Transmembrane protein 26

Overview
NameTransmembrane protein 26
Smed IDSMED30024383
Length (bp)1803
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transmembrane protein 26 (SMED30024383) t-SNE clustered cells

Violin plots show distribution of expression levels for Transmembrane protein 26 (SMED30024383) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Transmembrane protein 26 (SMED30024383) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Transmembrane protein 26 (SMED30024383) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024383

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30024383SMESG000079787.1 SmedASXL_011507SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30024383SMESG000079787.1 dd_Smed_v4_15637_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30024383SMESG000079787.1 dd_Smed_v4_15637_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30024383SMESG000079787.1 dd_Smed_v4_15637_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30024383SMESG000079787.1 dd_Smed_v4_15637_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30024383SMESG000079787.1 dd_Smed_v4_15637_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30024383SMESG000079787.1 dd_Smed_v4_15637_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30024383SMESG000079787.1 dd_Smed_v4_15637_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30024383SMESG000079787.1 dd_Smed_v6_15637_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
enteric muscle cellSMED30024383SMESG000079787.1 dd_Smed_v4_15637_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
reproductive organSMED30024383SMESG000079787.1 SMESG000011052.1 Contig15487newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30024383SMESG000079787.1 SMESG000011052.1 Contig15487uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transmembrane protein 26 vs. Ensembl Human
Match: TMEM26 (transmembrane protein 26 [Source:HGNC Symbol;Acc:HGNC:28550])

HSP 1 Score: 86.2705 bits (212), Expect = 1.629e-17
Identity = 61/151 (40.40%), Postives = 81/151 (53.64%), Query Frame = 3
Query:  951 GGITRDQLSQLLLVNIGMAADILELF-EALKEKVVRHHXXXXXXXXXXWQMSLFQFSLTKTVTKARKVRLGYFEDYSTKSNTENNLQITNCICCRTELWAIATSLLLQDIPFFCLRITLIVDFDVLSYSNIFFTCKNSLVILLQLFRSYVI 1400
            GGITRDQLSQLLL+ +G AADILE   E L+E+ VR+   L   ILV+W  S+ QF L   V                 S TE             +LW I  S+ +QD PF  +R+ L+  F V++   +FF  KN LV++LQL+R  V+
Sbjct:  167 GGITRDQLSQLLLMFVGTAADILEFTSETLEEQNVRNSPALVYAILVIWTWSMLQFPLDLAVQNV----------VCPVSVTERGFPSLFFCQYSADLWNIGISVFIQDGPFLVVRLILMTYFKVINQMLVFFAAKNFLVVVLQLYRLVVL 307          
BLAST of Transmembrane protein 26 vs. Ensembl Human
Match: TMEM26 (transmembrane protein 26 [Source:HGNC Symbol;Acc:HGNC:28550])

HSP 1 Score: 86.2705 bits (212), Expect = 1.629e-17
Identity = 61/151 (40.40%), Postives = 81/151 (53.64%), Query Frame = 3
Query:  951 GGITRDQLSQLLLVNIGMAADILELF-EALKEKVVRHHXXXXXXXXXXWQMSLFQFSLTKTVTKARKVRLGYFEDYSTKSNTENNLQITNCICCRTELWAIATSLLLQDIPFFCLRITLIVDFDVLSYSNIFFTCKNSLVILLQLFRSYVI 1400
            GGITRDQLSQLLL+ +G AADILE   E L+E+ VR+   L   ILV+W  S+ QF L   V                 S TE             +LW I  S+ +QD PF  +R+ L+  F V++   +FF  KN LV++LQL+R  V+
Sbjct:  167 GGITRDQLSQLLLMFVGTAADILEFTSETLEEQNVRNSPALVYAILVIWTWSMLQFPLDLAVQNV----------VCPVSVTERGFPSLFFCQYSADLWNIGISVFIQDGPFLVVRLILMTYFKVINQMLVFFAAKNFLVVVLQLYRLVVL 307          
BLAST of Transmembrane protein 26 vs. Ensembl Human
Match: TMEM26 (transmembrane protein 26 [Source:HGNC Symbol;Acc:HGNC:28550])

HSP 1 Score: 54.6842 bits (130), Expect = 3.890e-8
Identity = 34/58 (58.62%), Postives = 41/58 (70.69%), Query Frame = 3
Query:  951 GGITRDQLSQLLLVNIGMAADILELF-EALKEKVVRHHXXXXXXXXXXWQMSLFQFSL 1121
            GGITRDQLSQLLL+ +G AADILE   E L+E+ VR+   L   ILV+W  S+ QF L
Sbjct:   77 GGITRDQLSQLLLMFVGTAADILEFTSETLEEQNVRNSPALVYAILVIWTWSMLQFPL 134          
BLAST of Transmembrane protein 26 vs. Ensembl Celegans
Match: Y119C1B.3 (pep chromosome:WBcel235:I:4550401:4552758:1 gene:WBGene00022469.1 transcript:Y119C1B.3.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y119C1B.3)

HSP 1 Score: 109.768 bits (273), Expect = 1.960e-25
Identity = 59/158 (37.34%), Postives = 99/158 (62.66%), Query Frame = 3
Query:  945 PRGGITRDQLSQLLLVNIGMAADILELFEALKEKVVRHHXXXXXXXXXXWQMSLFQFSLTKTVTKARKVRLGYFEDYSTKSNTENNLQITNCICC--RTELWAIATSLLLQDIPFFCLRITLIVDFDVLSYSNIFFTCKNSLVILLQLFRSYVILSGK 1412
            P+G I+R+QLSQ+LL  + +++DI+E F+  KEKVV  +  +  I+L  W +SL QF    TV++ARK+R+    DY      +   +  +C       ++WAI  + +LQD+PF  +R+ L+   ++++Y+ IFF  KN L+ILLQ +RS +I++ +
Sbjct:  164 PKGDISREQLSQILLAYLAISSDIVEFFDVFKEKVVYSNSRVQTIVLTAWTLSLLQFPFVLTVSRARKMRVAITNDYEQLFARQ---RPRSCFKAFYDVDIWAIFLANVLQDVPFLLVRLYLMTVHNLITYTMIFFFFKNMLIILLQTYRSIIIINDR 318          
BLAST of Transmembrane protein 26 vs. Ensembl Celegans
Match: Y119C1B.3 (pep chromosome:WBcel235:I:4549695:4552758:1 gene:WBGene00022469.1 transcript:Y119C1B.3.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y119C1B.3)

HSP 1 Score: 109.768 bits (273), Expect = 1.960e-25
Identity = 59/158 (37.34%), Postives = 99/158 (62.66%), Query Frame = 3
Query:  945 PRGGITRDQLSQLLLVNIGMAADILELFEALKEKVVRHHXXXXXXXXXXWQMSLFQFSLTKTVTKARKVRLGYFEDYSTKSNTENNLQITNCICC--RTELWAIATSLLLQDIPFFCLRITLIVDFDVLSYSNIFFTCKNSLVILLQLFRSYVILSGK 1412
            P+G I+R+QLSQ+LL  + +++DI+E F+  KEKVV  +  +  I+L  W +SL QF    TV++ARK+R+    DY      +   +  +C       ++WAI  + +LQD+PF  +R+ L+   ++++Y+ IFF  KN L+ILLQ +RS +I++ +
Sbjct:  164 PKGDISREQLSQILLAYLAISSDIVEFFDVFKEKVVYSNSRVQTIVLTAWTLSLLQFPFVLTVSRARKMRVAITNDYEQLFARQ---RPRSCFKAFYDVDIWAIFLANVLQDVPFLLVRLYLMTVHNLITYTMIFFFFKNMLIILLQTYRSIIIINDR 318          
BLAST of Transmembrane protein 26 vs. Ensembl Fly
Match: CG14238 (gene:FBgn0039429 transcript:FBtr0085014)

HSP 1 Score: 132.494 bits (332), Expect = 1.179e-32
Identity = 95/268 (35.45%), Postives = 150/268 (55.97%), Query Frame = 3
Query:  663 MSKNVSEISTVLQQPTTVISKINLS---TNSNIFILTRNISDIYVYGVSDITRVIKQKGTDVLKKIESMLAYLDIPYRTTILEQVXXXXXXXXXXXXPRGGITRDQLSQLLLVNIGMAADILELFEALKEKVVRHHXXXXXXXXXXWQMSLFQFSLTKTVTKARKVRLGYFEDYSTKSNTENNLQITNCI---CCRTELWAIATSLLLQDIPFFCLRITLIVDFDVLSYSNIFFTCKNSLVILLQLFRSYVILSGKTDDNQLESTISR 1448
            + K    +  +    +TV S  N S    N+ IFI + N S     GV  +  ++ Q G  +    ++          TT++EQ L+L LI+ RWLLP+G +TRDQLSQLLLV IG AADI+E F++ K+  +     L  + L +W  SL QF++  + T+ R+ R          S + +  + T+C    CC  ++W I  +++LQD PF   R+ +I  + +++Y N+FFTCKNSLVI+LQL+R YV+ + +   N+ ES +++
Sbjct:   86 LDKVARRVGNMTSTNSTVYSPSNYSIPVGNTTIFITSTNSS-----GVPPVATLLGQAGVTLSVTPDTW---------TTLIEQFLMLILIVGRWLLPKGDLTRDQLSQLLLVYIGTAADIIEFFDSYKDDSIAKIGFLVFLTLGIWSWSLMQFTIVLSATRGRRPR---------GSGSHHKEEHTDCCQNCCCGIDVWGIVLNVILQDAPFLTFRLLIIFQYKIINYMNVFFTCKNSLVIILQLYRLYVV-NAEFWKNRRESRMAK 329          

HSP 2 Score: 51.9878 bits (123), Expect = 1.267e-6
Identity = 43/141 (30.50%), Postives = 65/141 (46.10%), Query Frame = 3
Query:  162 RCIFILYASIAIWNVVIVKTSI-YWLLLATLFPLFIETFIGIQQIKMDVKPKSKVNKWFSPVVFLFLMCACPPIWIMELTIASNVTGHSEILNLTSREATISHFRPQLLPTTFQSANLTQVQSTKSPISVVSTSTLNITLS 581
            R IF  ++ +AIW VV +K+ I YW L     PL +    GI  I +    K++  +WF P VFL+L    P IW++EL   +   G     N+TS  +T+       +P    +  +T   S+  P          +TLS
Sbjct:   14 RIIFSAHSLLAIWQVVALKSDIIYWALCG---PLLLLLLEGIFTIMIK---KTQEWRWFCPSVFLYLSSIVPAIWLLELDKVARRVG-----NMTSTNSTVYSPSNYSIPVGNTTIFITSTNSSGVPPVATLLGQAGVTLS 143          
BLAST of Transmembrane protein 26 vs. Ensembl Zebrafish
Match: tmem26b (transmembrane protein 26b [Source:ZFIN;Acc:ZDB-GENE-080204-66])

HSP 1 Score: 91.6633 bits (226), Expect = 7.436e-20
Identity = 58/150 (38.67%), Postives = 83/150 (55.33%), Query Frame = 3
Query:  951 GGITRDQLSQLLLVNIGMAADILELFEALKEKVVRHHXXXXXXXXXXWQMSLFQFSLTKTVTKARKVRLGYFEDYSTKSNTENNLQITNCICCRTELWAIATSLLLQDIPFFCLRITLIVDFDVLSYSNIFFTCKNSLVILLQLFRSYVI 1400
            GG+TRD++SQLLL+ +G AADILE        V    L    +ILV+W +S+ QF L  +V   R   +   +D S  S              RT++W I  SL LQD PFF +R+T+++ F       +FFT KN LV++L ++R +VI
Sbjct:  160 GGVTRDEMSQLLLIFVGTAADILEFISETLSDVNEESLSFVCVILVVWTLSMLQFPLHFSVVNTRAEDVSVSQDGSLYSRY------------RTDIWNIGGSLFLQDGPFFVVRLTVMMVFSNFHQMLVFFTLKNFLVVMLNIYRLWVI 297          

HSP 2 Score: 60.8474 bits (146), Expect = 1.122e-9
Identity = 44/137 (32.12%), Postives = 66/137 (48.18%), Query Frame = 3
Query:  162 RCIFILYASIAIWNVVIVKTS-IYWLLLATLFPLFIETFIGIQQIKMDVKPKSKVNKWFSPVVFLFLMCACPPIWIMELTIASNVTGHSEILNLTSREATISHFRPQLLPTTFQSANLTQVQSTKSPISVVSTSTLN 569
            R +FIL + I +W V  VK + +YW L     PL +E  + ++      + K K  KWFSP +  FL+   P IWI+EL    N +  ++   L S E  I  F  +   +T  S N      T+ P+ ++ST   N
Sbjct:   12 RALFILVSLIGVWRVTWVKNNPLYWFLTILYLPLVVEMILTLR------RRKGKDYKWFSPAILFFLISIIPTIWILELHHEQNKSSDTKCTKLDSSE-DIRAFLHEWKNSTNGSVN------TQDPLKLLSTVCAN 135          
BLAST of Transmembrane protein 26 vs. Ensembl Zebrafish
Match: tmem26a (transmembrane protein 26a [Source:ZFIN;Acc:ZDB-GENE-101223-2])

HSP 1 Score: 88.5817 bits (218), Expect = 1.035e-18
Identity = 75/194 (38.66%), Postives = 102/194 (52.58%), Query Frame = 3
Query:  828 GTDVLKKIESMLAYLDIPYRTTILEQVXXXXXXXXXXXXP-RGGITRDQLSQLLLVNIGMAADILELFEALKEKVVRHHXXXXXXXXXXWQMSLFQFSLTKTVTKARKVRLGYFEDYSTKSNTENNLQITNCICCR--TELWAIATSLLLQDIPFFCLRITLIVDFDVLSYSNIFFTCKNSLVILLQLFRSYVI 1400
            G   LK +ESML  +        L QVLL+ LI+ +WLLP  GG+TRD+LSQLLL+ +G AADILE        V  ++  L  IIL +W  S+ QF L   V  +R                +      N I  R  T++W I  SL +QD PF  +R+ +++ FDV     +FF  KN LV++L L+R  VI
Sbjct:  117 GNATLKYLESMLTSVCANDWILALHQVLLILLILGKWLLPLGGGVTRDELSQLLLIFVGTAADILEFTSETLSDVKENNHQLVYIILAVWTWSMLQFPLHLAVVTSRP---------ENTDEPKGGDGCCNLILSRHSTDIWNIVESLFIQDGPFLVVRLIVMIYFDVFHQMLVFFAIKNFLVVVLNLYRLIVI 301          

HSP 2 Score: 58.151 bits (139), Expect = 1.110e-8
Identity = 33/84 (39.29%), Postives = 46/84 (54.76%), Query Frame = 3
Query:  162 RCIFILYASIAIWNVVIVKT-SIYWLLLATLFPLFIETFIGIQQIKMDVKPKSKVNKWFSPVVFLFLMCACPPIWIMELTIASN 410
            R +FIL + I +W V  VK  ++YWLL     PL +E  I ++      + K +  KWFSP + LFL+   P IWI+EL    N
Sbjct:   13 RSLFILVSLIGVWRVKTVKNDNMYWLLTILYLPLVVEMIITLK------RRKGQDYKWFSPAILLFLISIIPSIWILELHHQEN 90          
BLAST of Transmembrane protein 26 vs. Ensembl Zebrafish
Match: CU638868.1 (transmembrane protein 26a [Source:NCBI gene;Acc:794507])

HSP 1 Score: 75.485 bits (184), Expect = 1.081e-14
Identity = 72/189 (38.10%), Postives = 98/189 (51.85%), Query Frame = 3
Query:  843 KKIESMLAYLDIPYRTTILEQVXXXXXXXXXXXXP-RGGITRDQLSQLLLVNIGMAADILELFEALKEKVVRHHXXXXXXXXXXWQMSLFQFSLTKTVTKARKVRLGYFEDYSTKSNTENNLQITNCICCR--TELWAIATSLLLQDIPFFCLRITLIVDFDVLSYSNIFFTCKNSLVILLQLFRSYVI 1400
            K +ESML  +        L QVLL+ LI+ +WLLP  GG+TRD+LSQLLL+ +G AADILE        V  ++  L  IIL +W  S+ QF L             +  D              N I  R  T++W I  SL +QD PF  +R+ +++ FDV     +FF  KN LV++L L+R  VI
Sbjct:   91 KYLESMLTSVCANDWILALHQVLLILLILGKWLLPLGGGVTRDELSQLLLIFVGTAADILEFTSETLSDVKENNHQLVYIILAVWTWSMLQFPL-------------HLAD-----------GCCNLILSRHSTDIWNIVESLFIQDGPFLVVRLIVMIYFDVFHQMLVFFAIKNFLVVVLNLYRLIVI 255          

HSP 2 Score: 58.9214 bits (141), Expect = 4.468e-9
Identity = 60/220 (27.27%), Postives = 100/220 (45.45%), Query Frame = 3
Query:  162 RCIFILYASIAIWNVVIVKT-SIYWLLLATLFPLFIETFIGIQQIKMDVKPKSKVNKWFSPVVFLFLMCACPPIWIMEL---------TIASNVTGHSEILNLTSREATISHFRPQLLPTTFQSANLTQVQSTKSPISVVSTSTLNITLSDIIENNSTNLTSVSYGENSTLNETNVPMSKNVSEIST--VLQQPTTVISKINLSTNSNIFILTRNISDIY 785
            R +FIL + I +W V  VK  ++YWLL     PL +E  I ++      + K +  KWFSP + LFL+   P IWI+EL         ++ ++V  +  IL L      +      LLP       +T+ + ++  +  V T+      +DI+E  S  L+ V         E N  +   +  + T  +LQ P      ++L+      IL+R+ +DI+
Sbjct:   13 RSLFILVSLIGVWRVKTVKNDNMYWLLTILYLPLVVEMIITLK------RRKGQDYKWFSPAILLFLISIIPSIWILELHHQENKYLESMLTSVCANDWILALHQVLLILLILGKWLLPL---GGGVTRDELSQLLLIFVGTA------ADILEFTSETLSDV--------KENNHQLVYIILAVWTWSMLQFP------LHLADGCCNLILSRHSTDIW 203          
BLAST of Transmembrane protein 26 vs. Ensembl Xenopus
Match: nsa2 (NSA2, ribosome biogenesis homolog [Source:Xenbase;Acc:XB-GENE-478113])

HSP 1 Score: 90.5077 bits (223), Expect = 1.273e-19
Identity = 66/157 (42.04%), Postives = 91/157 (57.96%), Query Frame = 3
Query:  945 PRG-GITRDQLSQLLLVNIGMAADILELF-EALKEKVVRHHXXXXXXXXXXWQMSLFQFSLTKTVTKARKVRLGYFEDYSTKSNTENNLQITNCICCR--TELWAIATSLLLQDIPFFCLRITLIVDFDVLSYSNIFFTCKNSLVILLQLFRSYVIL 1403
            P G G TRDQLSQLLL+ +G AADILE   E L++  VR+++IL   IL +W  S+ QF L   V                 + T+N L   N + CR   +LW I  SLL+QD PF   R+ L+  F+V++   +FFT KN LV++LQL+R  V++
Sbjct:   63 PIGAGTTRDQLSQLLLMFVGTAADILEFTSETLEQDNVRNNVILVYSILAVWTWSMLQFPLDLAVQNIA---------CQPATLTKNPL---NMLVCRYSADLWNIGISLLIQDGPFLVSRLILMAYFNVINQMLVFFTAKNILVVMLQLYRLVVLV 207          
BLAST of Transmembrane protein 26 vs. Ensembl Xenopus
Match: nsa2 (NSA2, ribosome biogenesis homolog [Source:Xenbase;Acc:XB-GENE-478113])

HSP 1 Score: 90.1225 bits (222), Expect = 1.380e-19
Identity = 66/157 (42.04%), Postives = 91/157 (57.96%), Query Frame = 3
Query:  945 PRG-GITRDQLSQLLLVNIGMAADILELF-EALKEKVVRHHXXXXXXXXXXWQMSLFQFSLTKTVTKARKVRLGYFEDYSTKSNTENNLQITNCICCR--TELWAIATSLLLQDIPFFCLRITLIVDFDVLSYSNIFFTCKNSLVILLQLFRSYVIL 1403
            P G G TRDQLSQLLL+ +G AADILE   E L++  VR+++IL   IL +W  S+ QF L   V                 + T+N L   N + CR   +LW I  SLL+QD PF   R+ L+  F+V++   +FFT KN LV++LQL+R  V++
Sbjct:   49 PIGAGTTRDQLSQLLLMFVGTAADILEFTSETLEQDNVRNNVILVYSILAVWTWSMLQFPLDLAVQNIA---------CQPATLTKNPL---NMLVCRYSADLWNIGISLLIQDGPFLVSRLILMAYFNVINQMLVFFTAKNILVVMLQLYRLVVLV 193          
BLAST of Transmembrane protein 26 vs. Ensembl Xenopus
Match: lrch3 (leucine-rich repeats and calponin homology (CH) domain containing 3 [Source:Xenbase;Acc:XB-GENE-877225])

HSP 1 Score: 89.3521 bits (220), Expect = 1.078e-18
Identity = 66/157 (42.04%), Postives = 91/157 (57.96%), Query Frame = 3
Query:  945 PRG-GITRDQLSQLLLVNIGMAADILELF-EALKEKVVRHHXXXXXXXXXXWQMSLFQFSLTKTVTKARKVRLGYFEDYSTKSNTENNLQITNCICCR--TELWAIATSLLLQDIPFFCLRITLIVDFDVLSYSNIFFTCKNSLVILLQLFRSYVIL 1403
            P G G TRDQLSQLLL+ +G AADILE   E L++  VR+++IL   IL +W  S+ QF L   V                 + T+N L   N + CR   +LW I  SLL+QD PF   R+ L+  F+V++   +FFT KN LV++LQL+R  V++
Sbjct:  153 PIGAGTTRDQLSQLLLMFVGTAADILEFTSETLEQDNVRNNVILVYSILAVWTWSMLQFPLDLAVQNIA---------CQPATLTKNPL---NMLVCRYSADLWNIGISLLIQDGPFLVSRLILMAYFNVINQMLVFFTAKNILVVMLQLYRLVVLV 297          
BLAST of Transmembrane protein 26 vs. Ensembl Xenopus
Match: nostrin (nitric oxide synthase trafficking [Source:Xenbase;Acc:XB-GENE-988808])

HSP 1 Score: 83.1889 bits (204), Expect = 5.621e-17
Identity = 62/198 (31.31%), Postives = 117/198 (59.09%), Query Frame = 3
Query:  864 AYLDI--PYRTTILEQVXXXXXXXXXXXXPRGGITRDQLSQLLLVNIGMAADILELFEALKEKVVRHHXXXXXXXXXXWQMSLFQFSLTKTVTKARKVRLGYFEDYSTKSNTENNLQITNCI-------CCRTELWAIATSLLLQDIPFFCLRITLIVDFDVLSYSNIFFTCKNSLVILLQLFRSYVI-LSGKTDDNQ 1427
            AY  I  P+  T LEQV++L +++ RW++P+G + R QL++LLL+ IG+ ADIL++   +K+  V    ++NI+ L ++  +L QF+L  T T++              S++ +N ++++ +       CC  E+W++  ++ +QD PF   R+ +++   VL+   IFF CKN   ++++++R +VI  S K+  N+
Sbjct:  110 AYFIIYNPWLLT-LEQVMILVIVMGRWIMPKGEMDRIQLTELLLIYIGLGADILDILNLIKDPQVETCRMVNIVGLSIFSWALLQFTLVLTQTQS--------------SDSTDNDEMSSSVKGTCGSSCCTNEVWSLLIAVGMQDGPFLIFRLYVMIKEQVLNEMMIFFICKNIFTVIIEIYRIFVIQCSKKSGKNE 292          
BLAST of Transmembrane protein 26 vs. Ensembl Mouse
Match: Tmem26 (transmembrane protein 26 [Source:MGI Symbol;Acc:MGI:2143537])

HSP 1 Score: 86.6557 bits (213), Expect = 7.881e-18
Identity = 64/169 (37.87%), Postives = 85/169 (50.30%), Query Frame = 3
Query:  945 PRGG-ITRDQLSQLLLVNIGMAADILELF-EALKEKVVRHHXXXXXXXXXXWQMSLFQFSLTKTV---------TKARKVRLGYFEDYSTKSNTENNLQITNCICCRTELWAIATSLLLQDIPFFCLRITLIVDFDVLSYSNIFFTCKNSLVILLQLFRSYVILSGKTD 1418
            P GG ITRDQLS+LLL+ +G AADILE   E LKE  VR +  L   ILV+W  S+ QF L   V          KAR     +   YS                   +LWAI  S  +QD PF  +R+ L++ F V+++  +FF  KNSLV+ L  +R   ++    D
Sbjct:  164 PIGGTITRDQLSELLLMFVGTAADILEFTTETLKENNVRTNPTLVSGILVVWTWSMLQFPLDLAVQLKLVCPASVKARGFLRVFLCQYSA------------------DLWAIGLSFFIQDGPFLVVRLVLMIYFKVINHMLVFFAVKNSLVMALHFYRLVALIMATRD 314          
BLAST of Transmembrane protein 26 vs. UniProt/SwissProt
Match: sp|Q3UP23|TMM26_MOUSE (Transmembrane protein 26 OS=Mus musculus OX=10090 GN=Tmem26 PE=2 SV=2)

HSP 1 Score: 87.4261 bits (215), Expect = 3.299e-17
Identity = 64/160 (40.00%), Postives = 88/160 (55.00%), Query Frame = 3
Query:  945 PRGG-ITRDQLSQLLLVNIGMAADILELF-EALKEKVVRHHXXXXXXXXXXWQMSLFQFSLTKTVTKARKVRLGYFEDYSTKSNTENNLQITNCICCRTELWAIATSLLLQDIPFFCLRITLIVDFDVLSYSNIFFTCKNSLVILLQLFRSYVILSGKTD 1418
            P GG ITRDQLS+LLL+ +G AADILE   E LKE  VR +  L   ILV+W  S+ QF L   V      +L      S K+     L++  C     +LWAI  S  +QD PF  +R+ L++ F V+++  +FF  KNSLV+ L  +R   ++    D
Sbjct:  164 PIGGTITRDQLSELLLMFVGTAADILEFTTETLKENNVRTNPTLVSGILVVWTWSMLQFPLDLAV------QLKLVCPASVKAR--GFLRVFLCQYS-ADLWAIGLSFFIQDGPFLVVRLVLMIYFKVINHMLVFFAVKNSLVMALHFYRLVALIMATRD 314          
BLAST of Transmembrane protein 26 vs. UniProt/SwissProt
Match: sp|Q6ZUK4|TMM26_HUMAN (Transmembrane protein 26 OS=Homo sapiens OX=9606 GN=TMEM26 PE=1 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 7.824e-17
Identity = 61/151 (40.40%), Postives = 81/151 (53.64%), Query Frame = 3
Query:  951 GGITRDQLSQLLLVNIGMAADILELF-EALKEKVVRHHXXXXXXXXXXWQMSLFQFSLTKTVTKARKVRLGYFEDYSTKSNTENNLQITNCICCRTELWAIATSLLLQDIPFFCLRITLIVDFDVLSYSNIFFTCKNSLVILLQLFRSYVI 1400
            GGITRDQLSQLLL+ +G AADILE   E L+E+ VR+   L   ILV+W  S+ QF L   V                 S TE             +LW I  S+ +QD PF  +R+ L+  F V++   +FF  KN LV++LQL+R  V+
Sbjct:  167 GGITRDQLSQLLLMFVGTAADILEFTSETLEEQNVRNSPALVYAILVIWTWSMLQFPLDLAVQNV----------VCPVSVTERGFPSLFFCQYSADLWNIGISVFIQDGPFLVVRLILMTYFKVINQMLVFFAAKNFLVVVLQLYRLVVL 307          
BLAST of Transmembrane protein 26 vs. TrEMBL
Match: G4LX49 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 GN=Smp_026670 PE=4 SV=1)

HSP 1 Score: 181.8 bits (460), Expect = 1.447e-47
Identity = 150/379 (39.58%), Postives = 197/379 (51.98%), Query Frame = 3
Query:  321 VNKWFSPVVFLFLMCACPPIWIMELTIASNVTGHSEILNLTSREATISHFRPQLLPTTFQSANLTQVQSTKSPISVVSTSTLNITLSDIIENNSTNLTSVSYGENSTLNETNVPMSKNVSEISTVLQQPTTVISKINLSTNSNIFILTRNISDIYVYGVSDITRVIKQKGTDVLKKIESMLAYLDIPYRTTILEQVXXXXXXXXXXXXPRGGITRDQLSQLLLVNIGMAADILELFEALKEKVVRHHXXXXXXXXXXWQMSLFQFSLTKTVTKARKVRLGYFEDYSTKSNTENNLQITNCI---------CCRTELWAIATSLLLQDIPFFCLRITLIVDFDVLSYSNIFFTCKNSLVILLQLFRSYVILSGKTDDNQL 1430
            ++KWFS   F +L+CACPPIWI+EL     V   S +  L    AT +H                      +PI  V  + +N   S I   N          E+  +  T +    N + ++T   Q T                +TRN    +++ V     +  Q   DVL+ ++  L    +  R  ILEQ+LLL++I+ RWL+PR G+TRDQLSQLLL+NIG AADILELFEA  E+ VR +  L  +IL LWQ SL QF L++              D+   SN  N   I  C+         CC TELWAI  SL+LQD+PF  LRITLIV ++V SYSN+FFTCKN+L+ILLQ+FRS VILS     NQL
Sbjct:  103 ISKWFSLCNFTYLICACPPIWIIELHHMDQVNNASALFELM---ATKNH----------------------TPIITVP-AWINKVPSIISREN----------ESMMIMGTEIEEFMNSAYLTTTEPQRTRR--------------MTRNT---FIHEVLSNETIGLQVSMDVLQSLQ--LHNFSLKERIRILEQLLLLSVIVGRWLMPREGLTRDQLSQLLLINIGTAADILELFEAFNEQEVRRNDFLRTVILSLWQASLLQF-LSQN-------------DFMDNSNNVNCPLIGGCLLLCHERPCLCCETELWAIGISLMLQDLPFLILRITLIVYYNVKSYSNVFFTCKNTLLILLQVFRSIVILSEAGKFNQL 412          
BLAST of Transmembrane protein 26 vs. TrEMBL
Match: A0A183QJE3 (Uncharacterized protein OS=Schistosoma rodhaini OX=6188 PE=4 SV=1)

HSP 1 Score: 174.481 bits (441), Expect = 3.838e-44
Identity = 151/379 (39.84%), Postives = 195/379 (51.45%), Query Frame = 3
Query:  321 VNKWFSPVVFLFLMCACPPIWIMELTIASNVTGHSEILNLTSREATISHFRPQLLPTTFQSANLTQVQSTKSPISVVSTSTLNITLSDIIENNSTNLTSVSYGENSTLNETNVPMSKNVSEISTVLQQPTTVISKINLSTNSNIFILTRNISDIYVYGVSDITRVIKQKGTDVLKKIESMLAYLDIPYRTTILEQVXXXXXXXXXXXXPRGGITRDQLSQLLLVNIGMAADILELFEALKEKVVRHHXXXXXXXXXXWQMSLFQFSLTKTVTKARKVRLGYFEDYSTKSNTENNLQITNCI---------CCRTELWAIATSLLLQDIPFFCLRITLIVDFDVLSYSNIFFTCKNSLVILLQLFRSYVILSGKTDDNQL 1430
            ++K FS   F +L+CACPPIWI+EL     V   S +  L    AT +H                      +PI  V  + +N   S I   N          E+  +  T +    N + ++T   Q T                +TRN + I+ Y V+ I   IK     +L      L    +  R  ILEQ+LLL++I+ RWL+PR G+TRDQLSQLLL+NIG AADILELFEA  E+ VR +  L  +IL LWQ SL QF L++              D+   SN  N   I  C+         CC TELWAI  SL+LQD+PF  LRITLIV ++V SYSN+FFTCKN+L+ILLQ+FRS VILS     NQL
Sbjct:  185 ISKXFSLCNFTYLICACPPIWIIELHHMDQVNNASALFELM---ATKNH----------------------TPIITVP-AWINKVPSIISREN----------ESMMIMGTEIEEFMNSAYLTTTEPQRTRR--------------MTRN-TFIHEYSVNLIKCTIKL----ILNLYSLQLHNFSLKERIRILEQLLLLSVIVGRWLMPREGLTRDQLSQLLLINIGTAADILELFEAFNEQEVRRNDFLRTVILSLWQASLLQF-LSQN-------------DFIDNSNNVNCPLIGGCLLLCHERPCLCCETELWAIGISLMLQDLPFLILRITLIVYYNVKSYSNVFFTCKNTLLILLQVFRSIVILSEAGKFNQL 494          
BLAST of Transmembrane protein 26 vs. TrEMBL
Match: A0A0R3SG34 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS3837 PE=4 SV=1)

HSP 1 Score: 175.252 bits (443), Expect = 7.905e-44
Identity = 159/461 (34.49%), Postives = 220/461 (47.72%), Query Frame = 3
Query:  159 VRCIFILYASIAIWNVVIVKT-SIYWLLLATLFPLFIETFIGIQQIKMDVKPKSKVNKWFSPVVFLFLMCACPPIWIMELTIASNVTGHSEILNLTSREATISHFRPQLLPTTFQSANLTQVQSTKSPISVVSTSTLNITLSDIIENNSTNLTSVSYGENSTLNETNVPMSKNVSEISTVLQQPTTVISKINLSTNSNIFILTRNISDIYVYGVSDITRVIKQKGTDVLKKIESMLAYLDIPYRTTILEQVXXXXXXXXXXXXPRGGITRDQLSQLLLVNIGMAADILELFEALKEKVVRHHXXXXXXXXXXWQMSLFQFSLTKTVT----KARKVRLGYFEDYSTKSNTENN------LQITN------------CICCR-----------------TELWAIATSLLLQDIPFFCLRITLIVDFDVLSYSNIFFTCKNSLVILLQLFRSYVILSGKTDD 1421
            VR +F+      +  VV  K  +IYWLL   + PL  +    I+ + M      K  KWF+  +  FL CACPPIWI+EL     +  +++ +   +    ++   P  +   ++ A L   +  ++           + + D +E+    L +V+  EN T+N                            L T S I I  +   D  +Y  +    +I+             L +  +  R  I+EQ+LLLT+I+ R+LLPR GITRDQLSQLLL+NIG AADILELFEA  E+ V  +  L I IL LWQ SLFQF   KT      K+    +       ++S T N+       QI +            C CC                  TE+WAI  SL+LQD+PF  LRITLI+ F+V SYSNIFFTCKNSL+ILLQ+FRS VIL+    D
Sbjct:  145 VRFVFLALTLTLVITVVKAKNQNIYWLLCFLMLPLMADLCYSIRLVIMPKVAYDKTEKWFTKCLLAFLFCACPPIWIIELHHLQQLNDYTDAV--INNPGLLNPGEPSPIRNPWEEAGLIYNEPGEN----------LVVMGDSVEDY---LNAVASRENITMNA---------------------------LVTKSRIRI--KRSPDEGLYFPTQQESLIQ----------AVTLQHYPLKMRIRIMEQLLLLTVIVGRFLLPRFGITRDQLSQLLLINIGNAADILELFEAFNEEAVFMNTSLKISILCLWQASLFQFCFNKTAVLENKKSTHSSVPVQAHSMSRSTTLNDSVVIELPQIMDDDQRPTAKRRHFCDCCPSDPSDDEVSGCGQLWFGTEIWAIFMSLILQDVPFLVLRITLIMLFNVRSYSNIFFTCKNSLLILLQIFRSVVILNDFRRD 551          
BLAST of Transmembrane protein 26 vs. TrEMBL
Match: A0A151XH34 (Transmembrane protein 26 OS=Trachymyrmex zeteki OX=64791 GN=ALC60_01379 PE=4 SV=1)

HSP 1 Score: 157.532 bits (397), Expect = 2.848e-38
Identity = 142/413 (34.38%), Postives = 209/413 (50.61%), Query Frame = 3
Query:  180 YASIAIWNVVIVK-TSIYWLLLATLFPLFIETFIGIQQIKMDVKPKSKVNKWFSPVVFLFLMCACPPIWIMELTIASNVTGHSEILNLTSREATISHFRPQLLPTTFQSANLTQVQSTKSPISVVSTSTLNITLSDIIENNSTNLTSVSYGENSTLNETNVPMSKNVSEISTVLQQPTTVISKINLSTNSNIFILTRNISD-IYVYGVSDITRVIK--QKGTDVLKKIESMLAYLDIPYRT--TILEQVXXXXXXXXXXXXPRGGITRDQLSQLLLVNIGMAADILELFEALKEKVVRHHXXXXXXXXXXWQMSLFQFSLTKTVTKARKVRLGYFEDYSTKSNTENNLQITNCICCRTELWAIATSLLLQDIPFFCLRITLIVDFDVLSYSNIFFTCKNSLVILLQLFRSYVI 1400
            +  IAIW V   K  S +W L   +  LF+E   GI  + +    +++  KWF P VFL+L    P IW++EL            + L SR   I               N+++                NI LS++  ++  +L          L ET  P   NV+     L  P     K  L    N+F    N+   + +Y ++ + + IK  +    +  K++  L  + I   T  T++EQ L+L LII RW+LP+G +TRDQLSQLLLV IG AADI+E F++ KE  +    +L  + L +W  SL QF++  T TK+RK RL      S+ S T   ++ T   CC  ++W IA +++LQD PF   R+ LI+ + ++SY NIFFTCKN+LVILLQL+R YV+
Sbjct:   20 HGFIAIWQVTTFKRNSYFWYLSCPILLLFVE---GIFTLTI---KENQEWKWFCPSVFLYLSSVVPAIWLLELDKVD--------MRLKSRGTNI---------------NISE----------------NIDLSNLAADDLKHL-------EEALGET--PKVINVTSKCKWLIFPYV---KSVLEKFKNVF---NNMQQKVTLYSMNKLNQFIKLYKNLCQIRIKVDIRLPDIQISTETWVTLIEQFLMLILIIGRWMLPKGDLTRDQLSQLLLVYIGTAADIIEFFDSFKEDRIAREPVLVYLTLGIWAWSLTQFTVVLTATKSRKSRL------SSGSVTRKKVR-TETSCCSIDVWGIALNMILQDGPFLAFRLILIIHYQIVSYMNIFFTCKNTLVILLQLYRLYVV 365          
BLAST of Transmembrane protein 26 vs. TrEMBL
Match: A0A2C9JGQ2 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106057407 PE=4 SV=1)

HSP 1 Score: 151.754 bits (382), Expect = 4.259e-38
Identity = 105/201 (52.24%), Postives = 135/201 (67.16%), Query Frame = 3
Query:  813 VIKQKGTDVLKKIESMLAY-LDIPYRTTILEQVXXXXXXXXXXXXPRGGITRDQLSQLLLVNIGMAADILELFEALKEKVVRHHXXXXXXXXXXWQMSLFQFSLTKTVTKARKVRLGYFEDYSTKSNTENNLQITNCICCRTELWAIATSLLLQDIPFFCLRITLIVDFDVLSYSNIFFTCKNSLVILLQLFRSYVILSGK 1412
            +I   G  VL+KI   +A  L       ILEQ+LLL LII RWLLP+G ITR+QLSQLLLV IGMAADI+ELFEA KEK VR + +L I+IL LW  SL QF+L  T TK++K            S     +Q+T+  CC  E+ +I  S+LLQD PF  LR+ LI  +DVLSY+NIFFTCKNSLV++LQ++R +V+ + +
Sbjct:   38 IIDLLGNAVLEKIPISIAISLGSEEWCKILEQMLLLILIIGRWLLPKGEITREQLSQLLLVYIGMAADIIELFEAFKEKTVRENPLLTIVILSLWTASLMQFTLVVTATKSKK------------SRASVAMQVTSEGCCPVEVISIFISVLLQDGPFLVLRMLLIFRYDVLSYTNIFFTCKNSLVLVLQMYRLFVLFTER 226          
BLAST of Transmembrane protein 26 vs. Ensembl Cavefish
Match: ENSAMXT00000044825.1 (pep primary_assembly:Astyanax_mexicanus-2.0:6:129973:131566:1 gene:ENSAMXG00000036480.1 transcript:ENSAMXT00000044825.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 99.7525 bits (247), Expect = 2.452e-23
Identity = 66/168 (39.29%), Postives = 105/168 (62.50%), Query Frame = 3
Query:  897 LEQVXXXXXXXXXXXXPRGGITRDQLSQLLLVNIGMAADILELFEALKEKVVRHHXXXXXXXXXXWQMSLFQFSLTKTVTKARKVRLGYFEDYSTKSNTENNLQITNCICCRTELWAIATSLLLQDIPFFCLRITLIVDFDVLSYSNIFFTCKNSLVILLQLFRSYVI 1400
            LEQ +L+ L++ RWL+P+G ++RDQLSQLL+V +G+ ADIL++F+  KE  V+   I+ I+ L L+  +L QF L  T T              T+   + +   T+  CC +E+W++  ++ LQD PF   R+ L++  +VL+   IFFTCKN L++LL+L+R  V+
Sbjct:   35 LEQTMLIVLVLGRWLMPKGDMSRDQLSQLLMVYVGLGADILDIFDTFKEPEVKTKRIVIIVGLSLFSWALMQFPLVLTQTSPTTP-----AQAETQHPADGDRTGTSTSCCSSEVWSLLLTVGLQDGPFLVYRLYLMIRENVLNQLMIFFTCKNILIVLLELYRIGVV 197          
BLAST of Transmembrane protein 26 vs. Ensembl Cavefish
Match: tmem26a (transmembrane protein 26-like [Source:NCBI gene;Acc:103029977])

HSP 1 Score: 82.0333 bits (201), Expect = 1.296e-16
Identity = 73/201 (36.32%), Postives = 102/201 (50.75%), Query Frame = 3
Query:  825 KGTDVLKKIESMLAYLDIPYRTTILEQVXXXXXXXXXXXXP-RGGITRDQLSQLLLVNIGMAADILELFEALKEKVVRHHXXXXXXXXXXWQMSLFQFSLTKTVTKARKVRLGYFEDYSTKSNTENNLQITNCICCR--------TELWAIATSLLLQDIPFFCLRITLIVDFDVLSYSNIFFTCKNSLVILLQLFRSYVI 1400
             G D LK++E +L+ +        L Q LL+ LI+ +WLLP  GG+TRD+LSQLLL+ +G AADILE        V      L  IIL +W  S+ QF L  +V  +R              + E   +     CCR        T++W I  SL +QD PF  +R+ ++  F V     +FF  KN LV++L L+R  VI
Sbjct:  117 HGNDTLKRLEDILSIVCPNDWILTLHQCLLILLILGKWLLPLGGGLTRDELSQLLLIFVGTAADILEFTSETLSDVKDKSPQLVYIILAVWTWSMLQFPLHLSVVTSRP-----------DESVEKEEEEKQTGCCRCVLIERHSTDIWNIVESLFIQDGPFLVVRLMVMAYFKVFHQMLLFFAIKNFLVVILNLYRLVVI 306          

HSP 2 Score: 49.2914 bits (116), Expect = 6.271e-6
Identity = 27/68 (39.71%), Postives = 39/68 (57.35%), Query Frame = 3
Query:  195 IWNVVIVKTSIYWLLLATLF-PLFIETFIGIQQIKMDVKPKSKVNKWFSPVVFLFLMCACPPIWIMEL 395
            +W V +VK   ++ LL  LF PL +ET I ++      + K +  KWFSP +  FL+   P IWI+EL
Sbjct:   24 VWRVCLVKNHHWFWLLTVLFTPLLLETIITLK------RSKGQEYKWFSPAILFFLISIIPSIWILEL 85          
BLAST of Transmembrane protein 26 vs. Ensembl Cavefish
Match: tmem26b (transmembrane protein 26b [Source:ZFIN;Acc:ZDB-GENE-080204-66])

HSP 1 Score: 74.7146 bits (182), Expect = 2.209e-14
Identity = 52/154 (33.77%), Postives = 84/154 (54.55%), Query Frame = 3
Query:  945 PRG-GITRDQLSQLLLVNIGMAADILELFEALKEKVVRHHXXXXXXXXXXWQMSLFQFSLTKTVTKARKVRLGYFEDYSTKSNTENNLQITNCICCRTELWAIATSLLLQDIPFFCLRITLIVDFDVLSYSNIFFTCKNSLVILLQLFRSYVIL 1403
            P G G+TRD+LSQLLL+ +G AADILE      E +   +  L  IIL +W  S+ QF    +V  +R       +D   ++  ++ L        RT+ W +  +L +QD PF  +R+T+++ + ++    +FF  KN LV+ L ++R +VI 
Sbjct:  142 PIGVGVTRDELSQLLLIFVGTAADILEF---TSETLSDVNPQLVYIILAVWTWSMLQFPFHLSVVNSR-------DDDECENQGDSVLTKH-----RTDFWTVVETLFIQDGPFLVVRLTVMIHYAIVHQMLVFFAIKNFLVVTLNIYRMWVIF 280          

HSP 2 Score: 62.7734 bits (151), Expect = 1.993e-10
Identity = 37/98 (37.76%), Postives = 52/98 (53.06%), Query Frame = 3
Query:  162 RCIFILYASIAIWNVVIVKTS-IYWLLLATLFPLFIETFIGIQQIKMDVKPKSKVNKWFSPVVFLFLMCACPPIWIMELTIASNVTGHSEILNLTSRE 452
            R +FIL + I +W V  VK + +YW L     PL IE  + ++      + K K  KWFSP +FLFL+   P IWI+EL    N +  ++   L S E
Sbjct:   12 RALFILISLIGVWRVTWVKNNKLYWFLTILYLPLVIELILTLR------RRKGKDYKWFSPAIFLFLISIIPTIWILELHHQQNRSSDAKCAKLDSSE 103          
BLAST of Transmembrane protein 26 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005994.1 (pep scaffold:Pmarinus_7.0:GL479500:25820:30764:-1 gene:ENSPMAG00000005417.1 transcript:ENSPMAT00000005994.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 56.6102 bits (135), Expect = 2.406e-10
Identity = 38/105 (36.19%), Postives = 52/105 (49.52%), Query Frame = 3
Query: 1092 WQMSLFQFSLTKTVTKARKVRLGYFEDYSTKSNTENNLQITNCICCRTELWAIATSLLLQDIPFFCLRITLIVDFDVLSYSN--IFFTCKNSLVILLQLFRSYVI 1400
            W  SL QF L   V + + V           S +    + T      T+LWAI  S+ +QD PF  +R+ L++ F VL      IFFT KN LV++LQ +R  VI
Sbjct:   14 WTWSLMQFPLVIKVMQLKVV--------CVSSVSARRFRRTLVRVYSTDLWAIVISVFIQDGPFLVVRLLLLIHFGVLDQMQMLIFFTIKNVLVLMLQAYRLVVI 110          
BLAST of Transmembrane protein 26 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005990.1 (pep scaffold:Pmarinus_7.0:GL479500:25802:30764:-1 gene:ENSPMAG00000005417.1 transcript:ENSPMAT00000005990.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.8398 bits (133), Expect = 5.523e-10
Identity = 28/58 (48.28%), Postives = 38/58 (65.52%), Query Frame = 3
Query: 1233 TELWAIATSLLLQDIPFFCLRITLIVDFDVLSYSN--IFFTCKNSLVILLQLFRSYVI 1400
            T+LWAI  S+ +QD PF  +R+ L++ F VL      IFFT KN LV++LQ +R  VI
Sbjct:   52 TDLWAIVISVFIQDGPFLVVRLLLLIHFGVLDQMQMLIFFTIKNVLVLMLQAYRLVVI 109          
BLAST of Transmembrane protein 26 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005989.1 (pep scaffold:Pmarinus_7.0:GL479500:25802:30764:-1 gene:ENSPMAG00000005417.1 transcript:ENSPMAT00000005989.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.8398 bits (133), Expect = 6.024e-10
Identity = 28/58 (48.28%), Postives = 38/58 (65.52%), Query Frame = 3
Query: 1233 TELWAIATSLLLQDIPFFCLRITLIVDFDVLSYSN--IFFTCKNSLVILLQLFRSYVI 1400
            T+LWAI  S+ +QD PF  +R+ L++ F VL      IFFT KN LV++LQ +R  VI
Sbjct:   54 TDLWAIVISVFIQDGPFLVVRLLLLIHFGVLDQMQMLIFFTIKNVLVLMLQAYRLVVI 111          
BLAST of Transmembrane protein 26 vs. Ensembl Nematostella
Match: EDO40847 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5Z5])

HSP 1 Score: 92.8189 bits (229), Expect = 4.878e-21
Identity = 58/150 (38.67%), Postives = 86/150 (57.33%), Query Frame = 3
Query:  945 PRGGITRDQLSQLLLVNIGMAADILELFEALKEKVVRHHXXXXXXXXXXWQMSLFQFSLTKTVTKAR--KVRLGYFEDYSTKSNTENNLQITNCICCRTELWAIATSLLLQDIPFFCLRITLIVDFDVLSYSNIFFTCKNSLVILLQLFR 1388
            PRG ITRDQLS LLL  +G AADILELFE  +E  V   L +   +L ++  SL QF+L  T T  +  K+R+      S K +    L          +++ I T + +QD PF  LR+ LI+ +++ S  ++FFTCKN++ + L ++R
Sbjct:  129 PRGEITRDQLSALLLGYVGTAADILELFEVFEEPQVGSELQITTAVLGVYSWSLLQFTLVTTATTGKDNKIRIA-----SNKISRREMLL-------HGDIFGILTGIFMQDGPFLVLRLVLIIKYNLYSEMHLFFTCKNAIALSLLMYR 266          
BLAST of Transmembrane protein 26 vs. Ensembl Nematostella
Match: EDO47924 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKK6])

HSP 1 Score: 90.5077 bits (223), Expect = 2.642e-20
Identity = 70/173 (40.46%), Postives = 100/173 (57.80%), Query Frame = 3
Query:  897 LEQVXXXXXXXXXXXXPRGGITRDQLSQLLLVNIGMAADILELFEALKEKVVR-----HHXXXXXXXXXXWQMSLFQFSLTKTVTKARKVRLGYFEDYSTKSNTENNLQITNCICCRTELWAIATSLLLQDIPFFCLRITLIVDFDVLSYSNIFFTCKNSLVILLQLFRSYVI 1400
            LEQ L+L L+I RWLLP+G I+RDQLSQLLLV +GMAADI+E  E +KE  +R     ++      +++ W MSLFQF+L                   T S TE   Q+   I    EL ++   +L+QD PF  +R+  I  ++V   +  F T KN+LVI+LQ++R +V+
Sbjct:  114 LEQALVLILVIGRWLLPKGSISRDQLSQLLLVYVGMAADIMEFTEIIKEDEIRKVNMLNNNHFVNAVILFWSMSLFQFTL-------------------TISGTERTAQLNEYI----ELVSLLVPMLMQDGPFLIIRLIAIAYYEVNHDTLYFLTVKNALVIMLQIYRIFVL 263          
BLAST of Transmembrane protein 26 vs. Ensembl Nematostella
Match: EDO32760 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SU47])

HSP 1 Score: 83.1889 bits (204), Expect = 1.122e-17
Identity = 60/152 (39.47%), Postives = 89/152 (58.55%), Query Frame = 3
Query:  945 PRGGITRDQLSQLLLVNIGMAADILELFEALKEKVVRHHXXXXXXXXXXWQMSLFQFSLTKTVTKARKVRLGYFEDYSTKSNTENNLQITNCICCRTELWAIATSLLLQDIPFFCLRITLIVDFDVLSYSNIFFTCKNSLVILLQLFRSYVI 1400
            PRG +TRDQLS LLL  IGM ADILELF AL E  V H+  +    L L+  S+FQF +  T T      +G  E+  +   T    +++  I    +   +A +L +QD PF  LR++L++ + V S  +IFFT KN+L +++ L+R Y++
Sbjct:  150 PRGRMTRDQLSNLLLCYIGMGADILELFAALTEPEVMHNASVTYATLALFSWSMFQFCVVATAT------VGGSEE--SPDITHQPSEVSTSIVDFKKKKHLA-ALFMQDGPFLLLRLSLLIGYGVSSEIHIFFTAKNALTVVIMLYRLYIL 292          
BLAST of Transmembrane protein 26 vs. Ensembl Nematostella
Match: EDO40016 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S878])

HSP 1 Score: 80.4925 bits (197), Expect = 6.442e-17
Identity = 64/180 (35.56%), Postives = 99/180 (55.00%), Query Frame = 3
Query:  849 IESMLAYLDIPYRTTILEQVXXXXXXXXXXXXPRGGITRDQLSQLLLVNIGMAADILELFEALKEKVVRHHXXXXXXXXXXWQMSLFQFSLTKTVTKARKVRLGYFEDYSTKSNTENNLQITNCICCRTELWAIATSLLLQDIPFFCLRITLIVDFDVLSYSNIFFTCKNSLVILLQLFR 1388
            + S+L  +D    T ++EQ  LL +I+ RWLLP+G +TR+ LSQLLLVN+ M+ADI+E F+ LK K  +    + + IL LW +SL QF +  T       +LG  E+ + K     +L  T              +L +QD PF   R+ +I  +    Y  +F T KN+L++ LQ+++
Sbjct:   97 VSSILPGVDGEVLTDLIEQTTLLMMILGRWLLPKGSLTRESLSQLLLVNLAMSADIIEFFDILKLKEAQQSHDVTLAILCLWTISLMQFPVNAT------AKLGT-EETAPKHRVTMDLIGT------------VMALFMQDGPFLTFRLFMIAKYSAFGYMIVFLTVKNALLLTLQVYK 257          
BLAST of Transmembrane protein 26 vs. Ensembl Nematostella
Match: EDO48561 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIS6])

HSP 1 Score: 69.707 bits (169), Expect = 3.991e-13
Identity = 51/153 (33.33%), Postives = 80/153 (52.29%), Query Frame = 3
Query:  945 PRGGITRDQLSQLLLVNIGMAADIL-ELFEALKEKVVRHHXXXXXXXXXXWQMSLFQFSLTKTVTKARKVRLGYFEDYSTKSNTENNLQITNCICCRTELWAIATSLLLQDIPFFCLRITLIVDFDVLSYSNIFFTCKNSLVILLQLFRSYVI 1400
            PRG +TRDQLS LLLV +  AADI+ EL   + +  +    +  + +LV +     QF+L  T T   +       D  TK  T         +    +L++I T +L+QD PF  LR+ ++V F V S  ++FFT KN++ + +  +R  V+
Sbjct:  145 PRGELTRDQLSTLLLVYVANAADIMGELSAEVPQAQLAAKTLYLVSVLVTYTWCFMQFTLVFTATAKSE------PDEVTKQVTSKTKSQEKKLRLHGDLYSILTIMLMQDGPFLVLRLVMLVQFRVDSEMHLFFTGKNAMALAVLFYRLLVL 291          
BLAST of Transmembrane protein 26 vs. Ensembl Medaka
Match: ENSORLT00000005990.2 (pep primary_assembly:ASM223467v1:15:16625055:16640574:1 gene:ENSORLG00000004760.2 transcript:ENSORLT00000005990.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 72.7886 bits (177), Expect = 1.086e-13
Identity = 49/150 (32.67%), Postives = 73/150 (48.67%), Query Frame = 3
Query:  951 GGITRDQLSQLLLVNIGMAADILELFEALKEKVVRHHXXXXXXXXXXWQMSLFQFSLTKTVTKARKVRLGYFEDYSTKSNTENNLQITNCICCRTELWAIATSLLLQDIPFFCLRITLIVDFDVLSYSNIFFTCKNSLVILLQLFRSYVI 1400
            GG+TRD+LSQLLL+ +G AADILE        V                M    F L +         L   ED+  + N+             T++W I  +L +QD PF  +R+T+++ F+ +    +FF  KNSLV++L L+R +VI
Sbjct:  161 GGVTRDELSQLLLIFVGTAADILEFTNETLSDVN--------------SMLNVPFHLNRFPRLPNAGDLSTDEDFLLRRNS-------------TDIWNIMEALFIQDGPFLVVRLTVMILFETIHQMLVFFAIKNSLVVILNLYRLFVI 283          

HSP 2 Score: 56.225 bits (134), Expect = 3.011e-8
Identity = 35/99 (35.35%), Postives = 50/99 (50.51%), Query Frame = 3
Query:  162 RCIFILYASIAIWNVVIVKTSI-YWLLLATLFPLFIETFIGIQQIKMDVKPKSKVNKWFSPVVFLFLMCACPPIWIMELTIASNVTGHSEILNLTSREA 455
            R +FIL + + ++ V  VK    YW L     PL  E  I ++      + K K  KWFSP +FLFL+   P IWI+EL    N + + +   L S E+
Sbjct:   13 RALFILVSLVGVFRVTSVKNDRNYWFLTFLFLPLVTEMIITLK------RRKGKDYKWFSPPIFLFLISIIPSIWILELHHQENKSSNPKCSKLDSWES 105          
BLAST of Transmembrane protein 26 vs. Ensembl Medaka
Match: tmem26a (transmembrane protein 26a [Source:ZFIN;Acc:ZDB-GENE-101223-2])

HSP 1 Score: 60.077 bits (144), Expect = 1.842e-9
Identity = 47/150 (31.33%), Postives = 76/150 (50.67%), Query Frame = 3
Query:  951 GGITRDQLSQLLLVNIGMAADILELFEALKEKVVRHHXXXXXXXXXXWQMSLFQFSLTKTVTKARKVRLGYFEDYSTKSNTENNLQITNCICCRTELWAIATSLLLQDIPFFCLRITLIVDFDVLSYSNIFFTCKNSLVILLQLFRSYVI 1400
            GG+T+D+L +LLLV +G AADILEL   +   V              W  +  +  +  +        L  FE ++T  +  + L         T++W I  +L  QD PF  +R+T+++ F+ +    +FF  KNSLV++L L+R +VI
Sbjct:  143 GGVTKDELLELLLVFVGTAADILELTNEILSDV-------------KWVTN--KEEIMHSSMLNVPFHLNRFEFFTTSCDRLSRLY-------PTDIWNIMEALFFQDGPFLVVRLTVMILFETIHQMLVFFAIKNSLVVILNLYRLFVI 270          

HSP 2 Score: 59.3066 bits (142), Expect = 2.726e-9
Identity = 37/99 (37.37%), Postives = 50/99 (50.51%), Query Frame = 3
Query:  162 RCIFILYASIAIWNVVIVKTSI-YWLLLATLFPLFIETFIGIQQIKMDVKPKSKVNKWFSPVVFLFLMCACPPIWIMELTIASNVTGHSEILNLTSREA 455
            R +FIL + + ++ V  VK    YW L     PL  E  I ++      + K K  KWFSP +FLFL+   P IWI+EL    N +   E   L SRE+
Sbjct:   10 RALFILVSLVGVFRVTSVKNDCNYWFLTFLFLPLVTEMIITLK------RRKGKDYKWFSPPIFLFLISIIPLIWILELHHQENKSSGPECHKLDSRES 102          
BLAST of Transmembrane protein 26 vs. Planmine SMEST
Match: SMESG000079787.1 (SMESG000079787.1)

HSP 1 Score: 871.307 bits (2250), Expect = 0.000e+0
Identity = 456/457 (99.78%), Postives = 457/457 (100.00%), Query Frame = 3
Query:  297 MDVKPKSKVNKWFSPVVFLFLMCACPPIWIMELTIASNVTGHSEILNLTSREATISHFRPQLLPTTFQSANLTQVQSTKSPISVVSTSTLNITLSDIIENNSTNLTSVSYGENSTLNETNVPMSKNVSEISTVLQQPTTVISKINLSTNSNIFILTRNISDIYVYGVSDITRVIKQKGTDVLKKIESMLAYLDIPYRTTILEQVXXXXXXXXXXXXPRGGITRDQLSQLLLVNIGMAADILELFEALKEKVVRHHXXXXXXXXXXWQMSLFQFSLTKTVTKARKVRLGYFEDYSTKSNTENNLQITNCICCRTELWAIATSLLLQDIPFFCLRITLIVDFDVLSYSNIFFTCKNSLVILLQLFRSYVILSGKTDDNQLESTISRQSLVVGSVTRWNQVHGNSEPGLDNRKALFTEQYELTKTNRNNANSMGILPKASPELSISSKENIPKTDSLNSL 1667
            MDVKPKSKVNKWFSPVVFLFLMCACPPIWIMELTIASNVTGHSEILNLTSREATISHFRPQLLPTTFQSANLTQVQSTKSPISVVSTSTLNITLSDIIENNSTNLTSVSYGENSTLNETNVPMSKNVSEISTVLQQPTTVISKINLSTNSNIFILTRNISDIYVYGVSDITRVIKQKGTDVLKKIESMLAYLDIPYRTTILEQVLLLTLIICRWLLPRGGITRDQLSQLLLVNIGMAADILELFEALKEKVVRHHLILNIIILVLWQMSLFQFSLTKTVTKARKVRLGYFEDYSTKSNTENNLQITNCICCRTELWAIATSLLLQDIPFFCLRITLIVDFDVLSYSNIFFTCKNSLVILLQLFRSYVILSGKTDDNQLESTISRQSLVVGSVTRWNQVHGNSEPGLDNRKALFTEQYELTKTNRNNANSMGILPKASPELSISSKEN+PKTDSLNSL
Sbjct:    1 MDVKPKSKVNKWFSPVVFLFLMCACPPIWIMELTIASNVTGHSEILNLTSREATISHFRPQLLPTTFQSANLTQVQSTKSPISVVSTSTLNITLSDIIENNSTNLTSVSYGENSTLNETNVPMSKNVSEISTVLQQPTTVISKINLSTNSNIFILTRNISDIYVYGVSDITRVIKQKGTDVLKKIESMLAYLDIPYRTTILEQVLLLTLIICRWLLPRGGITRDQLSQLLLVNIGMAADILELFEALKEKVVRHHLILNIIILVLWQMSLFQFSLTKTVTKARKVRLGYFEDYSTKSNTENNLQITNCICCRTELWAIATSLLLQDIPFFCLRITLIVDFDVLSYSNIFFTCKNSLVILLQLFRSYVILSGKTDDNQLESTISRQSLVVGSVTRWNQVHGNSEPGLDNRKALFTEQYELTKTNRNNANSMGILPKASPELSISSKENLPKTDSLNSL 457          
BLAST of Transmembrane protein 26 vs. Planmine SMEST
Match: SMESG000079787.1 (SMESG000079787.1)

HSP 1 Score: 818.535 bits (2113), Expect = 0.000e+0
Identity = 436/457 (95.40%), Postives = 437/457 (95.62%), Query Frame = 3
Query:  297 MDVKPKSKVNKWFSPVVFLFLMCACPPIWIMELTIASNVTGHSEILNLTSREATISHFRPQLLPTTFQSANLTQVQSTKSPISVVSTSTLNITLSDIIENNSTNLTSVSYGENSTLNETNVPMSKNVSEISTVLQQPTTVISKINLSTNSNIFILTRNISDIYVYGVSDITRVIKQKGTDVLKKIESMLAYLDIPYRTTILEQVXXXXXXXXXXXXPRGGITRDQLSQLLLVNIGMAADILELFEALKEKVVRHHXXXXXXXXXXWQMSLFQFSLTKTVTKARKVRLGYFEDYSTKSNTENNLQITNCICCRTELWAIATSLLLQDIPFFCLRITLIVDFDVLSYSNIFFTCKNSLVILLQLFRSYVILSGKTDDNQLESTISRQSLVVGSVTRWNQVHGNSEPGLDNRKALFTEQYELTKTNRNNANSMGILPKASPELSISSKENIPKTDSLNSL 1667
            MDVKPKSKVNKWFSPVVFLFLMCACPPIWIMELTIASNVTGHSEILNLTSREATISHFRPQLLPTTFQSANLTQVQSTKSPISVVSTSTLNITLSDIIENNSTNLTSVSYGENSTLNETNVPMSKNVSEISTVLQQPTTVISKINLSTNSN                    RVIKQKGTDVLKKIESMLAYLDIPYRTTILEQVLLLTLIICRWLLPRGGITRDQLSQLLLVNIGMAADILELFEALKEKVVRHHLILNIIILVLWQMSLFQFSLTKTVTKARKVRLGYFEDYSTKSNTENNLQITNCICCRTELWAIATSLLLQDIPFFCLRITLIVDFDVLSYSNIFFTCKNSLVILLQLFRSYVILSGKTDDNQLESTISRQSLVVGSVTRWNQVHGNSEPGLDNRKALFTEQYELTKTNRNNANSMGILPKASPELSISSKEN+PKTDSLNSL
Sbjct:    1 MDVKPKSKVNKWFSPVVFLFLMCACPPIWIMELTIASNVTGHSEILNLTSREATISHFRPQLLPTTFQSANLTQVQSTKSPISVVSTSTLNITLSDIIENNSTNLTSVSYGENSTLNETNVPMSKNVSEISTVLQQPTTVISKINLSTNSN--------------------RVIKQKGTDVLKKIESMLAYLDIPYRTTILEQVLLLTLIICRWLLPRGGITRDQLSQLLLVNIGMAADILELFEALKEKVVRHHLILNIIILVLWQMSLFQFSLTKTVTKARKVRLGYFEDYSTKSNTENNLQITNCICCRTELWAIATSLLLQDIPFFCLRITLIVDFDVLSYSNIFFTCKNSLVILLQLFRSYVILSGKTDDNQLESTISRQSLVVGSVTRWNQVHGNSEPGLDNRKALFTEQYELTKTNRNNANSMGILPKASPELSISSKENLPKTDSLNSL 437          
BLAST of Transmembrane protein 26 vs. Planmine SMEST
Match: SMESG000049136.1 (SMESG000049136.1)

HSP 1 Score: 254.603 bits (649), Expect = 3.498e-77
Identity = 185/452 (40.93%), Postives = 250/452 (55.31%), Query Frame = 3
Query:   57 NFILMEKRSQYYQKAVIDCWKKXXXXXXXXXXXXVRCIFILYASIAIWNVVIVKTS-IYWLLLATLFPLFIETFIGIQQIKMDVKPKSKVNKWFSPVVFLFLMCACPPIWIMELTIASNVTGHSEILNLTSREATISHFRPQLLPTTFQSANLTQVQSTKSPISVVSTSTLNITLSDIIENNSTNLTSVSYGENSTLNETNVPMSKNVSEISTVLQQPTTVISKINLSTNSNIFILTRNISDIYVYGVSDITRVIKQ--KGTDVLKKIESMLAYLDIPYRTTILEQVXXXXXXXXXXXXPRGGITRDQLSQLLLVNIGMAADILELFEALKEKVVRHHXXXXXXXXXXWQMSLFQFSLTKTVTKARKVRLGYFEDYSTKSNTENNLQITNCICCRTELWAIATSLLLQDIPFFCLRITLIVDFDVLSYSNIFFTCKNSLVILLQLFRSYVIL 1403
            N+I+  +  +  +K  I CWK  +   + IR  IVR +F+ +  +A+WNVVIVK++  YWLLL    P   E     + I ++ K  SK+ KWFSPVV LFL  ACP IWI+E++I         + N  ++          + PTT  S+ +  V             TL  TL                         NV   +     S  +  P  + S I  + +SN    TR ++   V   S+  R+I++  +  ++ +K+E+    +    R  ++EQ LLL LI  RWLLPR GITR QLSQLLLVNIGM ADILELFEA KE VVR   +L + IL LWQ SL QF LTKT TK RK+R G+ +   T   +++ +++  C+ C TELWAI+TS+LLQD PF  LR+ LIV + V SYSNIFFTCKN+LVILLQ+FR  VIL
Sbjct:   15 NYIMSNRGLKKERKFYILCWKAIVKLSVVIRALIVRALFVAFIFLAVWNVVIVKSNDFYWLLLGCAIPFAAEVLYACKVIFIEKKDSSKIGKWFSPVVLLFLCSACPTIWIIEISIWHQYQPIKNVSNPVNKS---------IYPTTQNSSAVKMV-----------IITLEFTL-------------------------NVESFQQRKPTSPAITTPEFLTSIIPSTFHSNRRKKTRVLN---VLASSEEKRMIERENRRREIFEKVENAWKKISPENRVRMIEQFLLLCLIFARWLLPRAGITRQQLSQLLLVNIGMGADILELFEAFKEPVVRQDFLLTVSILSLWQASLLQFCLTKTATKVRKIRGGFSQTLKT---SDSWIRLPGCLFCETELWAISTSVLLQDGPFLILRVVLIVQYYVASYSNIFFTCKNTLVILLQMFRIGVIL 415          
BLAST of Transmembrane protein 26 vs. Planmine SMEST
Match: SMESG000049136.1 (SMESG000049136.1)

HSP 1 Score: 253.062 bits (645), Expect = 3.554e-76
Identity = 191/470 (40.64%), Postives = 259/470 (55.11%), Query Frame = 3
Query:    3 SQIIQLPSY*IQFILSFNNFILMEKRSQYYQKAVIDCWKKXXXXXXXXXXXXVRCIFILYASIAIWNVVIVKTS-IYWLLLATLFPLFIETFIGIQQIKMDVKPKSKVNKWFSPVVFLFLMCACPPIWIMELTIASNVTGHSEILNLTSREATISHFRPQLLPTTFQSANLTQVQSTKSPISVVSTSTLNITLSDIIENNSTNLTSVSYGENSTLNETNVPMSKNVSEISTVLQQPTTVISKINLSTNSNIFILTRNISDIYVYGVSDITRVIKQ--KGTDVLKKIESMLAYLDIPYRTTILEQVXXXXXXXXXXXXPRGGITRDQLSQLLLVNIGMAADILELFEALKEKVVRHHXXXXXXXXXXWQMSLFQFSLTKTVTKARKVRLGYFEDYSTKSNTENNLQITNCICCRTELWAIATSLLLQDIPFFCLRITLIVDFDVLSYSNIFFTCKNSLVILLQLFRSYVIL 1403
            SQI Q+ S  ++F +S      ++K  ++Y    I CWK  +   + IR  IVR +F+ +  +A+WNVVIVK++  YWLLL    P   E     + I ++ K  SK+ KWFSPVV LFL  ACP IWI+E++I         + N  ++          + PTT  S+ +  V             TL  TL                         NV   +     S  +  P  + S I  + +SN    TR ++   V   S+  R+I++  +  ++ +K+E+    +    R  ++EQ LLL LI  RWLLPR GITR QLSQLLLVNIGM ADILELFEA KE VVR   +L + IL LWQ SL QF LTKT TK RK+R G+ +   T   +++ +++  C+ C TELWAI+TS+LLQD PF  LR+ LIV + V SYSNIFFTCKN+LVILLQ+FR  VIL
Sbjct:   47 SQIPQVVS--VRFTMSNRG---LKKERKFY----ILCWKAIVKLSVVIRALIVRALFVAFIFLAVWNVVIVKSNDFYWLLLGCAIPFAAEVLYACKVIFIEKKDSSKIGKWFSPVVLLFLCSACPTIWIIEISIWHQYQPIKNVSNPVNKS---------IYPTTQNSSAVKMV-----------IITLEFTL-------------------------NVESFQQRKPTSPAITTPEFLTSIIPSTFHSNRRKKTRVLN---VLASSEEKRMIERENRRREIFEKVENAWKKISPENRVRMIEQFLLLCLIFARWLLPRAGITRQQLSQLLLVNIGMGADILELFEAFKEPVVRQDFLLTVSILSLWQASLLQFCLTKTATKVRKIRGGFSQTLKT---SDSWIRLPGCLFCETELWAISTSVLLQDGPFLILRVVLIVQYYVASYSNIFFTCKNTLVILLQMFRIGVIL 456          
BLAST of Transmembrane protein 26 vs. Planmine SMEST
Match: SMESG000001147.1 (SMESG000001147.1)

HSP 1 Score: 114.775 bits (286), Expect = 5.541e-27
Identity = 74/178 (41.57%), Postives = 101/178 (56.74%), Query Frame = 3
Query:  945 PRGGITRDQLSQLLLVNIGMAADILELFEALKEKVVRHHXXXXXXXXXXWQMSLFQFSLTKTVTKARKVRLG--------------YFEDYSTK-------SNTENNLQITNCICCR-----TELWAIATSLLLQDIPFFCLRITLIVDFDVLSYSNIFFTCKNSLVILLQLFRSYVI 1400
            P+G ++ DQLSQLLLV +G AADI E F++ K+K V+++  L ++IL LW  SL QFS   T  +ARK + G              Y++  ST          TEN        CCR      +++ I  S+ LQD PF   R+ LI  FDV+SY+N+FFT KNSLVI+L ++R  VI
Sbjct:   63 PKGKLSHDQLSQLLLVYLGTAADIAEFFDSFKDKTVQNNRFLCLMILGLWSCSLLQFSFVLTAARARKDQSGLISGKNTSVNSYTKYYQSNSTPYLSVFSIKETENKTVFVK--CCRYNWFSPDVYGIFISISLQDGPFLAFRLALIFRFDVVSYTNMFFTAKNSLVIILLVYRLIVI 238          
The following BLAST results are available for this feature:
BLAST of Transmembrane protein 26 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
TMEM261.629e-1740.40transmembrane protein 26 [Source:HGNC Symbol;Acc:H... [more]
TMEM261.629e-1740.40transmembrane protein 26 [Source:HGNC Symbol;Acc:H... [more]
TMEM263.890e-858.62transmembrane protein 26 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of Transmembrane protein 26 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Y119C1B.31.960e-2537.34pep chromosome:WBcel235:I:4550401:4552758:1 gene:W... [more]
Y119C1B.31.960e-2537.34pep chromosome:WBcel235:I:4549695:4552758:1 gene:W... [more]
back to top
BLAST of Transmembrane protein 26 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG142381.179e-3235.45gene:FBgn0039429 transcript:FBtr0085014[more]
back to top
BLAST of Transmembrane protein 26 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
tmem26b7.436e-2038.67transmembrane protein 26b [Source:ZFIN;Acc:ZDB-GEN... [more]
tmem26a1.035e-1838.66transmembrane protein 26a [Source:ZFIN;Acc:ZDB-GEN... [more]
CU638868.11.081e-1438.10transmembrane protein 26a [Source:NCBI gene;Acc:79... [more]
back to top
BLAST of Transmembrane protein 26 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
nsa21.273e-1942.04NSA2, ribosome biogenesis homolog [Source:Xenbase;... [more]
nsa21.380e-1942.04NSA2, ribosome biogenesis homolog [Source:Xenbase;... [more]
lrch31.078e-1842.04leucine-rich repeats and calponin homology (CH) do... [more]
nostrin5.621e-1731.31nitric oxide synthase trafficking [Source:Xenbase;... [more]
back to top
BLAST of Transmembrane protein 26 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Tmem267.881e-1837.87transmembrane protein 26 [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of Transmembrane protein 26 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q3UP23|TMM26_MOUSE3.299e-1740.00Transmembrane protein 26 OS=Mus musculus OX=10090 ... [more]
sp|Q6ZUK4|TMM26_HUMAN7.824e-1740.40Transmembrane protein 26 OS=Homo sapiens OX=9606 G... [more]
back to top
BLAST of Transmembrane protein 26 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G4LX491.447e-4739.58Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A183QJE33.838e-4439.84Uncharacterized protein OS=Schistosoma rodhaini OX... [more]
A0A0R3SG347.905e-4434.49Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A151XH342.848e-3834.38Transmembrane protein 26 OS=Trachymyrmex zeteki OX... [more]
A0A2C9JGQ24.259e-3852.24Uncharacterized protein OS=Biomphalaria glabrata O... [more]
back to top
BLAST of Transmembrane protein 26 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSAMXT00000044825.12.452e-2339.29pep primary_assembly:Astyanax_mexicanus-2.0:6:1299... [more]
tmem26a1.296e-1636.32transmembrane protein 26-like [Source:NCBI gene;Ac... [more]
tmem26b2.209e-1433.77transmembrane protein 26b [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Transmembrane protein 26 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000005994.12.406e-1036.19pep scaffold:Pmarinus_7.0:GL479500:25820:30764:-1 ... [more]
ENSPMAT00000005990.15.523e-1048.28pep scaffold:Pmarinus_7.0:GL479500:25802:30764:-1 ... [more]
ENSPMAT00000005989.16.024e-1048.28pep scaffold:Pmarinus_7.0:GL479500:25802:30764:-1 ... [more]
back to top
BLAST of Transmembrane protein 26 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transmembrane protein 26 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO408474.878e-2138.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO479242.642e-2040.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO327601.122e-1739.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO400166.442e-1735.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO485613.991e-1333.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Transmembrane protein 26 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSORLT00000005990.21.086e-1332.67pep primary_assembly:ASM223467v1:15:16625055:16640... [more]
tmem26a1.842e-931.33transmembrane protein 26a [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Transmembrane protein 26 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000079787.10.000e+099.78SMESG000079787.1[more]
SMESG000079787.10.000e+095.40SMESG000079787.1[more]
SMESG000049136.13.498e-7740.93SMESG000049136.1[more]
SMESG000049136.13.554e-7640.64SMESG000049136.1[more]
SMESG000001147.15.541e-2741.57SMESG000001147.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024383 ID=SMED30024383|Name=Transmembrane protein 26|organism=Schmidtea mediterranea sexual|type=transcript|length=1803bp
AATCCCAGATCATTCAACTTCCGTCTTATTAAATTCAATTTATTTTATCT
TTCAATAATTTTATTTTAATGGAAAAAAGAAGTCAGTATTATCAAAAAGC
AGTTATAGACTGTTGGAAAAAATTCATCATTTTCATTATTGCAATCAGAA
CGTTCATTGTTCGATGTATTTTCATTCTCTACGCTTCAATCGCCATTTGG
AACGTGGTCATCGTCAAAACTAGCATCTACTGGCTGCTGTTGGCCACCCT
TTTCCCATTATTTATCGAAACCTTCATAGGGATACAACAGATCAAAATGG
ACGTCAAACCCAAATCAAAAGTTAACAAATGGTTTTCTCCAGTTGTGTTC
CTATTTCTGATGTGTGCCTGCCCCCCAATATGGATAATGGAGTTGACTAT
AGCTTCAAATGTTACAGGTCATTCTGAGATCTTGAATTTAACTTCACGAG
AAGCCACGATTTCTCACTTCAGACCGCAGCTGCTTCCCACAACATTCCAA
TCAGCCAATTTAACACAAGTTCAGTCAACAAAATCTCCGATTTCTGTCGT
TTCTACGTCAACATTGAATATTACGCTATCCGATATAATAGAAAACAACA
GTACAAATTTAACATCGGTCAGTTATGGCGAAAACAGCACGTTGAATGAA
ACCAACGTCCCAATGTCAAAAAACGTGTCGGAGATCTCGACAGTTCTTCA
ACAACCGACGACTGTTATATCAAAAATCAACTTGTCAACAAATTCAAATA
TTTTCATATTAACAAGAAATATAAGTGATATTTATGTCTATGGTGTGTCT
GACATTACAAGAGTCATAAAACAAAAAGGAACAGACGTCCTCAAAAAAAT
TGAGTCAATGTTAGCTTATTTGGATATTCCTTATCGGACAACAATTTTAG
AACAAGTTCTTTTGTTGACTTTAATAATATGTAGATGGCTCTTGCCAAGA
GGAGGGATCACGAGGGATCAGTTGTCTCAATTGTTGCTCGTTAACATTGG
CATGGCTGCCGACATTTTAGAACTATTTGAAGCTTTAAAAGAAAAGGTCG
TTAGGCATCATTTAATATTGAACATAATTATATTGGTACTGTGGCAAATG
TCTCTGTTTCAGTTTTCTCTCACAAAAACAGTAACTAAAGCTCGAAAAGT
GCGTCTTGGATATTTTGAGGATTATTCAACAAAGTCAAATACTGAAAACA
ATTTACAAATCACAAACTGTATATGTTGTCGCACGGAATTGTGGGCAATT
GCAACTTCATTGCTACTACAAGACATTCCCTTCTTTTGCTTGAGGATCAC
GTTGATTGTTGATTTTGACGTTTTGAGTTACTCAAATATATTTTTCACTT
GTAAAAATTCACTAGTCATTTTGCTACAACTATTTCGGTCATATGTGATT
CTATCCGGAAAAACTGATGACAACCAATTAGAGTCTACTATTTCCCGACA
ATCTTTAGTTGTCGGCAGTGTGACTAGATGGAATCAAGTTCATGGAAATT
CCGAACCGGGTTTAGACAATCGTAAAGCTTTATTTACAGAACAATATGAA
CTCACCAAGACAAACAGAAACAATGCAAATTCAATGGGAATTCTTCCAAA
AGCATCTCCAGAGTTATCAATTTCTTCCAAAGAAAATATACCGAAAACTG
ATTCTTTGAATTCTCTATAAAAAAATAAATGTTTTTGGATTTTCTCAGAG
TTTTTCTCACTCATTGAGATAAGCCCATTTTCCCTGGTTGATTTTTCTTT
TACTAAAATAGAGTCTATTGTCAGTTTCCTCATTTTCATTGGTTATATTC
GAC
back to top

protein sequence of SMED30024383-orf-1

>SMED30024383-orf-1 ID=SMED30024383-orf-1|Name=SMED30024383-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=100bp
MKMRKLTIDSILVKEKSTRENGLISMSEKNSEKIQKHLFFYREFKESVFG
IFSLEEIDNSGDAFGRIPIEFALFLFVLVSSYCSVNKALRLSKPGSEFP*
back to top

protein sequence of SMED30024383-orf-2

>SMED30024383-orf-2 ID=SMED30024383-orf-2|Name=SMED30024383-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=534bp
MEKRSQYYQKAVIDCWKKFIIFIIAIRTFIVRCIFILYASIAIWNVVIVK
TSIYWLLLATLFPLFIETFIGIQQIKMDVKPKSKVNKWFSPVVFLFLMCA
CPPIWIMELTIASNVTGHSEILNLTSREATISHFRPQLLPTTFQSANLTQ
VQSTKSPISVVSTSTLNITLSDIIENNSTNLTSVSYGENSTLNETNVPMS
KNVSEISTVLQQPTTVISKINLSTNSNIFILTRNISDIYVYGVSDITRVI
KQKGTDVLKKIESMLAYLDIPYRTTILEQVLLLTLIICRWLLPRGGITRD
QLSQLLLVNIGMAADILELFEALKEKVVRHHLILNIIILVLWQMSLFQFS
LTKTVTKARKVRLGYFEDYSTKSNTENNLQITNCICCRTELWAIATSLLL
QDIPFFCLRITLIVDFDVLSYSNIFFTCKNSLVILLQLFRSYVILSGKTD
DNQLESTISRQSLVVGSVTRWNQVHGNSEPGLDNRKALFTEQYELTKTNR
NNANSMGILPKASPELSISSKENIPKTDSLNSL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002089reproductive organ
PLANA:0003104enteric muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR019169Transmembrane_26
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR019169Transmembrane protein 26PFAMPF09772Tmem26coord: 265..440
e-value: 7.9E-56
score: 189.5
coord: 23..133
e-value: 7.6E-15
score: 55.0
IPR019169Transmembrane protein 26PANTHERPTHR22168TMEM26 PROTEINcoord: 23..458
NoneNo IPR availableTMHMMTMhelixcoord: 85..107
NoneNo IPR availableTMHMMTMhelixcoord: 53..72
NoneNo IPR availableTMHMMTMhelixcoord: 21..43