Protein LSM14 homolog B-B

Overview
NameProtein LSM14 homolog B-B
Smed IDSMED30024374
Length (bp)1465
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein LSM14 homolog B-B (SMED30024374) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein LSM14 homolog B-B (SMED30024374) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein LSM14 homolog B-B (SMED30024374) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein LSM14 homolog B-B (SMED30024374) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024374

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30024374SMESG000033950.1 SmedASXL_006962SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30024374SMESG000033950.1 dd_Smed_v4_1594_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30024374SMESG000033950.1 Contig45045newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30024374SMESG000033950.1 Contig45045uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30024374SMESG000033950.1 dd_Smed_v4_1594_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30024374SMESG000033950.1 dd_Smed_v4_1594_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein LSM14 homolog B-B vs. Ensembl Human
Match: LSM14B (LSM family member 14B [Source:HGNC Symbol;Acc:HGNC:15887])

HSP 1 Score: 124.79 bits (312), Expect = 1.930e-32
Identity = 65/108 (60.19%), Postives = 78/108 (72.22%), Query Frame = 2
Query:  104 FLGKKISLISKAGIRYEGILYTIDPTESTVALSKVKSFGTEDRPSERFISPRDEVYEYIIFRGSDIRDLHVCE----NSLYSEDSAIVKIMSPNFTNQP--PHVPLPP 409
            +LG KISLISKA IRYEGILYTID   STVAL+KV+SFGTEDRP++R   PR+E+YEYIIFRGSDI+D+ VCE         +D AIV+    + +  P  PHVP  P
Sbjct:    9 YLGSKISLISKAQIRYEGILYTIDTDNSTVALAKVRSFGTEDRPTDRPAPPREEIYEYIIFRGSDIKDITVCEPPKAQHTLPQDPAIVQSSLGSASASPFQPHVPYSP 116          
BLAST of Protein LSM14 homolog B-B vs. Ensembl Human
Match: LSM14A (LSM14A mRNA processing body assembly factor [Source:HGNC Symbol;Acc:HGNC:24489])

HSP 1 Score: 120.553 bits (301), Expect = 2.191e-32
Identity = 61/89 (68.54%), Postives = 71/89 (79.78%), Query Frame = 2
Query:  104 FLGKKISLISKAGIRYEGILYTIDPTESTVALSKVKSFGTEDRPSERFISPRDEVYEYIIFRGSDIRDLHVCE----NSLYSEDSAIVK 358
            ++G KISLISKA IRYEGILYTID   STVAL+KV+SFGTEDRP++R I PRDEV+EYIIFRGSDI+DL VCE         +D AIV+
Sbjct:    7 YIGSKISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPIPPRDEVFEYIIFRGSDIKDLTVCEPPKPQCSLPQDPAIVQ 95          
BLAST of Protein LSM14 homolog B-B vs. Ensembl Human
Match: LSM14A (LSM14A mRNA processing body assembly factor [Source:HGNC Symbol;Acc:HGNC:24489])

HSP 1 Score: 120.553 bits (301), Expect = 2.191e-32
Identity = 61/89 (68.54%), Postives = 71/89 (79.78%), Query Frame = 2
Query:  104 FLGKKISLISKAGIRYEGILYTIDPTESTVALSKVKSFGTEDRPSERFISPRDEVYEYIIFRGSDIRDLHVCE----NSLYSEDSAIVK 358
            ++G KISLISKA IRYEGILYTID   STVAL+KV+SFGTEDRP++R I PRDEV+EYIIFRGSDI+DL VCE         +D AIV+
Sbjct:    7 YIGSKISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPIPPRDEVFEYIIFRGSDIKDLTVCEPPKPQCSLPQDPAIVQ 95          
BLAST of Protein LSM14 homolog B-B vs. Ensembl Human
Match: LSM14B (LSM family member 14B [Source:HGNC Symbol;Acc:HGNC:15887])

HSP 1 Score: 123.635 bits (309), Expect = 5.211e-32
Identity = 65/108 (60.19%), Postives = 78/108 (72.22%), Query Frame = 2
Query:  104 FLGKKISLISKAGIRYEGILYTIDPTESTVALSKVKSFGTEDRPSERFISPRDEVYEYIIFRGSDIRDLHVCE----NSLYSEDSAIVKIMSPNFTNQP--PHVPLPP 409
            +LG KISLISKA IRYEGILYTID   STVAL+KV+SFGTEDRP++R   PR+E+YEYIIFRGSDI+D+ VCE         +D AIV+    + +  P  PHVP  P
Sbjct:    9 YLGSKISLISKAQIRYEGILYTIDTDNSTVALAKVRSFGTEDRPTDRPAPPREEIYEYIIFRGSDIKDITVCEPPKAQHTLPQDPAIVQSSLGSASASPFQPHVPYSP 116          
BLAST of Protein LSM14 homolog B-B vs. Ensembl Human
Match: LSM14B (LSM family member 14B [Source:HGNC Symbol;Acc:HGNC:15887])

HSP 1 Score: 125.946 bits (315), Expect = 2.784e-31
Identity = 65/108 (60.19%), Postives = 78/108 (72.22%), Query Frame = 2
Query:  104 FLGKKISLISKAGIRYEGILYTIDPTESTVALSKVKSFGTEDRPSERFISPRDEVYEYIIFRGSDIRDLHVCE----NSLYSEDSAIVKIMSPNFTNQP--PHVPLPP 409
            +LG KISLISKA IRYEGILYTID   STVAL+KV+SFGTEDRP++R   PR+E+YEYIIFRGSDI+D+ VCE         +D AIV+    + +  P  PHVP  P
Sbjct:    9 YLGSKISLISKAQIRYEGILYTIDTDNSTVALAKVRSFGTEDRPTDRPAPPREEIYEYIIFRGSDIKDITVCEPPKAQHTLPQDPAIVQSSLGSASASPFQPHVPYSP 116          
BLAST of Protein LSM14 homolog B-B vs. Ensembl Celegans
Match: car-1 (Cytokinesis, Apoptosis, RNA-associated [Source:UniProtKB/TrEMBL;Acc:Q9XW17])

HSP 1 Score: 106.301 bits (264), Expect = 3.587e-25
Identity = 71/195 (36.41%), Postives = 100/195 (51.28%), Query Frame = 2
Query:  104 FLGKKISLISKAGIRYEGILYTIDPTESTVALSKVKSFGTEDRPSERFISPRDEVYEYIIFRGSDIRDLHVCENSLYSE-------DSAIVKIMSPNFTNQPPHVPLPPHGIDVGVPDIHP------QNQERSPSGFHSTPNQNDNRIINNHXXXXXXXXXXXXGHSENKPIQTPRTHDKSELQKDKDEKFDMDK 649
            ++G KISLISK  IRYEGILYT+D  +ST+AL+KV+SFGTE RP+   ++ RD+VYEYIIF+ SDI+DL VC+    +        D AI+ + S +                 G P  +       QNQ     G+    N   NR  NN+         +  GH+       PR + + +L+ + D  FD +K
Sbjct:    7 YIGSKISLISKLDIRYEGILYTVDTNDSTIALAKVRSFGTEKRPTANPVAARDDVYEYIIFKASDIKDLIVCDTPKMANIGGGLPYDPAIISVSSRSAPASDGAPAASAGSSRAGTPSRNSPLGQIIQNQRPGRGGYQQ--NFQANRGYNNYRGGFAGGYNNQRGHNN---YGVPRVNHREKLKFESD--FDFEK 194          
BLAST of Protein LSM14 homolog B-B vs. Ensembl Fly
Match: tral (gene:FBgn0041775 transcript:FBtr0332640)

HSP 1 Score: 111.694 bits (278), Expect = 9.257e-26
Identity = 56/103 (54.37%), Postives = 73/103 (70.87%), Query Frame = 2
Query:  107 LGKKISLISKAGIRYEGILYTIDPTESTVALSKVKSFGTEDRPSERFISPRDEVYEYIIFRGSDIRDLHVCENSL--YSEDSAIVKIMSPNFTNQ-PPHVPLP 406
            LG KISLISKA IRYEG LYT+DP E T+ALS V+SFGTEDR ++  I+P+ ++Y+YI+FRGSDI+D+ V  N    +  D AI++    N   Q P H P+P
Sbjct:    8 LGSKISLISKADIRYEGRLYTVDPQECTIALSSVRSFGTEDRDTQFQIAPQSQIYDYILFRGSDIKDIRVVNNHTLPHHNDPAIMQAQLQNGPPQMPQHFPMP 110          
BLAST of Protein LSM14 homolog B-B vs. Ensembl Fly
Match: tral (gene:FBgn0041775 transcript:FBtr0332638)

HSP 1 Score: 111.309 bits (277), Expect = 9.577e-26
Identity = 56/103 (54.37%), Postives = 73/103 (70.87%), Query Frame = 2
Query:  107 LGKKISLISKAGIRYEGILYTIDPTESTVALSKVKSFGTEDRPSERFISPRDEVYEYIIFRGSDIRDLHVCENSL--YSEDSAIVKIMSPNFTNQ-PPHVPLP 406
            LG KISLISKA IRYEG LYT+DP E T+ALS V+SFGTEDR ++  I+P+ ++Y+YI+FRGSDI+D+ V  N    +  D AI++    N   Q P H P+P
Sbjct:    8 LGSKISLISKADIRYEGRLYTVDPQECTIALSSVRSFGTEDRDTQFQIAPQSQIYDYILFRGSDIKDIRVVNNHTLPHHNDPAIMQAQLQNGPPQMPQHFPMP 110          
BLAST of Protein LSM14 homolog B-B vs. Ensembl Fly
Match: tral (gene:FBgn0041775 transcript:FBtr0332635)

HSP 1 Score: 111.309 bits (277), Expect = 1.027e-25
Identity = 56/103 (54.37%), Postives = 73/103 (70.87%), Query Frame = 2
Query:  107 LGKKISLISKAGIRYEGILYTIDPTESTVALSKVKSFGTEDRPSERFISPRDEVYEYIIFRGSDIRDLHVCENSL--YSEDSAIVKIMSPNFTNQ-PPHVPLP 406
            LG KISLISKA IRYEG LYT+DP E T+ALS V+SFGTEDR ++  I+P+ ++Y+YI+FRGSDI+D+ V  N    +  D AI++    N   Q P H P+P
Sbjct:    8 LGSKISLISKADIRYEGRLYTVDPQECTIALSSVRSFGTEDRDTQFQIAPQSQIYDYILFRGSDIKDIRVVNNHTLPHHNDPAIMQAQLQNGPPQMPQHFPMP 110          
BLAST of Protein LSM14 homolog B-B vs. Ensembl Fly
Match: tral (gene:FBgn0041775 transcript:FBtr0075959)

HSP 1 Score: 111.309 bits (277), Expect = 1.027e-25
Identity = 56/103 (54.37%), Postives = 73/103 (70.87%), Query Frame = 2
Query:  107 LGKKISLISKAGIRYEGILYTIDPTESTVALSKVKSFGTEDRPSERFISPRDEVYEYIIFRGSDIRDLHVCENSL--YSEDSAIVKIMSPNFTNQ-PPHVPLP 406
            LG KISLISKA IRYEG LYT+DP E T+ALS V+SFGTEDR ++  I+P+ ++Y+YI+FRGSDI+D+ V  N    +  D AI++    N   Q P H P+P
Sbjct:    8 LGSKISLISKADIRYEGRLYTVDPQECTIALSSVRSFGTEDRDTQFQIAPQSQIYDYILFRGSDIKDIRVVNNHTLPHHNDPAIMQAQLQNGPPQMPQHFPMP 110          
BLAST of Protein LSM14 homolog B-B vs. Ensembl Fly
Match: tral (gene:FBgn0041775 transcript:FBtr0332642)

HSP 1 Score: 111.309 bits (277), Expect = 1.034e-25
Identity = 56/103 (54.37%), Postives = 73/103 (70.87%), Query Frame = 2
Query:  107 LGKKISLISKAGIRYEGILYTIDPTESTVALSKVKSFGTEDRPSERFISPRDEVYEYIIFRGSDIRDLHVCENSL--YSEDSAIVKIMSPNFTNQ-PPHVPLP 406
            LG KISLISKA IRYEG LYT+DP E T+ALS V+SFGTEDR ++  I+P+ ++Y+YI+FRGSDI+D+ V  N    +  D AI++    N   Q P H P+P
Sbjct:    8 LGSKISLISKADIRYEGRLYTVDPQECTIALSSVRSFGTEDRDTQFQIAPQSQIYDYILFRGSDIKDIRVVNNHTLPHHNDPAIMQAQLQNGPPQMPQHFPMP 110          
BLAST of Protein LSM14 homolog B-B vs. Ensembl Zebrafish
Match: lsm14aa (LSM14A mRNA processing body assembly factor a [Source:ZFIN;Acc:ZDB-GENE-040426-1567])

HSP 1 Score: 122.479 bits (306), Expect = 2.733e-31
Identity = 60/89 (67.42%), Postives = 71/89 (79.78%), Query Frame = 2
Query:  104 FLGKKISLISKAGIRYEGILYTIDPTESTVALSKVKSFGTEDRPSERFISPRDEVYEYIIFRGSDIRDLHVCE----NSLYSEDSAIVK 358
            ++G KISLISKA IRYEGILYTID   STVAL+KV+SFGTEDRP++R I+PRDE +EYIIFRGSDI+DL VCE         +D AIV+
Sbjct:    7 YIGSKISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPIAPRDETFEYIIFRGSDIKDLTVCEPPKPTCSLPQDPAIVQ 95          
BLAST of Protein LSM14 homolog B-B vs. Ensembl Zebrafish
Match: lsm14aa (LSM14A mRNA processing body assembly factor a [Source:ZFIN;Acc:ZDB-GENE-040426-1567])

HSP 1 Score: 114.775 bits (286), Expect = 1.085e-30
Identity = 56/73 (76.71%), Postives = 65/73 (89.04%), Query Frame = 2
Query:  104 FLGKKISLISKAGIRYEGILYTIDPTESTVALSKVKSFGTEDRPSERFISPRDEVYEYIIFRGSDIRDLHVCE 322
            ++G KISLISKA IRYEGILYTID   STVAL+KV+SFGTEDRP++R I+PRDE +EYIIFRGSDI+DL VCE
Sbjct:    7 YIGSKISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPIAPRDETFEYIIFRGSDIKDLTVCE 79          
BLAST of Protein LSM14 homolog B-B vs. Ensembl Zebrafish
Match: lsm14aa (LSM14A mRNA processing body assembly factor a [Source:ZFIN;Acc:ZDB-GENE-040426-1567])

HSP 1 Score: 121.709 bits (304), Expect = 1.183e-29
Identity = 60/89 (67.42%), Postives = 71/89 (79.78%), Query Frame = 2
Query:  104 FLGKKISLISKAGIRYEGILYTIDPTESTVALSKVKSFGTEDRPSERFISPRDEVYEYIIFRGSDIRDLHVCE----NSLYSEDSAIVK 358
            ++G KISLISKA IRYEGILYTID   STVAL+KV+SFGTEDRP++R I+PRDE +EYIIFRGSDI+DL VCE         +D AIV+
Sbjct:    7 YIGSKISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPIAPRDETFEYIIFRGSDIKDLTVCEPPKPTCSLPQDPAIVQ 95          
BLAST of Protein LSM14 homolog B-B vs. Ensembl Zebrafish
Match: lsm14ab (LSM14A mRNA processing body assembly factor b [Source:ZFIN;Acc:ZDB-GENE-040426-2462])

HSP 1 Score: 121.324 bits (303), Expect = 1.616e-29
Identity = 60/89 (67.42%), Postives = 71/89 (79.78%), Query Frame = 2
Query:  104 FLGKKISLISKAGIRYEGILYTIDPTESTVALSKVKSFGTEDRPSERFISPRDEVYEYIIFRGSDIRDLHVCE----NSLYSEDSAIVK 358
            ++G KISLISKA IRYEG+LYTID   STVAL+KVKSFGTEDRP++R I PRD+V+EYIIFRGSDI+DL VCE         +D AIV+
Sbjct:    7 YIGSKISLISKAEIRYEGVLYTIDTENSTVALAKVKSFGTEDRPTDRPIPPRDDVFEYIIFRGSDIKDLTVCEPPKPTCNLPQDPAIVQ 95          
BLAST of Protein LSM14 homolog B-B vs. Ensembl Zebrafish
Match: lsm14ab (LSM14A mRNA processing body assembly factor b [Source:ZFIN;Acc:ZDB-GENE-040426-2462])

HSP 1 Score: 121.709 bits (304), Expect = 1.884e-29
Identity = 60/89 (67.42%), Postives = 71/89 (79.78%), Query Frame = 2
Query:  104 FLGKKISLISKAGIRYEGILYTIDPTESTVALSKVKSFGTEDRPSERFISPRDEVYEYIIFRGSDIRDLHVCE----NSLYSEDSAIVK 358
            ++G KISLISKA IRYEG+LYTID   STVAL+KVKSFGTEDRP++R I PRD+V+EYIIFRGSDI+DL VCE         +D AIV+
Sbjct:    7 YIGSKISLISKAEIRYEGVLYTIDTENSTVALAKVKSFGTEDRPTDRPIPPRDDVFEYIIFRGSDIKDLTVCEPPKPTCNLPQDPAIVQ 95          
BLAST of Protein LSM14 homolog B-B vs. Ensembl Xenopus
Match: rps15 (ribosomal protein S15 [Source:Xenbase;Acc:XB-GENE-5832673])

HSP 1 Score: 122.865 bits (307), Expect = 5.701e-30
Identity = 61/89 (68.54%), Postives = 71/89 (79.78%), Query Frame = 2
Query:  104 FLGKKISLISKAGIRYEGILYTIDPTESTVALSKVKSFGTEDRPSERFISPRDEVYEYIIFRGSDIRDLHVCE----NSLYSEDSAIVK 358
            ++G KISLISKA IRYEGILYTID   STVAL+KV+SFGTEDRP++R I PRDEV+EYIIFRGSDI+DL VCE         +D AIV+
Sbjct:    7 YIGSKISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPIPPRDEVFEYIIFRGSDIKDLTVCEPPKPQCSLPQDPAIVQ 95          
BLAST of Protein LSM14 homolog B-B vs. Ensembl Xenopus
Match: lsm14b (LSM family member 14B [Source:NCBI gene;Acc:595068])

HSP 1 Score: 121.709 bits (304), Expect = 8.940e-30
Identity = 60/91 (65.93%), Postives = 72/91 (79.12%), Query Frame = 2
Query:  104 FLGKKISLISKAGIRYEGILYTIDPTESTVALSKVKSFGTEDRPSERFISPRDEVYEYIIFRGSDIRDLHVCENSLYS----EDSAIVKIM 364
            ++G KISLISKA IRYEGILYTID   STVAL+KV+SFGTEDRP++R   PR+EVYEYIIFRGSDI+D+ VCE    S    +D AIV++ 
Sbjct:    7 YIGSKISLISKAQIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPAPPREEVYEYIIFRGSDIKDITVCEPPKASHALPQDPAIVQVC 97          
BLAST of Protein LSM14 homolog B-B vs. Ensembl Xenopus
Match: rps15 (ribosomal protein S15 [Source:Xenbase;Acc:XB-GENE-5832673])

HSP 1 Score: 122.479 bits (306), Expect = 1.296e-29
Identity = 61/89 (68.54%), Postives = 71/89 (79.78%), Query Frame = 2
Query:  104 FLGKKISLISKAGIRYEGILYTIDPTESTVALSKVKSFGTEDRPSERFISPRDEVYEYIIFRGSDIRDLHVCE----NSLYSEDSAIVK 358
            ++G KISLISKA IRYEGILYTID   STVAL+KV+SFGTEDRP++R I PRDEV+EYIIFRGSDI+DL VCE         +D AIV+
Sbjct:    7 YIGSKISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPIPPRDEVFEYIIFRGSDIKDLTVCEPPKPQCSLPQDPAIVQ 95          
BLAST of Protein LSM14 homolog B-B vs. Ensembl Xenopus
Match: lsm14b (LSM family member 14B [Source:NCBI gene;Acc:595068])

HSP 1 Score: 119.783 bits (299), Expect = 1.573e-29
Identity = 60/89 (67.42%), Postives = 71/89 (79.78%), Query Frame = 2
Query:  104 FLGKKISLISKAGIRYEGILYTIDPTESTVALSKVKSFGTEDRPSERFISPRDEVYEYIIFRGSDIRDLHVCENSLYS----EDSAIVK 358
            ++G KISLISKA IRYEGILYTID   STVAL+KV+SFGTEDRP++R   PR+EVYEYIIFRGSDI+D+ VCE    S    +D AIV+
Sbjct:    7 YIGSKISLISKAQIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPAPPREEVYEYIIFRGSDIKDITVCEPPKASHALPQDPAIVQ 95          
BLAST of Protein LSM14 homolog B-B vs. Ensembl Xenopus
Match: lsm14b (LSM family member 14B [Source:NCBI gene;Acc:595068])

HSP 1 Score: 120.553 bits (301), Expect = 1.735e-29
Identity = 60/89 (67.42%), Postives = 71/89 (79.78%), Query Frame = 2
Query:  104 FLGKKISLISKAGIRYEGILYTIDPTESTVALSKVKSFGTEDRPSERFISPRDEVYEYIIFRGSDIRDLHVCENSLYS----EDSAIVK 358
            ++G KISLISKA IRYEGILYTID   STVAL+KV+SFGTEDRP++R   PR+EVYEYIIFRGSDI+D+ VCE    S    +D AIV+
Sbjct:    7 YIGSKISLISKAQIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPAPPREEVYEYIIFRGSDIKDITVCEPPKASHALPQDPAIVQ 95          
BLAST of Protein LSM14 homolog B-B vs. Ensembl Mouse
Match: Lsm14b (LSM family member 14B [Source:MGI Symbol;Acc:MGI:3040677])

HSP 1 Score: 128.257 bits (321), Expect = 2.233e-32
Identity = 74/143 (51.75%), Postives = 92/143 (64.34%), Query Frame = 2
Query:  104 FLGKKISLISKAGIRYEGILYTIDPTESTVALSKVKSFGTEDRPSERFISPRDEVYEYIIFRGSDIRDLHVCE----NSLYSEDSAIVKIMSPNFTNQP--PHVP------LPPHGIDVGVPDIHPQNQERS---PSGFHSTP 487
            +LG KISLISKA IRYEGILYTID   STVAL+KV+SFGTEDRP++R   PR+E+YEYIIFRGSDI+D+ VCE         +D AIV+    + +  P  PHVP      +PP+G  +    +  Q    S    +GF STP
Sbjct:    9 YLGSKISLISKAQIRYEGILYTIDTDNSTVALAKVRSFGTEDRPTDRPAPPREEIYEYIIFRGSDIKDITVCEPPKAQHTLPQDPAIVQSSLGSASASPFQPHVPYSPFRGMPPYG-QLAASSLLSQQYAASLGLGAGFPSTP 150          
BLAST of Protein LSM14 homolog B-B vs. Ensembl Mouse
Match: Lsm14a (LSM14A mRNA processing body assembly factor [Source:MGI Symbol;Acc:MGI:1914320])

HSP 1 Score: 121.709 bits (304), Expect = 9.753e-31
Identity = 57/73 (78.08%), Postives = 65/73 (89.04%), Query Frame = 2
Query:  104 FLGKKISLISKAGIRYEGILYTIDPTESTVALSKVKSFGTEDRPSERFISPRDEVYEYIIFRGSDIRDLHVCE 322
            ++G KISLISKA IRYEGILYTID   STVAL+KV+SFGTEDRP++R I PRDEV+EYIIFRGSDI+DL VCE
Sbjct:    7 YIGSKISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPIPPRDEVFEYIIFRGSDIKDLTVCE 79          
BLAST of Protein LSM14 homolog B-B vs. Ensembl Mouse
Match: Lsm14a (LSM14A mRNA processing body assembly factor [Source:MGI Symbol;Acc:MGI:1914320])

HSP 1 Score: 121.324 bits (303), Expect = 1.863e-29
Identity = 57/73 (78.08%), Postives = 65/73 (89.04%), Query Frame = 2
Query:  104 FLGKKISLISKAGIRYEGILYTIDPTESTVALSKVKSFGTEDRPSERFISPRDEVYEYIIFRGSDIRDLHVCE 322
            ++G KISLISKA IRYEGILYTID   STVAL+KV+SFGTEDRP++R I PRDEV+EYIIFRGSDI+DL VCE
Sbjct:    7 YIGSKISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPIPPRDEVFEYIIFRGSDIKDLTVCE 79          
BLAST of Protein LSM14 homolog B-B vs. Ensembl Mouse
Match: Lsm14a (LSM14A mRNA processing body assembly factor [Source:MGI Symbol;Acc:MGI:1914320])

HSP 1 Score: 73.9442 bits (180), Expect = 5.344e-15
Identity = 32/40 (80.00%), Postives = 37/40 (92.50%), Query Frame = 2
Query:  203 KVKSFGTEDRPSERFISPRDEVYEYIIFRGSDIRDLHVCE 322
            KV+SFGTEDRP++R I PRDEV+EYIIFRGSDI+DL VCE
Sbjct:    4 KVRSFGTEDRPTDRPIPPRDEVFEYIIFRGSDIKDLTVCE 43          
BLAST of Protein LSM14 homolog B-B vs. UniProt/SwissProt
Match: sp|Q8CGC4|LS14B_MOUSE (Protein LSM14 homolog B OS=Mus musculus OX=10090 GN=Lsm14b PE=1 SV=3)

HSP 1 Score: 128.257 bits (321), Expect = 1.562e-31
Identity = 74/143 (51.75%), Postives = 92/143 (64.34%), Query Frame = 2
Query:  104 FLGKKISLISKAGIRYEGILYTIDPTESTVALSKVKSFGTEDRPSERFISPRDEVYEYIIFRGSDIRDLHVCE----NSLYSEDSAIVKIMSPNFTNQP--PHVP------LPPHGIDVGVPDIHPQNQERS---PSGFHSTP 487
            +LG KISLISKA IRYEGILYTID   STVAL+KV+SFGTEDRP++R   PR+E+YEYIIFRGSDI+D+ VCE         +D AIV+    + +  P  PHVP      +PP+G  +    +  Q    S    +GF STP
Sbjct:    9 YLGSKISLISKAQIRYEGILYTIDTDNSTVALAKVRSFGTEDRPTDRPAPPREEIYEYIIFRGSDIKDITVCEPPKAQHTLPQDPAIVQSSLGSASASPFQPHVPYSPFRGMPPYG-QLAASSLLSQQYAASLGLGAGFPSTP 150          
BLAST of Protein LSM14 homolog B-B vs. UniProt/SwissProt
Match: sp|Q9BX40|LS14B_HUMAN (Protein LSM14 homolog B OS=Homo sapiens OX=9606 GN=LSM14B PE=1 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 1.337e-30
Identity = 65/108 (60.19%), Postives = 78/108 (72.22%), Query Frame = 2
Query:  104 FLGKKISLISKAGIRYEGILYTIDPTESTVALSKVKSFGTEDRPSERFISPRDEVYEYIIFRGSDIRDLHVCE----NSLYSEDSAIVKIMSPNFTNQP--PHVPLPP 409
            +LG KISLISKA IRYEGILYTID   STVAL+KV+SFGTEDRP++R   PR+E+YEYIIFRGSDI+D+ VCE         +D AIV+    + +  P  PHVP  P
Sbjct:    9 YLGSKISLISKAQIRYEGILYTIDTDNSTVALAKVRSFGTEDRPTDRPAPPREEIYEYIIFRGSDIKDITVCEPPKAQHTLPQDPAIVQSSLGSASASPFQPHVPYSP 116          
BLAST of Protein LSM14 homolog B-B vs. UniProt/SwissProt
Match: sp|Q498K9|L14BB_XENLA (Protein LSM14 homolog B-B OS=Xenopus laevis OX=8355 GN=lsm14b-b PE=1 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 2.554e-30
Identity = 64/106 (60.38%), Postives = 78/106 (73.58%), Query Frame = 2
Query:  104 FLGKKISLISKAGIRYEGILYTIDPTESTVALSKVKSFGTEDRPSERFISPRDEVYEYIIFRGSDIRDLHVCE----NSLYSEDSAIVKIMSPNFTNQPPHVPLPP 409
            ++G KISLISKA IRYEGILYTID   STVAL+KV+SFGTEDRP++R   PR+EVYEYIIFRGSDI+D+ VCE    +   S+D AIV+    +  +  P VP  P
Sbjct:    7 YIGSKISLISKAQIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPAPPREEVYEYIIFRGSDIKDITVCEPPKASHALSQDPAIVQSSLGSAASYQPSVPYSP 112          
BLAST of Protein LSM14 homolog B-B vs. UniProt/SwissProt
Match: sp|Q8ND56|LS14A_HUMAN (Protein LSM14 homolog A OS=Homo sapiens OX=9606 GN=LSM14A PE=1 SV=3)

HSP 1 Score: 123.25 bits (308), Expect = 3.487e-29
Identity = 61/89 (68.54%), Postives = 71/89 (79.78%), Query Frame = 2
Query:  104 FLGKKISLISKAGIRYEGILYTIDPTESTVALSKVKSFGTEDRPSERFISPRDEVYEYIIFRGSDIRDLHVCE----NSLYSEDSAIVK 358
            ++G KISLISKA IRYEGILYTID   STVAL+KV+SFGTEDRP++R I PRDEV+EYIIFRGSDI+DL VCE         +D AIV+
Sbjct:    7 YIGSKISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPIPPRDEVFEYIIFRGSDIKDLTVCEPPKPQCSLPQDPAIVQ 95          
BLAST of Protein LSM14 homolog B-B vs. UniProt/SwissProt
Match: sp|Q5R4R4|LS14A_PONAB (Protein LSM14 homolog A OS=Pongo abelii OX=9601 GN=LSM14A PE=2 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 3.555e-29
Identity = 61/89 (68.54%), Postives = 71/89 (79.78%), Query Frame = 2
Query:  104 FLGKKISLISKAGIRYEGILYTIDPTESTVALSKVKSFGTEDRPSERFISPRDEVYEYIIFRGSDIRDLHVCE----NSLYSEDSAIVK 358
            ++G KISLISKA IRYEGILYTID   STVAL+KV+SFGTEDRP++R I PRDEV+EYIIFRGSDI+DL VCE         +D AIV+
Sbjct:    7 YIGSKISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPIPPRDEVFEYIIFRGSDIKDLTVCEPPKPQCSLPQDPAIVQ 95          
BLAST of Protein LSM14 homolog B-B vs. TrEMBL
Match: D5JG80 (Sm-like protein LSM14 (Fragment) OS=Dugesia japonica OX=6161 GN=LSM-14 PE=2 SV=1)

HSP 1 Score: 270.011 bits (689), Expect = 1.039e-83
Identity = 202/296 (68.24%), Postives = 241/296 (81.42%), Query Frame = 2
Query:  461 SPSGFHSTPNQNDNRIINNHXXXXXXXXXXXXGHSENKPIQTPRTHDKSEL-QKDKDEKFDMDKIAANDYHNFLNRDQSFKYDTYIN-DEFRENSNYXXXXXXXXXXXMKNQDSRRGSQFSGSNGNVILNNNRGYRANKEVTIEPIKDDFDFESSNAILAEELANINVSNDDNNRVGNLSESKEPSDQNLADYVEEKLYYDKSKSFFDNIXXXXXXXXXXXXXXXXXXXXXXFGDSNYXXXXXXXXXXXXXXXXXXXYSRGSSAGFLRRGNYLNRGDMRGHGQVSGS-INKRLIPV 1339
            SP GFH+ PNQNDNRII N  L+SKS+DRDS   ++ KP+QT R  +  ++   +KD+ FDMDKIA NDYHNF+NR+ ++KYD+Y N DE++E +NY R G  +++  MK QDSRRGSQ++ S GN I +N R YRAN+EVT+EPIKDDFDFE+SNA+LAEELANINVSN++  RV  +S+SKE SD N++D  ++KLYYDKS+SFFDNISSE SER+NSERRNERR NTETFGDSNYNRN RGNRW NRRG FRGNYSRGSSAGFLRRGN  NRGDMRGHGQV GS  NKRLIP 
Sbjct:    1 SPLGFHTKPNQNDNRIIKNSSLNSKSIDRDSSSFADLKPLQTQRNQENLQMPNNEKDDSFDMDKIATNDYHNFMNREHNYKYDSYNNNDEYKEYANYPRRGSQRQRG-MKYQDSRRGSQYNAS-GNGIPSN-RAYRANREVTVEPIKDDFDFETSNALLAEELANINVSNEE-TRVKTVSDSKELSDPNISDCGDDKLYYDKSRSFFDNISSEMSERSNSERRNERRINTETFGDSNYNRNTRGNRWVNRRGQFRGNYSRGSSAGFLRRGNNFNRGDMRGHGQVGGSNNNKRLIPA 292          
BLAST of Protein LSM14 homolog B-B vs. TrEMBL
Match: K1RIG6 (LSM14-like protein A OS=Crassostrea gigas OX=29159 GN=CGI_10025647 PE=4 SV=1)

HSP 1 Score: 144.05 bits (362), Expect = 3.222e-33
Identity = 79/146 (54.11%), Postives = 99/146 (67.81%), Query Frame = 2
Query:  104 FLGKKISLISKAGIRYEGILYTIDPTESTVALSKVKSFGTEDRPSERFISPRDEVYEYIIFRGSDIRDLHVCE--------NSLYSEDSAIVKIMSP---NFTNQPPHVPLPPHGIDVGVPDIHPQ-NQERSPSGFHSTPNQNDNR 505
            +LG KISLISKAGIRYEGILYTIDP ESTVAL+KV+SFGTEDRP++R ++PRDE++EYIIFRGSDI+DLHVCE        +S+  +D AIVK   P    F  Q     +       G P ++ Q  Q  +P  F + PNQ+ +R
Sbjct:    7 YLGSKISLISKAGIRYEGILYTIDPNESTVALAKVRSFGTEDRPTDRPVAPRDEIFEYIIFRGSDIKDLHVCEPPKAQSLQSSMPPQDPAIVKSSQPTSSGFHQQGGGGYIGSSYQPFGGPQLYSQYGQGAAPQPFGAIPNQSGSR 152          
BLAST of Protein LSM14 homolog B-B vs. TrEMBL
Match: V3ZYH6 (LSM14 domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_143948 PE=4 SV=1)

HSP 1 Score: 128.642 bits (322), Expect = 3.510e-32
Identity = 64/92 (69.57%), Postives = 77/92 (83.70%), Query Frame = 2
Query:  104 FLGKKISLISKAGIRYEGILYTIDPTESTVALSKVKSFGTEDRPSERFISPRDEVYEYIIFRGSDIRDLHVCE----NSLYS--EDSAIVKI 361
            +LG KISLISKA IRYEGILYTIDP ESTVAL+KV+SFGTEDRP++R + PR+E++EYIIFRGSDI+DLHVCE     S++    D AIVK+
Sbjct:    7 YLGSKISLISKAEIRYEGILYTIDPNESTVALAKVRSFGTEDRPTDRPVPPREEIFEYIIFRGSDIKDLHVCEPPKQQSIHGLPADPAIVKV 98          
BLAST of Protein LSM14 homolog B-B vs. TrEMBL
Match: A0A1S3JKZ8 (protein LSM14 homolog B isoform X1 OS=Lingula unguis OX=7574 GN=LOC106173995 PE=4 SV=1)

HSP 1 Score: 138.272 bits (347), Expect = 5.813e-32
Identity = 67/98 (68.37%), Postives = 76/98 (77.55%), Query Frame = 2
Query:  104 FLGKKISLISKAGIRYEGILYTIDPTESTVALSKVKSFGTEDRPSERFISPRDEVYEYIIFRGSDIRDLHVCE---------NSLYSEDSAIVKIMSP 370
            +LG KISLISKAGIRYEGILYTIDP ESTVAL+KV SFGTEDRP++R + PRDE++EYIIFRGSDI+DLHVCE          S   +D AIVK   P
Sbjct:    7 YLGSKISLISKAGIRYEGILYTIDPNESTVALAKVCSFGTEDRPTDRPVCPRDEIFEYIIFRGSDIKDLHVCEPPKPQRNVAQSAVPQDPAIVKSSQP 104          
BLAST of Protein LSM14 homolog B-B vs. TrEMBL
Match: A0A1S3JKA9 (protein LSM14 homolog B isoform X2 OS=Lingula unguis OX=7574 GN=LOC106173995 PE=4 SV=1)

HSP 1 Score: 137.502 bits (345), Expect = 5.976e-32
Identity = 67/98 (68.37%), Postives = 76/98 (77.55%), Query Frame = 2
Query:  104 FLGKKISLISKAGIRYEGILYTIDPTESTVALSKVKSFGTEDRPSERFISPRDEVYEYIIFRGSDIRDLHVCE---------NSLYSEDSAIVKIMSP 370
            +LG KISLISKAGIRYEGILYTIDP ESTVAL+KV SFGTEDRP++R + PRDE++EYIIFRGSDI+DLHVCE          S   +D AIVK   P
Sbjct:    7 YLGSKISLISKAGIRYEGILYTIDPNESTVALAKVCSFGTEDRPTDRPVCPRDEIFEYIIFRGSDIKDLHVCEPPKPQRNVAQSAVPQDPAIVKSSQP 104          
BLAST of Protein LSM14 homolog B-B vs. Ensembl Cavefish
Match: lsm14ab (LSM14A mRNA processing body assembly factor [Source:NCBI gene;Acc:103042286])

HSP 1 Score: 125.176 bits (313), Expect = 1.179e-30
Identity = 60/89 (67.42%), Postives = 73/89 (82.02%), Query Frame = 2
Query:  104 FLGKKISLISKAGIRYEGILYTIDPTESTVALSKVKSFGTEDRPSERFISPRDEVYEYIIFRGSDIRDLHVCE----NSLYSEDSAIVK 358
            ++G KISLISKA IRYEG+LYTID   STVAL+KVKSFGTEDRP++R ++PRD+V+EYIIFRGSDI+DL VCE    N    +D AIV+
Sbjct:    7 YIGSKISLISKAEIRYEGVLYTIDTENSTVALAKVKSFGTEDRPTDRPVAPRDDVFEYIIFRGSDIKDLTVCEPPKPNCSLPQDPAIVQ 95          
BLAST of Protein LSM14 homolog B-B vs. Ensembl Cavefish
Match: lsm14ab (LSM14A mRNA processing body assembly factor [Source:NCBI gene;Acc:103042286])

HSP 1 Score: 124.405 bits (311), Expect = 1.441e-30
Identity = 60/89 (67.42%), Postives = 73/89 (82.02%), Query Frame = 2
Query:  104 FLGKKISLISKAGIRYEGILYTIDPTESTVALSKVKSFGTEDRPSERFISPRDEVYEYIIFRGSDIRDLHVCE----NSLYSEDSAIVK 358
            ++G KISLISKA IRYEG+LYTID   STVAL+KVKSFGTEDRP++R ++PRD+V+EYIIFRGSDI+DL VCE    N    +D AIV+
Sbjct:    7 YIGSKISLISKAEIRYEGVLYTIDTENSTVALAKVKSFGTEDRPTDRPVAPRDDVFEYIIFRGSDIKDLTVCEPPKPNCSLPQDPAIVQ 95          
BLAST of Protein LSM14 homolog B-B vs. Ensembl Cavefish
Match: lsm14ab (LSM14A mRNA processing body assembly factor [Source:NCBI gene;Acc:103042286])

HSP 1 Score: 124.405 bits (311), Expect = 1.882e-30
Identity = 60/89 (67.42%), Postives = 73/89 (82.02%), Query Frame = 2
Query:  104 FLGKKISLISKAGIRYEGILYTIDPTESTVALSKVKSFGTEDRPSERFISPRDEVYEYIIFRGSDIRDLHVCE----NSLYSEDSAIVK 358
            ++G KISLISKA IRYEG+LYTID   STVAL+KVKSFGTEDRP++R ++PRD+V+EYIIFRGSDI+DL VCE    N    +D AIV+
Sbjct:    7 YIGSKISLISKAEIRYEGVLYTIDTENSTVALAKVKSFGTEDRPTDRPVAPRDDVFEYIIFRGSDIKDLTVCEPPKPNCSLPQDPAIVQ 95          
BLAST of Protein LSM14 homolog B-B vs. Ensembl Cavefish
Match: lsm14aa (protein LSM14 homolog A-like [Source:NCBI gene;Acc:103031607])

HSP 1 Score: 122.479 bits (306), Expect = 5.814e-30
Identity = 61/87 (70.11%), Postives = 70/87 (80.46%), Query Frame = 2
Query:  104 FLGKKISLISKAGIRYEGILYTIDPTESTVALSKVKSFGTEDRPSERFISPRDEVYEYIIFRGSDIRDLHVCE--NSLYSEDSAIVK 358
            ++G KISLISKA IRYEGILYTID   STVAL+KV+SFGTEDRP++R I PRDE YEYIIFRGSDI+DL VCE       +D AIV+
Sbjct:    7 YIGSKISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPILPRDETYEYIIFRGSDIKDLTVCEPPKPTLPQDPAIVQ 93          
BLAST of Protein LSM14 homolog B-B vs. Ensembl Cavefish
Match: lsm14aa (protein LSM14 homolog A-like [Source:NCBI gene;Acc:103031607])

HSP 1 Score: 122.094 bits (305), Expect = 9.174e-30
Identity = 61/87 (70.11%), Postives = 70/87 (80.46%), Query Frame = 2
Query:  104 FLGKKISLISKAGIRYEGILYTIDPTESTVALSKVKSFGTEDRPSERFISPRDEVYEYIIFRGSDIRDLHVCE--NSLYSEDSAIVK 358
            ++G KISLISKA IRYEGILYTID   STVAL+KV+SFGTEDRP++R I PRDE YEYIIFRGSDI+DL VCE       +D AIV+
Sbjct:    7 YIGSKISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPILPRDETYEYIIFRGSDIKDLTVCEPPKPTLPQDPAIVQ 93          
BLAST of Protein LSM14 homolog B-B vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005960.1 (pep scaffold:Pmarinus_7.0:GL480662:10110:19118:-1 gene:ENSPMAG00000005377.1 transcript:ENSPMAT00000005960.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 117.087 bits (292), Expect = 1.170e-28
Identity = 62/114 (54.39%), Postives = 82/114 (71.93%), Query Frame = 2
Query:  104 FLGKKISLISKAGIRYEGILYTIDPTESTVALSKVKSFGTEDRPSERFISPRDEVYEYIIFRGSDIRDLHVCE---NSLYSEDSAIVK----IMSPNFTNQPPHVP---LPPHG 415
            ++G KISLISKA IRYEGILYTID   STVAL+KV+SFGTEDRP+ER ++PRDE++EYI+FRGSDI+D+ V E        +D AIV+     ++P F +   + P   + P+G
Sbjct:    7 YIGSKISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRPTERPVAPRDEIFEYIVFRGSDIKDITVREPPKPQRTPQDPAIVQSSLGSVAPRFQSSSSYGPFSGMAPYG 120          
BLAST of Protein LSM14 homolog B-B vs. Ensembl Yeast
Match: SCD6 (Repressor of translation initiation; binds eIF4G through its RGG domain and inhibits recruitment of the preinitiation complex; also contains an Lsm domain; may have a role in RNA processing; overproduction suppresses null mutation in clathrin heavy chain gene CHC1; forms cytoplasmic foci upon DNA replication stress [Source:SGD;Acc:S000006333])

HSP 1 Score: 65.4698 bits (158), Expect = 4.482e-12
Identity = 36/96 (37.50%), Postives = 54/96 (56.25%), Query Frame = 2
Query:   95 MANFLGKKISLISKAGIRYEGILYTIDPTESTVALSKVKSFGTEDR----PSERFISPRDEVYEYIIFRGSDIRDLHVCENSLYSEDSAIVKIMSP 370
            M+ ++GK ISLIS    RY G+L  ID  + TV L +V+ FGTE R    P E  I P   VY  + F GS+++DL + + ++      + ++M P
Sbjct:    1 MSQYIGKTISLISVTDNRYVGLLEDIDSEKGTVTLKEVRCFGTEGRKNWGPEE--IYPNPTVYNSVKFNGSEVKDLSILDANINDIQPVVPQMMPP 94          
BLAST of Protein LSM14 homolog B-B vs. Ensembl Nematostella
Match: EDO49317 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHB0])

HSP 1 Score: 88.1965 bits (217), Expect = 1.401e-21
Identity = 42/71 (59.15%), Postives = 54/71 (76.06%), Query Frame = 2
Query:  104 FLGKKISLISKAGIRYEGILYTIDPTESTVALSKVKSFGTEDRPSERFISPRDEVYEYIIFRGSDIRDLHV 316
            ++G  I+L+SKA IRY G LY ID  ESTV L+ V+SFGTE R  +  I PR+E+YEYI+FRG DI+DL+V
Sbjct:    7 YIGSIINLVSKAEIRYVGTLYAIDTKESTVTLANVRSFGTEGRKVDVEIPPRNEIYEYIVFRGQDIKDLNV 77          
BLAST of Protein LSM14 homolog B-B vs. Ensembl Medaka
Match: ENSORLT00000039753.1 (pep primary_assembly:ASM223467v1:3:30569759:30570647:-1 gene:ENSORLG00000028980.1 transcript:ENSORLT00000039753.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 122.094 bits (305), Expect = 6.792e-33
Identity = 61/90 (67.78%), Postives = 73/90 (81.11%), Query Frame = 2
Query:  104 FLGKKISLISKAGIRYEGILYTIDPTESTVALSKVKSFGTEDRPSERFISPRDEVYEYIIFRGSDIRDLHVCE----NSLYSEDSAIVKI 361
            ++G KISLISKA IRYEGILYTID   STVAL+KV+SFGTEDRP++R I PR+EV+EYIIFRGSDI+DL VCE     S   +D AIV++
Sbjct:    8 YIGSKISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPIPPREEVFEYIIFRGSDIKDLTVCEPPKATSSLPQDPAIVQV 97          
BLAST of Protein LSM14 homolog B-B vs. Ensembl Medaka
Match: LSM14B (protein LSM14 homolog A [Source:NCBI gene;Acc:101155350])

HSP 1 Score: 123.635 bits (309), Expect = 7.991e-31
Identity = 112/342 (32.75%), Postives = 156/342 (45.61%), Query Frame = 2
Query:  104 FLGKKISLISKAGIRYEGILYTIDPTESTVALSKVKSFGTEDRPSERFISPRDEVYEYIIFRGSDIRDLHVCENSLY-----SEDSAIVKIMSPNFTNQPPHV-PLPPHGIDVGVPDIHPQ---NQERSPSGFHSTPNQNDNRIINNHXXXXXXXXXXXXGHSENKPIQTPRTHDKSE---LQKDKDEKFDMDKIAANDYHNFLNRDQSFKYDTYINDEFRENSNYXXXXXXXXXXXMKNQ--DSRRGSQFSGSNGNVILNNNRGYRANKEVTIEPIKDDFDFESSNA-ILAEELANINVSNDDNNRVGNLSESKEPSDQNLADYVEEKLYYDKSKSFFDNI 1084
            ++G KI LISKA  RYEGILYTID   STV L+KVK FGTE RP++R + P++EVYEYI FRGSDI D+ +CE + Y       D AI+   S   +N    + PL P  + V  P +      +Q  S  G    P   D  I                G    K +QT +         L   +++++D  ++    Y  + NR         ++   R    +        ++ ++N+   SRR      S+G   L  N     +    +     DFDFESSNA  + EE+   N+S  D N   + +  +        D    K YYDKSKSFFDNI
Sbjct:    7 YIGCKIGLISKAQNRYEGILYTIDKINSTVVLAKVKCFGTEGRPADRPLPPKNEVYEYITFRGSDIMDIGLCEPAAYHHSSLPSDPAIIHSSSAIPSNVSSMLGPLSPMKMPVSNPLVASSLLNHQYASAIG----PLLQDMHI--------------RRGPMVEKAVQTMQMESSRPVRGLAPSQEQQWDRRQLQRPRYETYQNRRD-------VDVRMRSGPAFTTSRQESLRQNIENRPPPSRRQGTRRRSHGRGQLMMN-----SIPSPVLKFDTDFDFESSNAQFIKEEMERKNMSIKDGNYELDRNAKEGMHLTTEEDPCGPKRYYDKSKSFFDNI 318          
BLAST of Protein LSM14 homolog B-B vs. Ensembl Medaka
Match: lsm14b (protein LSM14 homolog B-B [Source:NCBI gene;Acc:101155509])

HSP 1 Score: 106.301 bits (264), Expect = 8.600e-25
Identity = 49/73 (67.12%), Postives = 62/73 (84.93%), Query Frame = 2
Query:  104 FLGKKISLISKAGIRYEGILYTIDPTESTVALSKVKSFGTEDRPSERFISPRDEVYEYIIFRGSDIRDLHVCE 322
            ++G KISLISKA IRYEGIL ++D   STVAL+KVKS+GTEDR ++R + P+DE+YEYIIFRGSDI+D+ V E
Sbjct:    9 YIGSKISLISKAQIRYEGILSSVDTERSTVALAKVKSYGTEDRHTDRPVPPKDEIYEYIIFRGSDIKDITVSE 81          
BLAST of Protein LSM14 homolog B-B vs. Planmine SMEST
Match: SMESG000033950.1 (SMESG000033950.1)

HSP 1 Score: 712.605 bits (1838), Expect = 0.000e+0
Identity = 424/425 (99.76%), Postives = 424/425 (99.76%), Query Frame = 2
Query:   95 MANFLGKKISLISKAGIRYEGILYTIDPTESTVALSKVKSFGTEDRPSERFISPRDEVYEYIIFRGSDIRDLHVCENSLYSEDSAIVKIMSPNFTNQPPHVPLPPHGIDVGVPDIHPQNQERSPSGFHSTPNQNDNRIINNHXXXXXXXXXXXXGHSENKPIQTPRTHDKSELQKDKDEKFDMDKIAANDYHNFLNRDQSFKYDTYINDEFRENSNYXXXXXXXXXXXMKNQDSRRGSQFSGSNGNVILNNNRGYRANKEVTIEPIKDDFDFESSNAILAEELANINVSNDDNNRVGNLSESKEPSDQNLADYVEEKLYYDKSKSFFDNIXXXXXXXXXXXXXXXXXXXXXXFGDSNYXXXXXXXXXXXXXXXXXXXYSRGSSAGFLRRGNYLNRGDMRGHGQVSGSINKRLIPVGGNRGNMNEN 1369
            MANFLGKKISLISKAGIRYEGILYTIDPTESTVALSKVKSFGTEDRPSERFISPRDEVYEYIIFRGSDIRDLHVCENSLYSEDSAIVKIMSPNFTNQPPHVPLP HGIDVGVPDIHPQNQERSPSGFHSTPNQNDNRIINNHLLSSKSLDRDSLGHSENKPIQTPRTHDKSELQKDKDEKFDMDKIAANDYHNFLNRDQSFKYDTYINDEFRENSNYRRGGGGQRQRGMKNQDSRRGSQFSGSNGNVILNNNRGYRANKEVTIEPIKDDFDFESSNAILAEELANINVSNDDNNRVGNLSESKEPSDQNLADYVEEKLYYDKSKSFFDNISSETSERTNSERRNERRSNTETFGDSNYNRNNRGNRWGNRRGHFRGNYSRGSSAGFLRRGNYLNRGDMRGHGQVSGSINKRLIPVGGNRGNMNEN
Sbjct:    1 MANFLGKKISLISKAGIRYEGILYTIDPTESTVALSKVKSFGTEDRPSERFISPRDEVYEYIIFRGSDIRDLHVCENSLYSEDSAIVKIMSPNFTNQPPHVPLPQHGIDVGVPDIHPQNQERSPSGFHSTPNQNDNRIINNHLLSSKSLDRDSLGHSENKPIQTPRTHDKSELQKDKDEKFDMDKIAANDYHNFLNRDQSFKYDTYINDEFRENSNYRRGGGGQRQRGMKNQDSRRGSQFSGSNGNVILNNNRGYRANKEVTIEPIKDDFDFESSNAILAEELANINVSNDDNNRVGNLSESKEPSDQNLADYVEEKLYYDKSKSFFDNISSETSERTNSERRNERRSNTETFGDSNYNRNNRGNRWGNRRGHFRGNYSRGSSAGFLRRGNYLNRGDMRGHGQVSGSINKRLIPVGGNRGNMNEN 425          
BLAST of Protein LSM14 homolog B-B vs. Planmine SMEST
Match: SMESG000014632.1 (SMESG000014632.1)

HSP 1 Score: 151.754 bits (382), Expect = 2.776e-40
Identity = 80/118 (67.80%), Postives = 90/118 (76.27%), Query Frame = 2
Query:   95 MANFLGKKISLISKAGIRYEGILYTIDPTESTVALSKVKSFGTEDRPSERFISPRDEVYEYIIFRGSDIRDLHVC----ENSLYSEDSAIVKIMSPNFTNQPPHV-PLPPHGIDVGVP 433
            M++F+G KISLISKAGIRYEGILYTIDP ESTVALSKVKSFGTEDR  +R I PRDE+YEYIIFRGSDI+DL+VC    E+SL SEDSAIV+  +    N PP V     H ID   P
Sbjct:    1 MSSFIGCKISLISKAGIRYEGILYTIDPRESTVALSKVKSFGTEDRKMDRVIPPRDEIYEYIIFRGSDIQDLNVCEPSKESSLLSEDSAIVRAETSISGNLPPGVMSSGMHHIDNAWP 118          

HSP 2 Score: 53.1434 bits (126), Expect = 3.532e-7
Identity = 31/67 (46.27%), Postives = 45/67 (67.16%), Query Frame = 2
Query:  884 EPIKDDFDFESSNAILAEELANINVSNDDNNRVGNLSESKEPSDQNLADYVEEKLYYDKSKSFFDNI 1084
            E  K+D+DFE++NAI+A+ELA ++VS +  +   +  E +   D  L+D   E  YYDK+KSFFDNI
Sbjct:  325 ESFKEDYDFETANAIIAKELAALHVSQEKKDVKDDECEKE---DGQLSD-NSEAGYYDKTKSFFDNI 387          
BLAST of Protein LSM14 homolog B-B vs. Planmine SMEST
Match: SMESG000020999.1 (SMESG000020999.1)

HSP 1 Score: 131.724 bits (330), Expect = 5.448e-33
Identity = 67/101 (66.34%), Postives = 78/101 (77.23%), Query Frame = 2
Query:  104 FLGKKISLISKAGIRYEGILYTIDPTESTVALSKVKSFGTEDRPSERFISPRDEVYEYIIFRGSDIRDLHVCEN-----SLYSEDSAIVKIMSPNFTNQPP 391
            FLG KISLIS+AGIRYEGILYTID   STVALSKVKSFGTEDR +E  + PRDE+YEYIIFRGSDI+DLHVCE       + ++D AI++I     T +PP
Sbjct:    6 FLGCKISLISRAGIRYEGILYTIDANNSTVALSKVKSFGTEDRYAETPVPPRDEIYEYIIFRGSDIQDLHVCEAPKKHPQIMAQDPAILEI-----TGKPP 101          
BLAST of Protein LSM14 homolog B-B vs. Planmine SMEST
Match: SMESG000020999.1 (SMESG000020999.1)

HSP 1 Score: 131.724 bits (330), Expect = 1.458e-32
Identity = 67/101 (66.34%), Postives = 78/101 (77.23%), Query Frame = 2
Query:  104 FLGKKISLISKAGIRYEGILYTIDPTESTVALSKVKSFGTEDRPSERFISPRDEVYEYIIFRGSDIRDLHVCEN-----SLYSEDSAIVKIMSPNFTNQPP 391
            FLG KISLIS+AGIRYEGILYTID   STVALSKVKSFGTEDR +E  + PRDE+YEYIIFRGSDI+DLHVCE       + ++D AI++I     T +PP
Sbjct:  151 FLGCKISLISRAGIRYEGILYTIDANNSTVALSKVKSFGTEDRYAETPVPPRDEIYEYIIFRGSDIQDLHVCEAPKKHPQIMAQDPAILEI-----TGKPP 246          
The following BLAST results are available for this feature:
BLAST of Protein LSM14 homolog B-B vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LSM14B1.930e-3260.19LSM family member 14B [Source:HGNC Symbol;Acc:HGNC... [more]
LSM14A2.191e-3268.54LSM14A mRNA processing body assembly factor [Sourc... [more]
LSM14A2.191e-3268.54LSM14A mRNA processing body assembly factor [Sourc... [more]
LSM14B5.211e-3260.19LSM family member 14B [Source:HGNC Symbol;Acc:HGNC... [more]
LSM14B2.784e-3160.19LSM family member 14B [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of Protein LSM14 homolog B-B vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
car-13.587e-2536.41Cytokinesis, Apoptosis, RNA-associated [Source:Un... [more]
back to top
BLAST of Protein LSM14 homolog B-B vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tral9.257e-2654.37gene:FBgn0041775 transcript:FBtr0332640[more]
tral9.577e-2654.37gene:FBgn0041775 transcript:FBtr0332638[more]
tral1.027e-2554.37gene:FBgn0041775 transcript:FBtr0332635[more]
tral1.027e-2554.37gene:FBgn0041775 transcript:FBtr0075959[more]
tral1.034e-2554.37gene:FBgn0041775 transcript:FBtr0332642[more]
back to top
BLAST of Protein LSM14 homolog B-B vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lsm14aa2.733e-3167.42LSM14A mRNA processing body assembly factor a [Sou... [more]
lsm14aa1.085e-3076.71LSM14A mRNA processing body assembly factor a [Sou... [more]
lsm14aa1.183e-2967.42LSM14A mRNA processing body assembly factor a [Sou... [more]
lsm14ab1.616e-2967.42LSM14A mRNA processing body assembly factor b [Sou... [more]
lsm14ab1.884e-2967.42LSM14A mRNA processing body assembly factor b [Sou... [more]
back to top
BLAST of Protein LSM14 homolog B-B vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rps155.701e-3068.54ribosomal protein S15 [Source:Xenbase;Acc:XB-GENE-... [more]
lsm14b8.940e-3065.93LSM family member 14B [Source:NCBI gene;Acc:595068... [more]
rps151.296e-2968.54ribosomal protein S15 [Source:Xenbase;Acc:XB-GENE-... [more]
lsm14b1.573e-2967.42LSM family member 14B [Source:NCBI gene;Acc:595068... [more]
lsm14b1.735e-2967.42LSM family member 14B [Source:NCBI gene;Acc:595068... [more]
back to top
BLAST of Protein LSM14 homolog B-B vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Lsm14b2.233e-3251.75LSM family member 14B [Source:MGI Symbol;Acc:MGI:3... [more]
Lsm14a9.753e-3178.08LSM14A mRNA processing body assembly factor [Sourc... [more]
Lsm14a1.863e-2978.08LSM14A mRNA processing body assembly factor [Sourc... [more]
Lsm14a5.344e-1580.00LSM14A mRNA processing body assembly factor [Sourc... [more]
back to top
BLAST of Protein LSM14 homolog B-B vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8CGC4|LS14B_MOUSE1.562e-3151.75Protein LSM14 homolog B OS=Mus musculus OX=10090 G... [more]
sp|Q9BX40|LS14B_HUMAN1.337e-3060.19Protein LSM14 homolog B OS=Homo sapiens OX=9606 GN... [more]
sp|Q498K9|L14BB_XENLA2.554e-3060.38Protein LSM14 homolog B-B OS=Xenopus laevis OX=835... [more]
sp|Q8ND56|LS14A_HUMAN3.487e-2968.54Protein LSM14 homolog A OS=Homo sapiens OX=9606 GN... [more]
sp|Q5R4R4|LS14A_PONAB3.555e-2968.54Protein LSM14 homolog A OS=Pongo abelii OX=9601 GN... [more]
back to top
BLAST of Protein LSM14 homolog B-B vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
D5JG801.039e-8368.24Sm-like protein LSM14 (Fragment) OS=Dugesia japoni... [more]
K1RIG63.222e-3354.11LSM14-like protein A OS=Crassostrea gigas OX=29159... [more]
V3ZYH63.510e-3269.57LSM14 domain-containing protein OS=Lottia gigantea... [more]
A0A1S3JKZ85.813e-3268.37protein LSM14 homolog B isoform X1 OS=Lingula ungu... [more]
A0A1S3JKA95.976e-3268.37protein LSM14 homolog B isoform X2 OS=Lingula ungu... [more]
back to top
BLAST of Protein LSM14 homolog B-B vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lsm14ab1.179e-3067.42LSM14A mRNA processing body assembly factor [Sourc... [more]
lsm14ab1.441e-3067.42LSM14A mRNA processing body assembly factor [Sourc... [more]
lsm14ab1.882e-3067.42LSM14A mRNA processing body assembly factor [Sourc... [more]
lsm14aa5.814e-3070.11protein LSM14 homolog A-like [Source:NCBI gene;Acc... [more]
lsm14aa9.174e-3070.11protein LSM14 homolog A-like [Source:NCBI gene;Acc... [more]
back to top
BLAST of Protein LSM14 homolog B-B vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000005960.11.170e-2854.39pep scaffold:Pmarinus_7.0:GL480662:10110:19118:-1 ... [more]
back to top
BLAST of Protein LSM14 homolog B-B vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
SCD64.482e-1237.50Repressor of translation initiation; binds eIF4G t... [more]
back to top
BLAST of Protein LSM14 homolog B-B vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO493171.401e-2159.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein LSM14 homolog B-B vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSORLT00000039753.16.792e-3367.78pep primary_assembly:ASM223467v1:3:30569759:305706... [more]
LSM14B7.991e-3132.75protein LSM14 homolog A [Source:NCBI gene;Acc:1011... [more]
lsm14b8.600e-2567.12protein LSM14 homolog B-B [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Protein LSM14 homolog B-B vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000033950.10.000e+099.76SMESG000033950.1[more]
SMESG000014632.12.776e-4067.80SMESG000014632.1[more]
SMESG000020999.15.448e-3366.34SMESG000020999.1[more]
SMESG000020999.11.458e-3266.34SMESG000020999.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024374 ID=SMED30024374|Name=Protein LSM14 homolog B-B|organism=Schmidtea mediterranea sexual|type=transcript|length=1465bp
TTTTGTATAACTGATTTTAAAGATGATTTTTGTTTAAAATATAGCTTTGT
TATGATATCTTTTAAGTGACAGTTAAAATTTTAGAATATTTTTCATGGCT
AATTTTCTTGGAAAAAAGATTAGCCTTATTTCTAAAGCCGGTATCCGTTA
TGAAGGAATTCTTTATACAATTGACCCCACTGAGTCTACAGTTGCTCTAT
CTAAAGTTAAATCATTTGGAACCGAGGACAGACCTTCTGAAAGATTTATT
TCTCCTAGAGATGAAGTTTATGAATATATAATATTTAGGGGAAGCGATAT
AAGAGATTTACATGTTTGTGAAAATAGTCTGTATTCTGAAGACTCTGCCA
TTGTAAAAATAATGTCACCTAATTTCACCAATCAGCCTCCTCATGTTCCA
CTCCCCCCACACGGAATTGACGTTGGTGTACCCGATATTCATCCACAAAA
CCAGGAGAGATCCCCATCGGGATTCCATTCTACGCCAAATCAGAATGATA
ACCGAATAATAAACAACCACTTATTGAGTTCTAAATCGTTAGATCGCGAC
TCATTGGGTCATTCGGAAAATAAACCCATTCAAACTCCTAGGACTCATGA
TAAATCGGAATTGCAAAAGGATAAAGATGAAAAATTCGATATGGATAAAA
TTGCAGCAAATGATTATCATAATTTTTTGAATCGCGATCAATCCTTTAAA
TATGACACTTATATCAACGATGAATTTCGGGAAAACTCCAATTATCGACG
AGGAGGCGGTGGTCAAAGGCAACGAGGAATGAAAAACCAAGATTCCAGGC
GCGGCTCACAGTTCAGTGGCAGTAATGGAAATGTAATACTCAATAATAAT
AGAGGATATCGAGCCAATAAAGAAGTCACAATCGAACCCATTAAAGATGA
CTTCGACTTTGAATCTTCAAATGCTATTCTAGCTGAAGAATTGGCAAATA
TAAACGTGTCGAATGATGACAATAATCGTGTGGGGAACCTTTCGGAATCC
AAGGAACCGTCCGATCAAAATTTGGCTGATTATGTAGAAGAGAAATTGTA
CTATGACAAATCAAAATCCTTCTTTGATAATATCAGTTCAGAAACATCTG
AACGAACAAACAGTGAAAGAAGGAACGAAAGAAGGAGCAATACTGAAACA
TTTGGTGATTCAAATTACAATAGAAATAATCGTGGAAATCGCTGGGGAAA
TCGGAGGGGCCATTTTCGTGGAAATTACAGTCGCGGTAGTTCTGCAGGTT
TTTTGAGACGAGGGAACTATCTAAATCGAGGAGACATGCGAGGTCATGGT
CAGGTAAGTGGTTCCATTAATAAGCGTCTTATACCCGTTGGAGGAAATAG
AGGAAATATGAATGAGAATTAATATCGTTTTATGAAGCTGATTAATATAT
GTCGTTTGCTTTATTTGTTCAATTTGGCTTTTATTGAATTAGATTCGTCT
TGTTTTTTAAAAAAA
back to top

protein sequence of SMED30024374-orf-1

>SMED30024374-orf-1 ID=SMED30024374-orf-1|Name=SMED30024374-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=426bp
MANFLGKKISLISKAGIRYEGILYTIDPTESTVALSKVKSFGTEDRPSER
FISPRDEVYEYIIFRGSDIRDLHVCENSLYSEDSAIVKIMSPNFTNQPPH
VPLPPHGIDVGVPDIHPQNQERSPSGFHSTPNQNDNRIINNHLLSSKSLD
RDSLGHSENKPIQTPRTHDKSELQKDKDEKFDMDKIAANDYHNFLNRDQS
FKYDTYINDEFRENSNYRRGGGGQRQRGMKNQDSRRGSQFSGSNGNVILN
NNRGYRANKEVTIEPIKDDFDFESSNAILAEELANINVSNDDNNRVGNLS
ESKEPSDQNLADYVEEKLYYDKSKSFFDNISSETSERTNSERRNERRSNT
ETFGDSNYNRNNRGNRWGNRRGHFRGNYSRGSSAGFLRRGNYLNRGDMRG
HGQVSGSINKRLIPVGGNRGNMNEN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:1990904ribonucleoprotein complex
GO:0005575cellular_component
GO:0030529intracellular ribonucleoprotein complex
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000034epidermis
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR025609Lsm14-like_N
IPR019050FDF_dom
IPR025761FFD_box
IPR025762DFDF
IPR010920LSM_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
Vocabulary: biological process
TermDefinition
GO:0006417regulation of translation
GO:0007275multicellular organism development
GO:0008150biological_process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR019050FDF domainSMARTSM01199FDF_2coord: 264..357
e-value: 6.6E-12
score: 55.6
IPR019050FDF domainPFAMPF09532FDFcoord: 268..355
e-value: 1.8E-7
score: 32.0
IPR025609Lsm14-like, N-terminalSMARTSM01271LSM14_2coord: 1..91
e-value: 5.5E-43
score: 158.8
IPR025609Lsm14-like, N-terminalPFAMPF12701LSM14coord: 3..77
e-value: 1.7E-30
score: 104.9
IPR025609Lsm14-like, N-terminalCDDcd01736LSm14_Ncoord: 1..74
e-value: 1.37644E-35
score: 123.852
NoneNo IPR availableGENE3DG3DSA:2.30.30.100coord: 1..80
e-value: 3.5E-35
score: 121.6
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 351..365
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 331..374
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 214..244
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 150..178
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 335..350
NoneNo IPR availablePANTHERPTHR13586SCD6 PROTEIN-RELATEDcoord: 1..396
NoneNo IPR availablePANTHERPTHR13586:SF0TRAILER HITCH, ISOFORM Hcoord: 1..396
IPR025761FFD boxPROSITEPS51513FFDcoord: 318..334
score: 15.273
IPR025762DFDF domainPROSITEPS51512DFDFcoord: 258..294
score: 8.543
IPR010920LSM domain superfamilySUPERFAMILYSSF50182Sm-like ribonucleoproteinscoord: 4..79