKERMSQGMNTKNITPYVMDTLEGEIGRIVGYSVKGITDTNSLAVEDDKESVTMVDRDGVEGRLAEVLYNKLYSD 375          
BLAST of Synaptotagmin like 4 vs. TrEMBL
Match: G4VMW3 (RabBD domain-containing protein OS=Schistosoma mansoni OX=6183 GN=Smp_057410 PE=4 SV=1)

HSP 1 Score: 135.961 bits (341), Expect = 1.301e-30
Identity = 90/295 (30.51%), Postives = 154/295 (52.20%), Query Frame = 1
Query:   79 SIEKYMYCINLNFLKEDEVEAIVSVIEKDFEVKAAEKARICKLRKQLINKDHK--AELLSQSPFEGSFCVLCCSKFFIIFNPKYVCASCGMQICQSCSIYVKMFNHIICAICQQQQDLMAMNCSWFYETIRRKFMEGGSQIVANSL----------------------SEYPKKNAISP------YILNMVKGAQITKFRHQIEDASSTILDSLRKVEGN--LSDENIKSVRYDELIKKFSENLKMILHNTGQVIQITLEXXXXXXXXXXXXXXLQVLRILHDEVELLVGKKIDV 867
            SI+  +  +NLN+L EDE + ++ V++KDFEV+A E+ R+ + R  ++ +D +  A+ L+ S  E + C+LC   F ++ NPK +C +C  +IC++CS  +  +N   C +C ++++  AM C+WFYET+ ++F E GS  VA SL                      +   K+N+I        Y  +  + AQI K R+++E      L  L  VE N  LS   I + +++ +  KF +N    + N  Q++ +T E      G+N +NI   V+  L  E+  +VG  + +
Sbjct:   44 SIQNDIENLNLNYLNEDERQKVLCVVKKDFEVRAKERERLNRFRSSILRRDRELAAKHLT-SLTESTSCLLCGRPFILLINPKRICYNCKREICRNCSESINQYNEFFCRMCLKEKNYRAMTCNWFYETVIQRFREFGSTAVAKSLFGSRFKQVQDMAEEELWNLLFRTSSSKRNSIESKESETFYSADQAREAQIKKLRNRLEKLMEETLTELNAVEKNDSLSPRQI-TWQHESVSMKFKKNACREMRNFIQILYVTTEKERMSQGMNTKNITPYVMDTLEGEIGRIVGYSVKL 336          
BLAST of Synaptotagmin like 4 vs. TrEMBL
Match: A0A4Z2D9Z9 (Rab effector MyRIP isoform 1 OS=Schistosoma japonicum OX=6182 GN=EWB00_003028 PE=4 SV=1)

HSP 1 Score: 137.502 bits (345), Expect = 1.488e-29
Identity = 105/335 (31.34%), Postives = 171/335 (51.04%), Query Frame = 1
Query:   79 SIEKYMYCINLNFLKEDEVEAIVSVIEKDFEVKAAEKARICKLRKQLINKDHK--AELLSQSPFEGSFCVLCCSKFFIIFNPKYVCASCGMQICQSCSIYVKMFNHIICAICQQQQDLMAMNCSWFYETIRRKFMEGGSQIVANSL----------------------SEYPKKNAIS------PYILNMVKGAQITKFRHQIE---DASSTILDSLRKVEGNLSDENIKSVRYDELIKKFSENLKMILHNTGQVIQITLEXXXXXXXXXXXXXXLQVLRILHDEVELLVGKKI-DVKDLQEKLRKTRKAFETADLRDKTEMTLANAIVEKLISD 981
            SI+  +  +NLN L EDE + ++ V++KDFEV+A E+ R+ + R  +I +D +  A+ LS +  E + C+LC   F  + NPK +C +C   IC++CS +V  +N I+C +C +++D  AM C+WFY+T+ ++F E GS  VA SL                      S   ++N I        Y  +  K AQI K R +++   D + + L+++ K   +LS   I + +YD +  KF +N    L +  Q++ IT E +    G+N ++I   V+ IL  E+  +VG  + D+ D         K   T    D  E  LA+ +  KL  D
Sbjct:   45 SIQHAIENLNLNHLSEDERQQVLGVVKKDFEVRAKERERLNRYRLSIIRRDRELAAKRLS-TVIESTSCILCERVFMALINPKRICFNCQRTICRNCSEFVPKYNGILCRMCLKEKDYRAMTCNWFYDTVIQRFREFGSTAVAKSLFGSKYKQVQNMAEEELWNLLFRSSTSRRNLIESKESEKSYTADQAKEAQIKKLRDRLKKLMDETQSELNAVAK-NNSLSPRQI-TWQYDSVSVKFKKNACRELKSFIQLLYITTEKHRMSQGMNTKDITPYVMDILEREIGRIVGYSLKDITDSNNLTVDDDKESVTMTDCDGVEKRLADILYNKLSED 376          
BLAST of Synaptotagmin like 4 vs. TrEMBL
Match: A0A094ZQX0 (Rab effector MyRIP OS=Schistosoma haematobium OX=6185 GN=MS3_03695 PE=4 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 2.046e-29
Identity = 103/333 (30.93%), Postives = 165/333 (49.55%), Query Frame = 1
Query:   79 SIEKYMYCINLNFLKEDEVEAIVSVIEKDFEVKAAEKARICKLRKQLINKDHK-AELLSQSPFEGSFCVLCCSKFFIIFNPKYVCASCGMQICQSCSIYVKMFNHIICAICQQQQDLMAMNCSWFYETIRRKFMEGGSQIVANSL----------------------SEYPKKNAISP------YILNMVKGAQITKFRHQIEDASSTILDSLRKVEGN--LSDENIKSVRYDELIKKFSENLKMILHNTGQVIQITLEXXXXXXXXXXXXXXLQVLRILHDEVELLVGKKI-DVKDLQEKLRKTRKAFETADLRDKTEMTLANAIVEKLISD 981
            SI+  +  +NLN L EDE + ++ V++KDFEV+A E+ R+ + R  ++ +D + A     S  E + C+LC   F  + NPK++C +C  +IC++CS  +  ++  +C +C ++++  AM C+WFYET+ ++F E GS  VA SL                      S   K+N+I        Y  +  + AQI K R+++E      L  L  VE N  LS   I + +++ +  KF +N    + N  Q++ IT E      G+N +NI   V+  L  E+  +VG  +  V D      +  K   T   RD  E  LA  +  KL SD
Sbjct:   45 SIQHDIENLNLNHLNEDERQKVLCVVKKDFEVRAKERERLNRFRSSILRRDRELAVKSLTSTTESTSCLLCGRAFIPLINPKHICFNCQREICRNCSESMNKYDEFLCRMCLKEKNYRAMTCNWFYETVIQRFREFGSTTVAKSLFGSTYKQVQNMAEEELWNLLFRSSSSKRNSIESKESDKFYSADQAREAQIKKLRNRLEKLMEETLSELNGVEKNDSLSPRQI-TWQHESVGMKFKKNACREMRNFIQILYITTEKERMSQGMNTKNITPYVMDTLEGEIGRIVGYSVKGVTDTNSLAGEDDKESVTMVDRDSVEGRLAEILFNKLYSD 376          
BLAST of Synaptotagmin like 4 vs. Ensembl Cavefish
Match: si:ch211-106h4.9 (rab effector MyRIP-like [Source:NCBI gene;Acc:103028056])

HSP 1 Score: 95.5153 bits (236), Expect = 1.090e-19
Identity = 42/137 (30.66%), Postives = 73/137 (53.28%), Query Frame = 1
Query:  103 INLNFLKEDEVEAIVSVIEKDFEVKAAEKARICKLRKQLINKDHKAELLS-QSPFEGSFCVLCCSKFFIIFNPKYVCASCGMQICQSCSIYVKMFNHIICAICQQQQDLMAMNCSWFYETIRRKFMEGGSQIVANSL 510
            ++L+ L E+E E ++ V+++D  ++  E+ R+  L+++L  +D +  LLS Q  F    C+ CCS F  +  P+  C  C   IC+ C  Y       +C+ C++ + L   +  WFY  +RR+F   GS  V  +L
Sbjct:    6 LDLSTLTEEEAEHVLQVVQRDMRLRKTEEERLSDLKQELDEEDSRCVLLSRQQGFNQRCCIRCCSPFTFLLKPRRRCLDCNYNICKRCCSYSSTEKGWLCSACEKSRLLKTQSLEWFYSNVRRRFKRFGSAKVLKTL 142          
BLAST of Synaptotagmin like 4 vs. Ensembl Cavefish
Match: si:ch211-106h4.9 (rab effector MyRIP-like [Source:NCBI gene;Acc:103028056])

HSP 1 Score: 95.5153 bits (236), Expect = 1.158e-19
Identity = 42/137 (30.66%), Postives = 73/137 (53.28%), Query Frame = 1
Query:  103 INLNFLKEDEVEAIVSVIEKDFEVKAAEKARICKLRKQLINKDHKAELLS-QSPFEGSFCVLCCSKFFIIFNPKYVCASCGMQICQSCSIYVKMFNHIICAICQQQQDLMAMNCSWFYETIRRKFMEGGSQIVANSL 510
            ++L+ L E+E E ++ V+++D  ++  E+ R+  L+++L  +D +  LLS Q  F    C+ CCS F  +  P+  C  C   IC+ C  Y       +C+ C++ + L   +  WFY  +RR+F   GS  V  +L
Sbjct:    6 LDLSTLTEEEAEHVLQVVQRDMRLRKTEEERLSDLKQELDEEDSRCVLLSRQQGFNQRCCIRCCSPFTFLLKPRRRCLDCNYNICKRCCSYSSTEKGWLCSACEKSRLLKTQSLEWFYSNVRRRFKRFGSAKVLKTL 142          
BLAST of Synaptotagmin like 4 vs. Ensembl Cavefish
Match: mlphb (melanophilin-like [Source:NCBI gene;Acc:103033900])

HSP 1 Score: 88.9669 bits (219), Expect = 4.280e-18
Identity = 43/137 (31.39%), Postives = 73/137 (53.28%), Query Frame = 1
Query:  103 INLNFLKEDEVEAIVSVIEKDFEVKAAEKARICKLRKQLINKDHKAELLS-QSPFEGSFCVLCCSKFFIIFNPKYVCASCGMQICQSCSIYVKMFNHIICAICQQQQDLMAMNCSWFYETIRRKFMEGGSQIVANSL 510
            ++L+ L ++E   +  V+++DF ++  E+ R+  L+ +++ +D K ELL  QS    S C+ C   F  + N K+ C  C   +C++CS + K  N  +C  CQ  + L      WF+E +R +F   GS  V  SL
Sbjct:   11 LDLSRLTDEEARHVYQVVQRDFSLRKKEEERLGDLKTKIVKEDSKRELLGYQSTLSDSLCIHCLRPFKFLLNTKHQCLDCKFFVCKACSRFNKKDNGWVCDPCQSARLLKIGTLEWFHENVRSRFKRFGSAKVMKSL 147          
BLAST of Synaptotagmin like 4 vs. Ensembl Cavefish
Match: mlpha (melanophilin [Source:NCBI gene;Acc:103021787])

HSP 1 Score: 85.1149 bits (209), Expect = 8.536e-17
Identity = 43/137 (31.39%), Postives = 73/137 (53.28%), Query Frame = 1
Query:  103 INLNFLKEDEVEAIVSVIEKDFEVKAAEKARICKLRKQLINKDHKAELL-SQSPFEGSFCVLCCSKFFIIFNPKYVCASCGMQICQSCSIYVKMFNHIICAICQQQQDLMAMNCSWFYETIRRKFMEGGSQIVANSL 510
            ++L+ L ++E + +  VI++DF+++  E+ R+  LR ++  +D K ELL SQS    S C+ C   F  + N K  C  C +  C++CS Y K     +C  C+  + L      W+++ +R +F   GS  V  SL
Sbjct:    5 LDLSRLTDEEAKHVWEVIQRDFDLRKKEEERLGALRTKIEKEDTKRELLGSQSNLADSHCIHCLQPFKFLVNSKRQCLDCHLYTCKTCSKYNKKERGWVCDPCRMSRVLKIGTLGWYHDNMRSRFKRFGSAKVMRSL 141          
BLAST of Synaptotagmin like 4 vs. Ensembl Cavefish
Match: mlpha (melanophilin [Source:NCBI gene;Acc:103021787])

HSP 1 Score: 84.7297 bits (208), Expect = 1.101e-16
Identity = 43/137 (31.39%), Postives = 73/137 (53.28%), Query Frame = 1
Query:  103 INLNFLKEDEVEAIVSVIEKDFEVKAAEKARICKLRKQLINKDHKAELL-SQSPFEGSFCVLCCSKFFIIFNPKYVCASCGMQICQSCSIYVKMFNHIICAICQQQQDLMAMNCSWFYETIRRKFMEGGSQIVANSL 510
            ++L+ L ++E + +  VI++DF+++  E+ R+  LR ++  +D K ELL SQS    S C+ C   F  + N K  C  C +  C++CS Y K     +C  C+  + L      W+++ +R +F   GS  V  SL
Sbjct:    5 LDLSRLTDEEAKHVWEVIQRDFDLRKKEEERLGALRTKIEKEDTKRELLGSQSNLADSHCIHCLQPFKFLVNSKRQCLDCHLYTCKTCSKYNKKERGWVCDPCRMSRVLKIGTLGWYHDNMRSRFKRFGSAKVMRSL 141          
BLAST of Synaptotagmin like 4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009931.1 (pep scaffold:Pmarinus_7.0:GL476634:726032:749970:1 gene:ENSPMAG00000008982.1 transcript:ENSPMAT00000009931.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 82.8037 bits (203), Expect = 5.228e-18
Identity = 41/125 (32.80%), Postives = 72/125 (57.60%), Query Frame = 1
Query:  118 LKEDEVEAIVSVIEKDFEVKAAEKARICKLRKQLINKDHKAELLS-QSPFEGSFCVLCCSKFFIIFNPKYVCASCGMQICQSCSIYVKMFNHIICAICQQQQDLMAMNCSWFYETIRRKFMEGGS 489
            L +DE   I+ V+++D  ++  E  +I +L++ L  K     LL+ Q  F    C+LC S F I+ N +  C SC + +C+ CS Y +     +C++C +Q+ L A +  W+Y+T+R++F + GS
Sbjct:   10 LSQDEAAHIMEVLQRDAHLRQLEDRKIGELKEHLQEKKSMMGLLARQEAFNDKCCILCYSPFLILINSRERCQSCCLYVCRDCSAYNRQAKARLCSVCLKQRLLKARSFEWYYDTVRKRFKQFGS 134          
BLAST of Synaptotagmin like 4 vs. Ensembl Medaka
Match: si:ch211-106h4.9 (rab effector MyRIP [Source:NCBI gene;Acc:101164255])

HSP 1 Score: 96.6709 bits (239), Expect = 3.820e-20
Identity = 42/137 (30.66%), Postives = 80/137 (58.39%), Query Frame = 1
Query:  103 INLNFLKEDEVEAIVSVIEKDFEVKAAEKARICKLRKQLINKDHKAELLS-QSPFEGSFCVLCCSKFFIIFNPKYVCASCGMQICQSCSIYVKMFNHIICAICQQQQDLMAMNCSWFYETIRRKFMEGGSQIVANSL 510
            ++L  L E E   ++ V+++D +++  ++ R+ +L+++L  +  +  LLS Q+ F    C+ CCS F  + NPK  C+SC   +C++C +Y K     +C+ CQ+ + L A++  WFY  ++++F   GS  V  +L
Sbjct:    5 LDLTGLTEGEAAHVLQVVQRDMKLRKKDEERLSELKQELDEEGSRCLLLSRQTCFNRRCCIRCCSPFSFLLNPKRQCSSCSYNVCKACRVYNKRDRIWLCSACQKSRLLKALSLEWFYSNVKKRFKRFGSAKVLKTL 141          
BLAST of Synaptotagmin like 4 vs. Ensembl Medaka
Match: si:ch211-106h4.9 (rab effector MyRIP [Source:NCBI gene;Acc:101164255])

HSP 1 Score: 96.6709 bits (239), Expect = 4.731e-20
Identity = 42/137 (30.66%), Postives = 80/137 (58.39%), Query Frame = 1
Query:  103 INLNFLKEDEVEAIVSVIEKDFEVKAAEKARICKLRKQLINKDHKAELLS-QSPFEGSFCVLCCSKFFIIFNPKYVCASCGMQICQSCSIYVKMFNHIICAICQQQQDLMAMNCSWFYETIRRKFMEGGSQIVANSL 510
            ++L  L E E   ++ V+++D +++  ++ R+ +L+++L  +  +  LLS Q+ F    C+ CCS F  + NPK  C+SC   +C++C +Y K     +C+ CQ+ + L A++  WFY  ++++F   GS  V  +L
Sbjct:    5 LDLTGLTEGEAAHVLQVVQRDMKLRKKDEERLSELKQELDEEGSRCLLLSRQTCFNRRCCIRCCSPFSFLLNPKRQCSSCSYNVCKACRVYNKRDRIWLCSACQKSRLLKALSLEWFYSNVKKRFKRFGSAKVLKTL 141          
BLAST of Synaptotagmin like 4 vs. Ensembl Medaka
Match: myrip (myosin VIIA and Rab interacting protein [Source:NCBI gene;Acc:101165516])

HSP 1 Score: 89.3521 bits (220), Expect = 8.428e-18
Identity = 38/137 (27.74%), Postives = 76/137 (55.47%), Query Frame = 1
Query:  103 INLNFLKEDEVEAIVSVIEKDFEVKAAEKARICKLRKQLINKDHKAELLS-QSPFEGSFCVLCCSKFFIIFNPKYVCASCGMQICQSCSIYVKMFNHIICAICQQQQDLMAMNCSWFYETIRRKFMEGGSQIVANSL 510
            ++L+ L +DE E ++ V+++D +++  E+AR+ +++++L  +  +  +LS Q  F    C+ CC+ F  + NPK  C  C   +C++C  Y K     +C+ CQ+ +     +  W+Y  ++ +F   GS  V  +L
Sbjct:    5 LDLSGLTDDEAEHVLKVVQRDMKLRKKEEARLSEMKQELAEEGSRCSILSKQQRFNEHCCIRCCAPFTFLLNPKRQCLDCQYNVCKTCCTYSKKDKAWLCSACQKGRIYRTQSLEWYYNNVKSRFKRFGSAKVLKTL 141          
BLAST of Synaptotagmin like 4 vs. Ensembl Medaka
Match: mlpha (melanophilin [Source:NCBI gene;Acc:101156308])

HSP 1 Score: 86.6557 bits (213), Expect = 2.274e-17
Identity = 45/137 (32.85%), Postives = 73/137 (53.28%), Query Frame = 1
Query:  103 INLNFLKEDEVEAIVSVIEKDFEVKAAEKARICKLRKQLINKDHKAELL-SQSPFEGSFCVLCCSKFFIIFNPKYVCASCGMQICQSCSIYVKMFNHIICAICQQQQDLMAMNCSWFYETIRRKFMEGGSQIVANSL 510
            ++L+ L ++E + +  VI++DF ++  E+ R+ +L+ Q+  +D K ELL SQS    S C+ C   F  + N K  C  C M  C+SCS Y K     +C  C+  + L      W+++ +R +F   GS  V  SL
Sbjct:    5 LDLSRLTDEEAKHVWEVIQRDFNLRKKEEERLGELKNQIEKEDTKRELLGSQSRVSDSLCIRCLQPFKFLVNSKRQCLDCCMYTCKSCSRYNKKERGWVCDNCRMTRVLKIGTLGWYHDNVRNRFKRFGSAKVMRSL 141          
BLAST of Synaptotagmin like 4 vs. Ensembl Medaka
Match: mlphb (melanophilin [Source:NCBI gene;Acc:101161277])

HSP 1 Score: 75.485 bits (184), Expect = 8.725e-14
Identity = 39/137 (28.47%), Postives = 75/137 (54.74%), Query Frame = 1
Query:  103 INLNFLKEDEVEAIVSVIEKDFEVKAAEKARICKLRKQLINKDHKAELLS-QSPFEGSFCVLCCSKFFIIFNPKYVCASCGMQICQSCSIYVKMFNHIICAICQQQQDLMAMNCSWFYETIRRKFMEGGSQIVANSL 510
            ++L+ L ++E + ++ VI++DF+++  E+ R+ +L+ ++  +D K ELL  ++    S C+ C   F  + N K  C  C + +C+SCS + K     +C  C   + L      W+++ +R +F   GS  V +SL
Sbjct:   10 LDLSKLTDEEAKHVLEVIQRDFDLRKKEEDRLGELKTRIEREDIKRELLGNRTSLTESHCIRCLQAFKFLVNIKRQCLDCQLYVCRSCSHFNKNEQGWLCDPCHMTRVLKIGTLEWYHKIVRARFRRFGSAKVMHSL 146          
BLAST of Synaptotagmin like 4 vs. Planmine SMEST
Match: SMESG000042371.1 (SMESG000042371.1)

HSP 1 Score: 1257.66 bits (3253), Expect = 0.000e+0
Identity = 672/673 (99.85%), Postives = 672/673 (99.85%), Query Frame = 1
Query:   94 MYCINLNFLKEDEVEAIVSVIEKDFEVKAAEKARICKLRKQLINKDHKAELLSQSPFEGSFCVLCCSKFFIIFNPKYVCASCGMQICQSCSIYVKMFNHIICAICQQQQDLMAMNCSWFYETIRRKFMEGGSQIVANSLSEYPKKNAISPYILNMVKGAQITKFRHQIEDASSTILDSLRKVEGNLSDENIKSVRYDELIKKFSENLKMILHNTGQVIQITLEXXXXXXXXXXXXXXLQVLRILHDEVELLVGKKIDVKDLQEKLRKTRKAFETADLRDKTEMTLANAIVEKLISDHQQFLIETRDLQYDDLNTVLKDIVKNESMDFDYDSISQVPSRHGTVRKPHAAXXXXXXXXXXXXXXXDDSSKLYSLSGVGDRTQTVSKQWNDVQSIPKPEMNKDTVDSDEPPMVPVXXXXXXXXXXXXGYDSDMKVDSDVITMVANESQSSNWLMNARQPFGSLNSLNNITMDPYASLNRSIKKNKPATVIEGKDVKTEKDKSKIPIKKSQHFGSLNNISDRLDDPYIAINKNKIKRNPNQRPPSHLDLDQDIDAIVDQNKQFSRQTYNMSIDSEYKKNFTIATGIPVYKNENRQMERASSQDSGVVLSQKSSSNSVTPTVRSKNYETPQTTKLPISSRAKITKPQNVSFKKNDNAHGXXXXXXXXXXXXXXATRAD 2112
            MYCINLNFLKEDEVEAIVSVIEKDFEVKAAEKARICKLRKQLINKDHKAELLSQSPFEGSFCVLCCSKFFIIFNPKYVCASCGMQICQSCSIYVKMFNHIICAICQQQQDLMAMNCSWFYETIRRKFMEGGSQIVANSLSEYPKKNAISPYILNMVKGAQITKFRHQIEDASSTILDSLRKVEGNLSDENIKSVRYDELIKKFSENLKMILHNTGQVIQITLENYNNKTGINNQNINLQVLRILHDEVELLVGKKIDVKDLQEKLRKTRKAFETADLRDKTEMTLANAIVEKLISDHQQFLIETRDLQYDDLNTVLKDIVKNESMDFDYDSISQVPSRHGTVRKPHAAPVIPEPVIEVSPPESDDSSKLYSLSGVGDRTQTVSKQWNDVQSIPKPEMNKDTVDSDEPPMVPVRLKRTSSLSRKSGYDSDMKVDSDVITMVANESQSSNWLMNARQPFGSLNSLNNITMDPYASLNRSIKKNKPATVIEGKDVKTE DKSKIPIKKSQHFGSLNNISDRLDDPYIAINKNKIKRNPNQRPPSHLDLDQDIDAIVDQNKQFSRQTYNMSIDSEYKKNFTIATGIPVYKNENRQMERASSQDSGVVLSQKSSSNSVTPTVRSKNYETPQTTKLPISSRAKITKPQNVSFKKNDNAHGSNSSVDSDPNNVISATRAD
Sbjct:    1 MYCINLNFLKEDEVEAIVSVIEKDFEVKAAEKARICKLRKQLINKDHKAELLSQSPFEGSFCVLCCSKFFIIFNPKYVCASCGMQICQSCSIYVKMFNHIICAICQQQQDLMAMNCSWFYETIRRKFMEGGSQIVANSLSEYPKKNAISPYILNMVKGAQITKFRHQIEDASSTILDSLRKVEGNLSDENIKSVRYDELIKKFSENLKMILHNTGQVIQITLENYNNKTGINNQNINLQVLRILHDEVELLVGKKIDVKDLQEKLRKTRKAFETADLRDKTEMTLANAIVEKLISDHQQFLIETRDLQYDDLNTVLKDIVKNESMDFDYDSISQVPSRHGTVRKPHAAPVIPEPVIEVSPPESDDSSKLYSLSGVGDRTQTVSKQWNDVQSIPKPEMNKDTVDSDEPPMVPVRLKRTSSLSRKSGYDSDMKVDSDVITMVANESQSSNWLMNARQPFGSLNSLNNITMDPYASLNRSIKKNKPATVIEGKDVKTENDKSKIPIKKSQHFGSLNNISDRLDDPYIAINKNKIKRNPNQRPPSHLDLDQDIDAIVDQNKQFSRQTYNMSIDSEYKKNFTIATGIPVYKNENRQMERASSQDSGVVLSQKSSSNSVTPTVRSKNYETPQTTKLPISSRAKITKPQNVSFKKNDNAHGSNSSVDSDPNNVISATRAD 673          
BLAST of Synaptotagmin like 4 vs. Planmine SMEST
Match: SMESG000042371.1 (SMESG000042371.1)

HSP 1 Score: 1187.17 bits (3070), Expect = 0.000e+0
Identity = 645/673 (95.84%), Postives = 645/673 (95.84%), Query Frame = 1
Query:   94 MYCINLNFLKEDEVEAIVSVIEKDFEVKAAEKARICKLRKQLINKDHKAELLSQSPFEGSFCVLCCSKFFIIFNPKYVCASCGMQICQSCSIYVKMFNHIICAICQQQQDLMAMNCSWFYETIRRKFMEGGSQIVANSLSEYPKKNAISPYILNMVKGAQITKFRHQIEDASSTILDSLRKVEGNLSDENIKSVRYDELIKKFSENLKMILHNTGQVIQITLEXXXXXXXXXXXXXXLQVLRILHDEVELLVGKKIDVKDLQEKLRKTRKAFETADLRDKTEMTLANAIVEKLISDHQQFLIETRDLQYDDLNTVLKDIVKNESMDFDYDSISQVPSRHGTVRKPHAAXXXXXXXXXXXXXXXDDSSKLYSLSGVGDRTQTVSKQWNDVQSIPKPEMNKDTVDSDEPPMVPVXXXXXXXXXXXXGYDSDMKVDSDVITMVANESQSSNWLMNARQPFGSLNSLNNITMDPYASLNRSIKKNKPATVIEGKDVKTEKDKSKIPIKKSQHFGSLNNISDRLDDPYIAINKNKIKRNPNQRPPSHLDLDQDIDAIVDQNKQFSRQTYNMSIDSEYKKNFTIATGIPVYKNENRQMERASSQDSGVVLSQKSSSNSVTPTVRSKNYETPQTTKLPISSRAKITKPQNVSFKKNDNAHGXXXXXXXXXXXXXXATRAD 2112
            MYCINLNFLKEDEVEAIVSVIEKDFEVKAAEKARICKLRKQLINKDHKAELLSQSPFEGSFCVLCCSKFFIIFNPKYVCASCGMQICQSCSIYVKMFNHIICAICQQQQDLMAMNCSWFYETIRRKFMEGGSQIVANSLSEYPKKNAISPYILNMVKGAQITKFRHQIEDASSTILDSLRKVEGNLSDENIKSVRYDELIKKFSENLKMILHNTGQVIQITLENYNNKTGINNQNINLQVLRILHDEVELLVGKKIDVKDLQEKLRKTRKAFETADLRDKTEMTLANAIVEK                           VKNESMDFDYDSISQVPSRHGTVRKPHAAPVIPEPVIEVSPPESDDSSKLYSLSGVGDRTQTVSKQWNDVQSIPKPEMNKDTVDSDEPPMVPVRLKRTSSLSRKSGYDSDMKVDSDVITMVANESQSSNWLMNARQPFGSLNSLNNITMDPYASLNRSIKKNKPATVIEGKDVKTE DKSKIPIKKSQHFGSLNNISDRLDDPYIAINKNKIKRNPNQRPPSHLDLDQDIDAIVDQNKQFSRQTYNMSIDSEYKKNFTIATGIPVYKNENRQMERASSQDSGVVLSQKSSSNSVTPTVRSKNYETPQTTKLPISSRAKITKPQNVSFKKNDNAHGSNSSVDSDPNNVISATRAD
Sbjct:    1 MYCINLNFLKEDEVEAIVSVIEKDFEVKAAEKARICKLRKQLINKDHKAELLSQSPFEGSFCVLCCSKFFIIFNPKYVCASCGMQICQSCSIYVKMFNHIICAICQQQQDLMAMNCSWFYETIRRKFMEGGSQIVANSLSEYPKKNAISPYILNMVKGAQITKFRHQIEDASSTILDSLRKVEGNLSDENIKSVRYDELIKKFSENLKMILHNTGQVIQITLENYNNKTGINNQNINLQVLRILHDEVELLVGKKIDVKDLQEKLRKTRKAFETADLRDKTEMTLANAIVEK---------------------------VKNESMDFDYDSISQVPSRHGTVRKPHAAPVIPEPVIEVSPPESDDSSKLYSLSGVGDRTQTVSKQWNDVQSIPKPEMNKDTVDSDEPPMVPVRLKRTSSLSRKSGYDSDMKVDSDVITMVANESQSSNWLMNARQPFGSLNSLNNITMDPYASLNRSIKKNKPATVIEGKDVKTENDKSKIPIKKSQHFGSLNNISDRLDDPYIAINKNKIKRNPNQRPPSHLDLDQDIDAIVDQNKQFSRQTYNMSIDSEYKKNFTIATGIPVYKNENRQMERASSQDSGVVLSQKSSSNSVTPTVRSKNYETPQTTKLPISSRAKITKPQNVSFKKNDNAHGSNSSVDSDPNNVISATRAD 646          
BLAST of Synaptotagmin like 4 vs. Planmine SMEST
Match: SMESG000012034.1 (SMESG000012034.1)

HSP 1 Score: 179.489 bits (454), Expect = 6.249e-47
Identity = 115/331 (34.74%), Postives = 183/331 (55.29%), Query Frame = 1
Query:  103 INLNFLKEDEVEAIVSVIEKDFEVKAAEKARICKLRKQLINKDHKAELLSQSPFEGSFCVLCCSKFFIIFNPKYVCASCGMQICQSCSIYVKMFNHIICAICQQQQDLMAMNCSWFYETIRRKFMEGGSQIVANSLSEYPKKNAI-------SPYILNMVKGAQITKFRHQIEDASSTILDSLRKVEGNLSDENIKSVRYDE----LIKKFSENLKMILHNTGQVIQITLEXXXXXXXXXXXXXXLQVLRILHDEVELLVGKKI-----DVKDLQEKLRKTRKAFETADLRDKTEMTLANAIVEKLISDHQQFLIETRDLQYDDLNTVLKD 1047
            I+L  L E E+E +V VI+KDFE+KAAEKAR+ + ++QL + D +  +L+ S F  +FCV+C  +FFII   K  C SC   +C  CS +V      IC +CQ++++L +M C W+Y  ++ +F + GS++VA SL     +  +       +P +L  VKGAQI+++R +I      + D LR +E      NI   + DE    L ++F  N + IL    Q + ITLENY  K    + NIN QV+  ++DE+EL++G +I     D+  +   +  T   F    + ++ E  LA A+V K++ DH        +LQ  D+ ++ +D
Sbjct:    8 IDLKNLSEAELEIVVQVIQKDFELKAAEKARLRRHKRQLKDYDKRVSILASSNFNENFCVICFQRFFIIVVRKRCCYSCRHLMCTKCSEWVPALKSYICLLCQKERNLKSMACEWYYNLLKSRFQQDGSEVVAQSLYSNQGQWYVQLADSITTPDLLKKVKGAQISRYRQKINARWEEMQDRLRMLE----QSNISKAKKDEAWHYLTEEFKNNFREILKEFSQFLYITLENYAAKVDDPDLNINEQVITTVYDEIELMIGYRINYMPEDMGSVISDVESTASMF----IGNQMEERLAAALVNKIVQDH-----SLNELQNFDMKSLTQD 325          
BLAST of Synaptotagmin like 4 vs. Planmine SMEST
Match: SMESG000012034.1 (SMESG000012034.1)

HSP 1 Score: 179.104 bits (453), Expect = 1.048e-46
Identity = 115/331 (34.74%), Postives = 183/331 (55.29%), Query Frame = 1
Query:  103 INLNFLKEDEVEAIVSVIEKDFEVKAAEKARICKLRKQLINKDHKAELLSQSPFEGSFCVLCCSKFFIIFNPKYVCASCGMQICQSCSIYVKMFNHIICAICQQQQDLMAMNCSWFYETIRRKFMEGGSQIVANSLSEYPKKNAI-------SPYILNMVKGAQITKFRHQIEDASSTILDSLRKVEGNLSDENIKSVRYDE----LIKKFSENLKMILHNTGQVIQITLEXXXXXXXXXXXXXXLQVLRILHDEVELLVGKKI-----DVKDLQEKLRKTRKAFETADLRDKTEMTLANAIVEKLISDHQQFLIETRDLQYDDLNTVLKD 1047
            I+L  L E E+E +V VI+KDFE+KAAEKAR+ + ++QL + D +  +L+ S F  +FCV+C  +FFII   K  C SC   +C  CS +V      IC +CQ++++L +M C W+Y  ++ +F + GS++VA SL     +  +       +P +L  VKGAQI+++R +I      + D LR +E      NI   + DE    L ++F  N + IL    Q + ITLENY  K    + NIN QV+  ++DE+EL++G +I     D+  +   +  T   F    + ++ E  LA A+V K++ DH        +LQ  D+ ++ +D
Sbjct:    8 IDLKNLSEAELEIVVQVIQKDFELKAAEKARLRRHKRQLKDYDKRVSILASSNFNENFCVICFQRFFIIVVRKRCCYSCRHLMCTKCSEWVPALKSYICLLCQKERNLKSMACEWYYNLLKSRFQQDGSEVVAQSLYSNQGQWYVQLADSITTPDLLKKVKGAQISRYRQKINARWEEMQDRLRMLE----QSNISKAKKDEAWHYLTEEFKNNFREILKEFSQFLYITLENYAAKVDDPDLNINEQVITTVYDEIELMIGYRINYMPEDMGSVISDVESTASMF----IGNQMEERLAAALVNKIVQDH-----SLNELQNFDMKSLTQD 325          
BLAST of Synaptotagmin like 4 vs. Planmine SMEST
Match: SMESG000012034.1 (SMESG000012034.1)

HSP 1 Score: 179.104 bits (453), Expect = 1.061e-46
Identity = 115/331 (34.74%), Postives = 183/331 (55.29%), Query Frame = 1
Query:  103 INLNFLKEDEVEAIVSVIEKDFEVKAAEKARICKLRKQLINKDHKAELLSQSPFEGSFCVLCCSKFFIIFNPKYVCASCGMQICQSCSIYVKMFNHIICAICQQQQDLMAMNCSWFYETIRRKFMEGGSQIVANSLSEYPKKNAI-------SPYILNMVKGAQITKFRHQIEDASSTILDSLRKVEGNLSDENIKSVRYDE----LIKKFSENLKMILHNTGQVIQITLEXXXXXXXXXXXXXXLQVLRILHDEVELLVGKKI-----DVKDLQEKLRKTRKAFETADLRDKTEMTLANAIVEKLISDHQQFLIETRDLQYDDLNTVLKD 1047
            I+L  L E E+E +V VI+KDFE+KAAEKAR+ + ++QL + D +  +L+ S F  +FCV+C  +FFII   K  C SC   +C  CS +V      IC +CQ++++L +M C W+Y  ++ +F + GS++VA SL     +  +       +P +L  VKGAQI+++R +I      + D LR +E      NI   + DE    L ++F  N + IL    Q + ITLENY  K    + NIN QV+  ++DE+EL++G +I     D+  +   +  T   F    + ++ E  LA A+V K++ DH        +LQ  D+ ++ +D
Sbjct:    8 IDLKNLSEAELEIVVQVIQKDFELKAAEKARLRRHKRQLKDYDKRVSILASSNFNENFCVICFQRFFIIVVRKRCCYSCRHLMCTKCSEWVPALKSYICLLCQKERNLKSMACEWYYNLLKSRFQQDGSEVVAQSLYSNQGQWYVQLADSITTPDLLKKVKGAQISRYRQKINARWEEMQDRLRMLE----QSNISKAKKDEAWHYLTEEFKNNFREILKEFSQFLYITLENYAAKVDDPDLNINEQVITTVYDEIELMIGYRINYMPEDMGSVISDVESTASMF----IGNQMEERLAAALVNKIVQDH-----SLNELQNFDMKSLTQD 325          
The following BLAST results are available for this feature:
BLAST of Synaptotagmin like 4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MYRIP2.589e-1832.12myosin VIIA and Rab interacting protein [Source:HG... [more]
MYRIP3.372e-1832.12myosin VIIA and Rab interacting protein [Source:HG... [more]
MYRIP3.372e-1832.12myosin VIIA and Rab interacting protein [Source:HG... [more]
MYRIP3.544e-1832.12myosin VIIA and Rab interacting protein [Source:HG... [more]
MYRIP2.131e-1332.38myosin VIIA and Rab interacting protein [Source:HG... [more]
back to top
BLAST of Synaptotagmin like 4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Synaptotagmin like 4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Rph1.916e-826.40gene:FBgn0030230 transcript:FBtr0071502[more]
back to top
BLAST of Synaptotagmin like 4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-106h4.92.718e-2029.94si:ch211-106h4.9 [Source:ZFIN;Acc:ZDB-GENE-070705-... [more]
si:ch211-106h4.94.074e-2029.94si:ch211-106h4.9 [Source:ZFIN;Acc:ZDB-GENE-070705-... [more]
myrip7.695e-2031.39Danio rerio myosin VIIA and Rab interacting protei... [more]
si:ch211-106h4.98.348e-2027.04si:ch211-106h4.9 [Source:ZFIN;Acc:ZDB-GENE-070705-... [more]
myrip9.654e-2031.39myosin VIIA and Rab interacting protein [Source:NC... [more]
back to top
BLAST of Synaptotagmin like 4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
selenon3.627e-2032.05selenoprotein N [Source:Xenbase;Acc:XB-GENE-645684... [more]
selenon8.959e-2032.85selenoprotein N [Source:Xenbase;Acc:XB-GENE-645684... [more]
selenon1.065e-1932.85selenoprotein N [Source:Xenbase;Acc:XB-GENE-645684... [more]
selenon1.761e-1932.85selenoprotein N [Source:Xenbase;Acc:XB-GENE-645684... [more]
selenon1.225e-1535.24selenoprotein N [Source:Xenbase;Acc:XB-GENE-645684... [more]
back to top
BLAST of Synaptotagmin like 4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Myrip3.262e-1928.66myosin VIIA and Rab interacting protein [Source:MG... [more]
Myrip1.421e-1729.93myosin VIIA and Rab interacting protein [Source:MG... [more]
Mlph7.467e-1225.55melanophilin [Source:MGI Symbol;Acc:MGI:2176380][more]
Sytl34.400e-1125.00synaptotagmin-like 3 [Source:MGI Symbol;Acc:MGI:19... [more]
Sytl31.518e-1025.00synaptotagmin-like 3 [Source:MGI Symbol;Acc:MGI:19... [more]
back to top
BLAST of Synaptotagmin like 4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A8T6P4|MYRIP_DANRE7.300e-1931.39Rab effector MyRIP OS=Danio rerio OX=7955 GN=myrip... [more]
sp|Q8NFW9|MYRIP_HUMAN1.619e-1732.12Rab effector MyRIP OS=Homo sapiens OX=9606 GN=MYRI... [more]
sp|Q7TNY7|MYRIP_RAT9.043e-1729.93Rab effector MyRIP OS=Rattus norvegicus OX=10116 G... [more]
sp|Q8K3I4|MYRIP_MOUSE9.941e-1729.93Rab effector MyRIP OS=Mus musculus OX=10090 GN=Myr... [more]
sp|Q91V27|MELPH_MOUSE5.089e-1125.55Melanophilin OS=Mus musculus OX=10090 GN=Mlph PE=1... [more]
back to top
BLAST of Synaptotagmin like 4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183QJ302.095e-3132.40RabBD domain-containing protein OS=Schistosoma rod... [more]
A0A3Q0KQC83.590e-3130.54Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
G4VMW31.301e-3030.51RabBD domain-containing protein OS=Schistosoma man... [more]
A0A4Z2D9Z91.488e-2931.34Rab effector MyRIP isoform 1 OS=Schistosoma japoni... [more]
A0A094ZQX02.046e-2930.93Rab effector MyRIP OS=Schistosoma haematobium OX=6... [more]
back to top
BLAST of Synaptotagmin like 4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-106h4.91.090e-1930.66rab effector MyRIP-like [Source:NCBI gene;Acc:1030... [more]
si:ch211-106h4.91.158e-1930.66rab effector MyRIP-like [Source:NCBI gene;Acc:1030... [more]
mlphb4.280e-1831.39melanophilin-like [Source:NCBI gene;Acc:103033900][more]
mlpha8.536e-1731.39melanophilin [Source:NCBI gene;Acc:103021787][more]
mlpha1.101e-1631.39melanophilin [Source:NCBI gene;Acc:103021787][more]
back to top
BLAST of Synaptotagmin like 4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000009931.15.228e-1832.80pep scaffold:Pmarinus_7.0:GL476634:726032:749970:1... [more]
back to top
BLAST of Synaptotagmin like 4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Synaptotagmin like 4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Synaptotagmin like 4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-106h4.93.820e-2030.66rab effector MyRIP [Source:NCBI gene;Acc:101164255... [more]
si:ch211-106h4.94.731e-2030.66rab effector MyRIP [Source:NCBI gene;Acc:101164255... [more]
myrip8.428e-1827.74myosin VIIA and Rab interacting protein [Source:NC... [more]
mlpha2.274e-1732.85melanophilin [Source:NCBI gene;Acc:101156308][more]
mlphb8.725e-1428.47melanophilin [Source:NCBI gene;Acc:101161277][more]
back to top
BLAST of Synaptotagmin like 4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000042371.10.000e+099.85SMESG000042371.1[more]
SMESG000042371.10.000e+095.84SMESG000042371.1[more]
SMESG000012034.16.249e-4734.74SMESG000012034.1[more]
SMESG000012034.11.048e-4634.74SMESG000012034.1[more]
SMESG000012034.11.061e-4634.74SMESG000012034.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024390 ID=SMED30024390|Name=Synaptotagmin like 4|organism=Schmidtea mediterranea sexual|type=transcript|length=2280bp
ATTGATTTATAGCAGAAGTTAAGTATTATGTATAAACTGCTGAACCAAAC
AGAATATATAGAAGTGATTTGATAATTTTCAATAGAGAAATATATGTATT
GTATTAACCTAAATTTCTTAAAAGAAGATGAAGTCGAAGCTATTGTATCA
GTTATTGAGAAAGATTTTGAAGTAAAAGCAGCGGAAAAAGCTAGAATATG
TAAACTCAGAAAACAATTAATTAACAAAGATCACAAAGCTGAACTTCTTA
GTCAGTCACCTTTCGAAGGATCATTTTGTGTTTTGTGCTGTAGTAAATTT
TTCATTATTTTCAATCCGAAATATGTATGTGCCTCATGTGGAATGCAAAT
ATGTCAATCATGCAGTATTTATGTGAAAATGTTTAACCATATCATATGCG
CAATTTGCCAGCAACAACAAGATTTAATGGCGATGAATTGTTCATGGTTC
TATGAAACTATTCGTCGAAAATTCATGGAAGGTGGTTCTCAGATCGTAGC
AAATAGCCTGAGTGAATATCCAAAGAAAAATGCGATTAGTCCATATATTC
TCAACATGGTAAAAGGTGCCCAGATCACCAAATTCCGGCATCAGATAGAA
GACGCTAGTAGTACAATTCTTGATTCACTTCGGAAAGTAGAAGGAAATCT
TAGTGATGAAAATATCAAATCAGTCCGATATGATGAGTTAATAAAAAAAT
TTTCAGAAAATTTAAAAATGATTTTGCATAACACAGGACAAGTTATTCAA
ATTACTCTTGAAAATTACAATAATAAGACAGGGATTAACAATCAGAATAT
TAATTTGCAAGTTTTGAGAATTTTGCATGACGAGGTAGAATTATTAGTCG
GGAAAAAAATAGATGTCAAAGATTTGCAAGAAAAATTACGAAAAACTCGA
AAAGCTTTCGAAACGGCAGATCTCAGAGATAAAACAGAAATGACATTGGC
TAATGCCATAGTTGAAAAATTGATATCTGATCATCAACAGTTTCTCATAG
AGACTCGAGATTTACAATATGATGATCTTAATACTGTTTTGAAAGATATT
GTCAAAAATGAGAGCATGGACTTTGATTATGATTCAATAAGTCAAGTTCC
GTCGAGACATGGAACGGTTAGAAAACCTCACGCTGCTCCAGTCATACCAG
AACCGGTCATTGAAGTTTCTCCACCTGAATCTGATGACTCTTCAAAATTA
TACAGTTTATCAGGAGTTGGTGACAGAACTCAAACCGTTTCTAAACAATG
GAATGACGTTCAATCCATTCCAAAACCAGAAATGAACAAAGATACAGTGG
ATTCTGATGAACCTCCTATGGTTCCTGTCAGACTTAAACGTACGTCGAGT
CTATCCAGGAAATCGGGTTACGATAGTGATATGAAAGTTGATTCTGATGT
AATTACTATGGTCGCTAACGAATCGCAATCATCAAACTGGTTGATGAACG
CAAGACAACCGTTTGGAAGTCTAAATAGTCTCAATAATATAACAATGGAT
CCATATGCCAGTTTGAACAGATCAATAAAAAAAAATAAACCAGCTACCGT
AATAGAAGGAAAAGACGTTAAAACAGAAAAGGACAAATCAAAAATACCAA
TTAAGAAATCTCAACATTTTGGAAGTCTGAATAATATTAGCGATCGACTG
GATGATCCATATATTGCAATAAATAAAAACAAAATCAAAAGGAATCCTAA
TCAGAGGCCACCGTCACATTTGGATCTTGATCAAGATATTGATGCGATTG
TTGATCAAAATAAACAATTTTCTAGACAAACATATAACATGAGCATTGAT
TCTGAATACAAGAAAAACTTCACAATTGCCACAGGTATTCCTGTGTATAA
AAATGAAAATAGACAAATGGAAAGAGCTAGTTCACAGGATTCTGGAGTTG
TATTATCGCAGAAATCCTCAAGTAATTCTGTAACTCCAACAGTGAGATCA
AAAAATTATGAAACTCCACAGACAACGAAATTGCCAATTTCATCTAGAGC
GAAAATAACAAAACCACAGAATGTATCTTTTAAAAAAAATGACAATGCTC
ATGGAAGCAACTCATCGGTTGATAGTGATCCCAATAACGTTATATCTGCC
ACTCGAGCAGATAACAAATCGACAAAAAAAAATTCAAATTAGCCGAATAA
GTTCCAGAGATTTTTATAAATTGACATATCTCATAGCGTTATGTTTTCAA
GGTGATTTTAAAAAAATATTCAAATTTTTACTGCGAATTTTTTAAATGAC
TTTTTCTTAATCTGATTTTGTAAGATTATG
back to top

protein sequence of SMED30024390-orf-1

>SMED30024390-orf-1 ID=SMED30024390-orf-1|Name=SMED30024390-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=683bp
MYCINLNFLKEDEVEAIVSVIEKDFEVKAAEKARICKLRKQLINKDHKAE
LLSQSPFEGSFCVLCCSKFFIIFNPKYVCASCGMQICQSCSIYVKMFNHI
ICAICQQQQDLMAMNCSWFYETIRRKFMEGGSQIVANSLSEYPKKNAISP
YILNMVKGAQITKFRHQIEDASSTILDSLRKVEGNLSDENIKSVRYDELI
KKFSENLKMILHNTGQVIQITLENYNNKTGINNQNINLQVLRILHDEVEL
LVGKKIDVKDLQEKLRKTRKAFETADLRDKTEMTLANAIVEKLISDHQQF
LIETRDLQYDDLNTVLKDIVKNESMDFDYDSISQVPSRHGTVRKPHAAPV
IPEPVIEVSPPESDDSSKLYSLSGVGDRTQTVSKQWNDVQSIPKPEMNKD
TVDSDEPPMVPVRLKRTSSLSRKSGYDSDMKVDSDVITMVANESQSSNWL
MNARQPFGSLNSLNNITMDPYASLNRSIKKNKPATVIEGKDVKTEKDKSK
IPIKKSQHFGSLNNISDRLDDPYIAINKNKIKRNPNQRPPSHLDLDQDID
AIVDQNKQFSRQTYNMSIDSEYKKNFTIATGIPVYKNENRQMERASSQDS
GVVLSQKSSSNSVTPTVRSKNYETPQTTKLPISSRAKITKPQNVSFKKND
NAHGSNSSVDSDPNNVISATRADNKSTKKNSN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0001778plasma membrane repair
GO:0006887exocytosis
GO:0032418lysosome localization
GO:0045921positive regulation of exocytosis
GO:0046676negative regulation of insulin secretion
GO:0050714positive regulation of protein secretion
GO:0071985multivesicular body sorting pathway
GO:1905684regulation of plasma membrane repair
GO:0006886intracellular protein transport
Vocabulary: molecular function
TermDefinition
GO:0005543phospholipid binding
GO:0042043neurexin family protein binding
GO:0017137Rab GTPase binding
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005768endosome
GO:0016020membrane
GO:0019898extrinsic component of membrane
GO:0030141secretory granule
GO:0005622intracellular
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000018Category 4 cell
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR041282FYVE_2
IPR011011Znf_FYVE_PHD
IPR013083Znf_RING/FYVE/PHD
IPR010911Rab_BD
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 258..278
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 591..682
NoneNo IPR availablePANTHERPTHR14555MYELIN-ASSOCIATED OLIGODENDROCYTIC BASIC PROTEIN MOBP -RELATEDcoord: 6..644
IPR041282FYVE-type zinc fingerPFAMPF02318FYVE_2coord: 9..123
e-value: 1.8E-22
score: 79.7
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 2..143
e-value: 2.7E-26
score: 93.7
IPR010911Rab-binding domainPROSITEPS50916RABBDcoord: 3..122
score: 11.267
IPR011011Zinc finger, FYVE/PHD-typeSUPERFAMILYSSF57903FYVE/PHD zinc fingercoord: 8..128