chromodomain helicase DNA-binding protein 4

Overview
Namechromodomain helicase DNA-binding protein 4 (ADE34162.1)
Smed IDSMED30024368
Length (bp)7237
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of chromodomain helicase DNA-binding protein 4 (SMED30024368) t-SNE clustered cells

Violin plots show distribution of expression levels for chromodomain helicase DNA-binding protein 4 (SMED30024368) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of chromodomain helicase DNA-binding protein 4 (SMED30024368) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for chromodomain helicase DNA-binding protein 4 (SMED30024368) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024368

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 32

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30024368SMESG000068192.1 SmedASXL_015138SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30024368SMESG000068192.1 SmedASXL_015138SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30024368SMESG000068192.1 dd_Smed_v4_2659_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30024368SMESG000068192.1 dd_Smed_v4_2659_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30024368SMESG000068192.1 dd_Smed_v4_2659_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30024368SMESG000068192.1 dd_Smed_v4_2659_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30024368SMESG000068193.1 dd_Smed_v4_18178_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30024368SMESG000068192.1 dd_Smed_v4_2331_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30024368SMESG000068192.1 dd_Smed_v4_2331_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30024368SMESG000068192.1 dd_Smed_v4_2331_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30024368SMESG000068192.1 dd_Smed_v4_2331_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30024368SMESG000068192.1 dd_Smed_v4_2331_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30024368SMESG000068192.1 dd_Smed_v4_2331_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30024368SMESG000068192.1 dd_Smed_v4_2331_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30024368SMESG000068192.1 dd_Smed_v4_2331_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30024368SMESG000068192.1 dd_Smed_v4_2331_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30024368SMESG000068192.1 dd_Smed_v4_2331_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30024368SMESG000068192.1 dd_Smed_v4_2331_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30024368SMESG000062945.1 SMESG000026061.1 SMESG000023942.1 SMESG000023421.1 SMESG000016382.1 SMESG000068192.1 Contig34095uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30024368SMESG000062945.1 SMESG000026061.1 SMESG000023942.1 SMESG000023421.1 SMESG000016382.1 SMESG000068192.1 Contig34095newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30024368SMESG000068192.1 Contig39949newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30024368SMESG000068192.1 Contig39949uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30024368SMESG000068192.1 GU980571.1smed_ncbi_20200123PMID:20223763
Scimone et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30024368SMESG000068192.1 GU980571.1smed_ncbi_20200123PMID:20223763
Scimone et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30024368SMESG000068192.1 GU980571.1smed_ncbi_20200123PMID:20223763
Scimone et al., 2010
FACS sorted cell population asexual adult fluorescence in situ hybridization evidence
X2 cellSMED30024368SMESG000068192.1 GU980571.1smed_ncbi_20200123PMID:20223763
Scimone et al., 2010
FACS sorted cell population asexual adult fluorescence in situ hybridization evidence
Xins cellSMED30024368SMESG000068192.1 GU980571.1smed_ncbi_20200123PMID:20223763
Scimone et al., 2010
FACS sorted cell population asexual adult fluorescence in situ hybridization evidence
Category 3 cellSMED30024368SMESG000068192.1 GU980571.1smed_ncbi_20200123PMID:26457503
Tu et al., 2015
whole organism asexual adult fluorescence in situ hybridization evidence
cephalic gangliaSMED30024368SMESG000068192.1 GU980571.1smed_ncbi_20200123PMID:26457503
Tu et al., 2015
whole organism asexual adult fluorescence in situ hybridization evidence
ventral nerve cordSMED30024368SMESG000068192.1 GU980571.1smed_ncbi_20200123PMID:26457503
Tu et al., 2015
whole organism asexual adult fluorescence in situ hybridization evidence
parenchymaSMED30024368SMESG000068192.1 GU980571.1smed_ncbi_20200123PMID:26457503
Tu et al., 2015
whole organism asexual adult fluorescence in situ hybridization evidence
epidermisSMED30024368SMESG000068192.1 dd_Smed_v4_2659_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of chromodomain helicase DNA-binding protein 4 vs. Ensembl Human
Match: CHD4 (chromodomain helicase DNA binding protein 4 [Source:HGNC Symbol;Acc:HGNC:1919])

HSP 1 Score: 1442.17 bits (3732), Expect = 0.000e+0
Identity = 710/1180 (60.17%), Postives = 891/1180 (75.51%), Query Frame = -1
Query: 1136 MSGYDTDHQDYCEVCQQGGEIMLCDTCPRAFHLVCLDPELEEAPEGSWSCPHCEKEGVVAASRSTTPATGGDMSQNPQNIRKSAQPNEEEKDEHQEFCNECKDGGDLICCAKCPVSYHPECLYPPLSEIPEGPWLCPRCGCGPLKAKVHKILTWRWMEPPKGKDELDHTHKSTEVEKNPTGGHGRQRAPMREFFVKFRDLSYWNCEWLTELQLDVHHPILLRNYFKKNDMDEPPAPEDGSTYKGRAREKVADPH--NLEERFYKWSVRPEWMQIHRIIDHMTHRNNSIWYLIKWRDLAYDECTWEQLDGEYEVIDMKHLVEEYHIMRKLFTGDIYKKKFKNSSXXXXXXXXXXXXXXPTTDLKKRMSKQPDYIEETGGKLHQYQLEGLNWLRFSFGNVVDTILADEMGLGKTIQTITFLYSLYKEGHSKGPFLVAAPLSTVINWEREFEFWAPDFYVVTYVGDKDSRAVVREHEFSYEEGAMRTSKHACRMRQGTRTKFHVLLTSYELISIDQALLGSISWEVLVVDEAHRLKNNQSKFFRILSSYKINYKLLLTGTPLQNNLEELFHLLHFMTPEKFNDMQGFLDEFADISKEEQVKRLHEILGEHLLRRLKADVLTDMPSKGEFIVRVELSPMQAKFYKYILTRNFDALSVKGGGSQISLINIVMDLKKCCNHPYLFPSGSDEAPKLRNGAYEGLALIKASGKLELLYKMLPKLKTGGHRVLIFSQMTRLLDILEDFMDYMGYKFERIDGAVTGQQRQDSIDRFNAPDSVSFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQSNKVMIYRFVTRNTVEERVTQVAKKKMMLTHLVVRPGLGGKGGASMSKKELDEILKFGTEDLFKEK--------DENEDDHKIVYDDGAIDRLIDRSQQGIEEKE-DMMTDYLSSFKVAHYSKREVSVNXXXXXXXXXETRGEIIKQDLDPADPTYWEKLLRHHYEQDQEDLSKSLGKGKRIRKQVNYSATQQEDDNWNDAVGDSDHESGSINKEEDDEEYDE-SRGEIIGTRRSKRERDGTKMPPLLVKVNGQLEVLGFNVRQRKAFINAVMRYGLPPMDFINSHWMVRELRCKSDRVMRAYINLFLRHLCEPESDNTDCYSDQVPREGVSRQHVLTRIGIMAVVRKKVQEFEKINGQYS 4639
            + GY+TDHQDYCEVCQQGGEI+LCDTCPRA+H+VCLDP++E+APEG WSCPHCEKEG+   ++        D S+  + + +     EEE D H EFC  CKDGG+L+CC  CP SYH  CL PPL EIP G WLCPRC C  LK KV KIL W+W +            +  + + N       +  P R+FFVK++ +SYW+C W++ELQL++H  ++ RNY +KNDMDEPP+ + G   +   + K  DP    +EERFY++ ++PEWM IHRI++H   +   + YLIKWRDL YD+ +WE  D E +  D+    + Y   R+L  G+  + +        ++   + PPE PT D   +  +QP+Y++ TGG LH YQ+EGLNWLRFS+    DTILADEMGLGKT+QT  FLYSLYKEGHSKGPFLV+APLST+INWEREFE WAPD YVVTYVGDKDSRA++RE+EFS+E+ A+R  K A RM++    KFHVLLTSYELI+ID A+LGSI W  L+VDEAHRLKNNQSKFFR+L+ Y + +KLLLTGTPLQNNLEELFHLL+F+TPE+F++++GFL+EFADI+KE+Q+K+LH++LG H+LRRLKADV  +MPSK E IVRVELSPMQ K+YKYILTRNF+AL+ +GGG+Q+SL+N+VMDLKKCCNHPYLFP  + EAPK+ NG Y+G ALI+ASGKL LL KML  LK GGHRVLIFSQMT++LD+LEDF+++ GYK+ERIDG +TG  RQ++IDRFNAP +  F FLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQ+ KVMIYRFVTR +VEER+TQVAKKKMMLTHLVVRPGLG K G SMSK+ELD+ILKFGTE+LFK++         E ED   I YDD AI+RL+DR+Q   E+ E   M +YLSSFKVA Y  RE  +       ++EE   EIIKQ+ +  DP YWEKLLRHHYEQ QEDL+++LGKGKRIRKQVNY+   QED +W D   D+  +  S+  EE DE++DE S      +R+  R      +PPLL +V G +EVLGFN RQRKAF+NA+MRYG+PP D   + W+VR+LR KS++  +AY++LF+RHLCEP +D  + ++D VPREG+SRQHVLTRIG+M+++RKKVQEFE +NG++S
Sbjct:  362 VDGYETDHQDYCEVCQQGGEIILCDTCPRAYHMVCLDPDMEKAPEGKWSCPHCEKEGIQWEAKE-------DNSEGEEILEEVGGDLEEEDDHHMEFCRVCKDGGELLCCDTCPSSYHIHCLNPPLPEIPNGEWLCPRCTCPALKGKVQKILIWKWGQ----PPSPTPVPRPPDADPNTPSPKPLEGRPERQFFVKWQGMSYWHCSWVSELQLELHCQVMFRNYQRKNDMDEPPSGDFGGDEEKSRKRKNKDPKFAEMEERFYRYGIKPEWMMIHRILNHSVDKKGHVHYLIKWRDLPYDQASWESEDVEIQDYDL--FKQSYWNHRELMRGE--EGRPGKKLKKVKLRKLERPPETPTVDPTVKYERQPEYLDATGGTLHPYQMEGLNWLRFSWAQGTDTILADEMGLGKTVQTAVFLYSLYKEGHSKGPFLVSAPLSTIINWEREFEMWAPDMYVVTYVGDKDSRAIIRENEFSFEDNAIRGGKKASRMKKEASVKFHVLLTSYELITIDMAILGSIDWACLIVDEAHRLKNNQSKFFRVLNGYSLQHKLLLTGTPLQNNLEELFHLLNFLTPERFHNLEGFLEEFADIAKEDQIKKLHDMLGPHMLRRLKADVFKNMPSKTELIVRVELSPMQKKYYKYILTRNFEALNARGGGNQVSLLNVVMDLKKCCNHPYLFPVAAMEAPKMPNGMYDGSALIRASGKLLLLQKMLKNLKEGGHRVLIFSQMTKMLDLLEDFLEHEGYKYERIDGGITGNMRQEAIDRFNAPGAQQFCFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQNKKVMIYRFVTRASVEERITQVAKKKMMLTHLVVRPGLGSKTG-SMSKQELDDILKFGTEELFKDEATDGGGDNKEGEDSSVIHYDDKAIERLLDRNQDETEDTELQGMNEYLSSFKVAQYVVREEEMG------EEEEVEREIIKQE-ESVDPDYWEKLLRHHYEQQQEDLARNLGKGKRIRKQVNYNDGSQEDRDWQDDQSDNQSDY-SVASEEGDEDFDERSEAPRRPSRKGLRNDKDKPLPPLLARVGGNIEVLGFNARQRKAFLNAIMRYGMPPQDAFTTQWLVRDLRGKSEKEFKAYVSLFMRHLCEPGADGAETFADGVPREGLSRQHVLTRIGVMSLIRKKVQEFEHVNGRWS 1517          

HSP 2 Score: 248.825 bits (634), Expect = 2.736e-65
Identity = 128/217 (58.99%), Postives = 165/217 (76.04%), Query Frame = -1
Query:  245 KIVINKFMFNIADGGFTELHTIWQNEQRAL-VEGHEQDIWHRKHDYWLLAGVVAHGYGRWQDIHNDVRFAIVNEPFRNEQQKPNYLEIKNRFLARRFKLLEQALTIEEQLRRAAQLNLTYAPNDQVQNLNRRFTELECLATSQQNVYTEAVQGNKTLVPVLHRVLTQLEDLLSDMKQDXXXXXXXXXXXXXXSQRLNLTQTNLIQKLTVQMQQTKPQ 892
            K +  +FMFNIADGGFTELH++WQNE+RA  V     +IWHR+HDYWLLAG++ HGY RWQDI ND R+AI+NEPF+ E  + N+LEIKN+FLARRFKLLEQAL IEEQLRRAA LN++  P+     LN RF E+ECLA S Q++  E++ GNK    VLH+VL QLE+LLSDMK DV RLPA++AR+ PV+ RL +++ N++ +L  +  +  PQ
Sbjct: 1692 KNIKQRFMFNIADGGFTELHSLWQNEERAATVTKKTYEIWHRRHDYWLLAGIINHGYARWQDIQNDPRYAILNEPFKGEMNRGNFLEIKNKFLARRFKLLEQALVIEEQLRRAAYLNMSEDPSHPSMALNTRFAEVECLAESHQHLSKESMAGNKPANAVLHKVLKQLEELLSDMKADVTRLPATIARIPPVAVRLQMSERNILSRLANRAPEPTPQ 1908          
BLAST of chromodomain helicase DNA-binding protein 4 vs. Ensembl Human
Match: CHD4 (chromodomain helicase DNA binding protein 4 [Source:HGNC Symbol;Acc:HGNC:1919])

HSP 1 Score: 1442.17 bits (3732), Expect = 0.000e+0
Identity = 710/1180 (60.17%), Postives = 891/1180 (75.51%), Query Frame = -1
Query: 1136 MSGYDTDHQDYCEVCQQGGEIMLCDTCPRAFHLVCLDPELEEAPEGSWSCPHCEKEGVVAASRSTTPATGGDMSQNPQNIRKSAQPNEEEKDEHQEFCNECKDGGDLICCAKCPVSYHPECLYPPLSEIPEGPWLCPRCGCGPLKAKVHKILTWRWMEPPKGKDELDHTHKSTEVEKNPTGGHGRQRAPMREFFVKFRDLSYWNCEWLTELQLDVHHPILLRNYFKKNDMDEPPAPEDGSTYKGRAREKVADPH--NLEERFYKWSVRPEWMQIHRIIDHMTHRNNSIWYLIKWRDLAYDECTWEQLDGEYEVIDMKHLVEEYHIMRKLFTGDIYKKKFKNSSXXXXXXXXXXXXXXPTTDLKKRMSKQPDYIEETGGKLHQYQLEGLNWLRFSFGNVVDTILADEMGLGKTIQTITFLYSLYKEGHSKGPFLVAAPLSTVINWEREFEFWAPDFYVVTYVGDKDSRAVVREHEFSYEEGAMRTSKHACRMRQGTRTKFHVLLTSYELISIDQALLGSISWEVLVVDEAHRLKNNQSKFFRILSSYKINYKLLLTGTPLQNNLEELFHLLHFMTPEKFNDMQGFLDEFADISKEEQVKRLHEILGEHLLRRLKADVLTDMPSKGEFIVRVELSPMQAKFYKYILTRNFDALSVKGGGSQISLINIVMDLKKCCNHPYLFPSGSDEAPKLRNGAYEGLALIKASGKLELLYKMLPKLKTGGHRVLIFSQMTRLLDILEDFMDYMGYKFERIDGAVTGQQRQDSIDRFNAPDSVSFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQSNKVMIYRFVTRNTVEERVTQVAKKKMMLTHLVVRPGLGGKGGASMSKKELDEILKFGTEDLFKEK--------DENEDDHKIVYDDGAIDRLIDRSQQGIEEKE-DMMTDYLSSFKVAHYSKREVSVNXXXXXXXXXETRGEIIKQDLDPADPTYWEKLLRHHYEQDQEDLSKSLGKGKRIRKQVNYSATQQEDDNWNDAVGDSDHESGSINKEEDDEEYDE-SRGEIIGTRRSKRERDGTKMPPLLVKVNGQLEVLGFNVRQRKAFINAVMRYGLPPMDFINSHWMVRELRCKSDRVMRAYINLFLRHLCEPESDNTDCYSDQVPREGVSRQHVLTRIGIMAVVRKKVQEFEKINGQYS 4639
            + GY+TDHQDYCEVCQQGGEI+LCDTCPRA+H+VCLDP++E+APEG WSCPHCEKEG+   ++        D S+  + + +     EEE D H EFC  CKDGG+L+CC  CP SYH  CL PPL EIP G WLCPRC C  LK KV KIL W+W +            +  + + N       +  P R+FFVK++ +SYW+C W++ELQL++H  ++ RNY +KNDMDEPP+ + G   +   + K  DP    +EERFY++ ++PEWM IHRI++H   +   + YLIKWRDL YD+ +WE  D E +  D+    + Y   R+L  G+  + +        ++   + PPE PT D   +  +QP+Y++ TGG LH YQ+EGLNWLRFS+    DTILADEMGLGKT+QT  FLYSLYKEGHSKGPFLV+APLST+INWEREFE WAPD YVVTYVGDKDSRA++RE+EFS+E+ A+R  K A RM++    KFHVLLTSYELI+ID A+LGSI W  L+VDEAHRLKNNQSKFFR+L+ Y + +KLLLTGTPLQNNLEELFHLL+F+TPE+F++++GFL+EFADI+KE+Q+K+LH++LG H+LRRLKADV  +MPSK E IVRVELSPMQ K+YKYILTRNF+AL+ +GGG+Q+SL+N+VMDLKKCCNHPYLFP  + EAPK+ NG Y+G ALI+ASGKL LL KML  LK GGHRVLIFSQMT++LD+LEDF+++ GYK+ERIDG +TG  RQ++IDRFNAP +  F FLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQ+ KVMIYRFVTR +VEER+TQVAKKKMMLTHLVVRPGLG K G SMSK+ELD+ILKFGTE+LFK++         E ED   I YDD AI+RL+DR+Q   E+ E   M +YLSSFKVA Y  RE  +       ++EE   EIIKQ+ +  DP YWEKLLRHHYEQ QEDL+++LGKGKRIRKQVNY+   QED +W D   D+  +  S+  EE DE++DE S      +R+  R      +PPLL +V G +EVLGFN RQRKAF+NA+MRYG+PP D   + W+VR+LR KS++  +AY++LF+RHLCEP +D  + ++D VPREG+SRQHVLTRIG+M+++RKKVQEFE +NG++S
Sbjct:  338 VDGYETDHQDYCEVCQQGGEIILCDTCPRAYHMVCLDPDMEKAPEGKWSCPHCEKEGIQWEAKE-------DNSEGEEILEEVGGDLEEEDDHHMEFCRVCKDGGELLCCDTCPSSYHIHCLNPPLPEIPNGEWLCPRCTCPALKGKVQKILIWKWGQ----PPSPTPVPRPPDADPNTPSPKPLEGRPERQFFVKWQGMSYWHCSWVSELQLELHCQVMFRNYQRKNDMDEPPSGDFGGDEEKSRKRKNKDPKFAEMEERFYRYGIKPEWMMIHRILNHSVDKKGHVHYLIKWRDLPYDQASWESEDVEIQDYDL--FKQSYWNHRELMRGE--EGRPGKKLKKVKLRKLERPPETPTVDPTVKYERQPEYLDATGGTLHPYQMEGLNWLRFSWAQGTDTILADEMGLGKTVQTAVFLYSLYKEGHSKGPFLVSAPLSTIINWEREFEMWAPDMYVVTYVGDKDSRAIIRENEFSFEDNAIRGGKKASRMKKEASVKFHVLLTSYELITIDMAILGSIDWACLIVDEAHRLKNNQSKFFRVLNGYSLQHKLLLTGTPLQNNLEELFHLLNFLTPERFHNLEGFLEEFADIAKEDQIKKLHDMLGPHMLRRLKADVFKNMPSKTELIVRVELSPMQKKYYKYILTRNFEALNARGGGNQVSLLNVVMDLKKCCNHPYLFPVAAMEAPKMPNGMYDGSALIRASGKLLLLQKMLKNLKEGGHRVLIFSQMTKMLDLLEDFLEHEGYKYERIDGGITGNMRQEAIDRFNAPGAQQFCFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQNKKVMIYRFVTRASVEERITQVAKKKMMLTHLVVRPGLGSKTG-SMSKQELDDILKFGTEELFKDEATDGGGDNKEGEDSSVIHYDDKAIERLLDRNQDETEDTELQGMNEYLSSFKVAQYVVREEEMG------EEEEVEREIIKQE-ESVDPDYWEKLLRHHYEQQQEDLARNLGKGKRIRKQVNYNDGSQEDRDWQDDQSDNQSDY-SVASEEGDEDFDERSEAPRRPSRKGLRNDKDKPLPPLLARVGGNIEVLGFNARQRKAFLNAIMRYGMPPQDAFTTQWLVRDLRGKSEKEFKAYVSLFMRHLCEPGADGAETFADGVPREGLSRQHVLTRIGVMSLIRKKVQEFEHVNGRWS 1493          

HSP 2 Score: 243.817 bits (621), Expect = 9.802e-64
Identity = 127/218 (58.26%), Postives = 165/218 (75.69%), Query Frame = -1
Query:  245 KIVINKFMFNIADGGFTELHTIWQNEQRAL-VEGHEQDIWHRKHDYWLLAGVVAHGYGRWQDIHNDVRFAIVNEPFRNEQQKPNYLEIKNRFLARRFKLLEQALTIEEQLRRAAQLNLTYAPNDQVQNLNRRFTELECLATSQQNVYTEAVQGNKTLVPVLHR-VLTQLEDLLSDMKQDXXXXXXXXXXXXXXSQRLNLTQTNLIQKLTVQMQQTKPQ 892
            K +  +FMFNIADGGFTELH++WQNE+RA  V     +IWHR+HDYWLLAG++ HGY RWQDI ND R+AI+NEPF+ E  + N+LEIKN+FLARRFKLLEQAL IEEQLRRAA LN++  P+     LN RF E+ECLA S Q++  E++ GNK    VLH+ +L QLE+LLSDMK DV RLPA++AR+ PV+ RL +++ N++ +L  +  +  PQ
Sbjct: 1666 KNIKQRFMFNIADGGFTELHSLWQNEERAATVTKKTYEIWHRRHDYWLLAGIINHGYARWQDIQNDPRYAILNEPFKGEMNRGNFLEIKNKFLARRFKLLEQALVIEEQLRRAAYLNMSEDPSHPSMALNTRFAEVECLAESHQHLSKESMAGNKPANAVLHKGILKQLEELLSDMKADVTRLPATIARIPPVAVRLQMSERNILSRLANRAPEPTPQ 1883          
BLAST of chromodomain helicase DNA-binding protein 4 vs. Ensembl Human
Match: CHD4 (chromodomain helicase DNA binding protein 4 [Source:HGNC Symbol;Acc:HGNC:1919])

HSP 1 Score: 1441.79 bits (3731), Expect = 0.000e+0
Identity = 710/1180 (60.17%), Postives = 891/1180 (75.51%), Query Frame = -1
Query: 1136 MSGYDTDHQDYCEVCQQGGEIMLCDTCPRAFHLVCLDPELEEAPEGSWSCPHCEKEGVVAASRSTTPATGGDMSQNPQNIRKSAQPNEEEKDEHQEFCNECKDGGDLICCAKCPVSYHPECLYPPLSEIPEGPWLCPRCGCGPLKAKVHKILTWRWMEPPKGKDELDHTHKSTEVEKNPTGGHGRQRAPMREFFVKFRDLSYWNCEWLTELQLDVHHPILLRNYFKKNDMDEPPAPEDGSTYKGRAREKVADPH--NLEERFYKWSVRPEWMQIHRIIDHMTHRNNSIWYLIKWRDLAYDECTWEQLDGEYEVIDMKHLVEEYHIMRKLFTGDIYKKKFKNSSXXXXXXXXXXXXXXPTTDLKKRMSKQPDYIEETGGKLHQYQLEGLNWLRFSFGNVVDTILADEMGLGKTIQTITFLYSLYKEGHSKGPFLVAAPLSTVINWEREFEFWAPDFYVVTYVGDKDSRAVVREHEFSYEEGAMRTSKHACRMRQGTRTKFHVLLTSYELISIDQALLGSISWEVLVVDEAHRLKNNQSKFFRILSSYKINYKLLLTGTPLQNNLEELFHLLHFMTPEKFNDMQGFLDEFADISKEEQVKRLHEILGEHLLRRLKADVLTDMPSKGEFIVRVELSPMQAKFYKYILTRNFDALSVKGGGSQISLINIVMDLKKCCNHPYLFPSGSDEAPKLRNGAYEGLALIKASGKLELLYKMLPKLKTGGHRVLIFSQMTRLLDILEDFMDYMGYKFERIDGAVTGQQRQDSIDRFNAPDSVSFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQSNKVMIYRFVTRNTVEERVTQVAKKKMMLTHLVVRPGLGGKGGASMSKKELDEILKFGTEDLFKEK--------DENEDDHKIVYDDGAIDRLIDRSQQGIEEKE-DMMTDYLSSFKVAHYSKREVSVNXXXXXXXXXETRGEIIKQDLDPADPTYWEKLLRHHYEQDQEDLSKSLGKGKRIRKQVNYSATQQEDDNWNDAVGDSDHESGSINKEEDDEEYDE-SRGEIIGTRRSKRERDGTKMPPLLVKVNGQLEVLGFNVRQRKAFINAVMRYGLPPMDFINSHWMVRELRCKSDRVMRAYINLFLRHLCEPESDNTDCYSDQVPREGVSRQHVLTRIGIMAVVRKKVQEFEKINGQYS 4639
            + GY+TDHQDYCEVCQQGGEI+LCDTCPRA+H+VCLDP++E+APEG WSCPHCEKEG+   ++        D S+  + + +     EEE D H EFC  CKDGG+L+CC  CP SYH  CL PPL EIP G WLCPRC C  LK KV KIL W+W +            +  + + N       +  P R+FFVK++ +SYW+C W++ELQL++H  ++ RNY +KNDMDEPP+ + G   +   + K  DP    +EERFY++ ++PEWM IHRI++H   +   + YLIKWRDL YD+ +WE  D E +  D+    + Y   R+L  G+  + +        ++   + PPE PT D   +  +QP+Y++ TGG LH YQ+EGLNWLRFS+    DTILADEMGLGKT+QT  FLYSLYKEGHSKGPFLV+APLST+INWEREFE WAPD YVVTYVGDKDSRA++RE+EFS+E+ A+R  K A RM++    KFHVLLTSYELI+ID A+LGSI W  L+VDEAHRLKNNQSKFFR+L+ Y + +KLLLTGTPLQNNLEELFHLL+F+TPE+F++++GFL+EFADI+KE+Q+K+LH++LG H+LRRLKADV  +MPSK E IVRVELSPMQ K+YKYILTRNF+AL+ +GGG+Q+SL+N+VMDLKKCCNHPYLFP  + EAPK+ NG Y+G ALI+ASGKL LL KML  LK GGHRVLIFSQMT++LD+LEDF+++ GYK+ERIDG +TG  RQ++IDRFNAP +  F FLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQ+ KVMIYRFVTR +VEER+TQVAKKKMMLTHLVVRPGLG K G SMSK+ELD+ILKFGTE+LFK++         E ED   I YDD AI+RL+DR+Q   E+ E   M +YLSSFKVA Y  RE  +       ++EE   EIIKQ+ +  DP YWEKLLRHHYEQ QEDL+++LGKGKRIRKQVNY+   QED +W D   D+  +  S+  EE DE++DE S      +R+  R      +PPLL +V G +EVLGFN RQRKAF+NA+MRYG+PP D   + W+VR+LR KS++  +AY++LF+RHLCEP +D  + ++D VPREG+SRQHVLTRIG+M+++RKKVQEFE +NG++S
Sbjct:  362 VDGYETDHQDYCEVCQQGGEIILCDTCPRAYHMVCLDPDMEKAPEGKWSCPHCEKEGIQWEAKE-------DNSEGEEILEEVGGDLEEEDDHHMEFCRVCKDGGELLCCDTCPSSYHIHCLNPPLPEIPNGEWLCPRCTCPALKGKVQKILIWKWGQ----PPSPTPVPRPPDADPNTPSPKPLEGRPERQFFVKWQGMSYWHCSWVSELQLELHCQVMFRNYQRKNDMDEPPSGDFGGDEEKSRKRKNKDPKFAEMEERFYRYGIKPEWMMIHRILNHSVDKKGHVHYLIKWRDLPYDQASWESEDVEIQDYDL--FKQSYWNHRELMRGE--EGRPGKKLKKVKLRKLERPPETPTVDPTVKYERQPEYLDATGGTLHPYQMEGLNWLRFSWAQGTDTILADEMGLGKTVQTAVFLYSLYKEGHSKGPFLVSAPLSTIINWEREFEMWAPDMYVVTYVGDKDSRAIIRENEFSFEDNAIRGGKKASRMKKEASVKFHVLLTSYELITIDMAILGSIDWACLIVDEAHRLKNNQSKFFRVLNGYSLQHKLLLTGTPLQNNLEELFHLLNFLTPERFHNLEGFLEEFADIAKEDQIKKLHDMLGPHMLRRLKADVFKNMPSKTELIVRVELSPMQKKYYKYILTRNFEALNARGGGNQVSLLNVVMDLKKCCNHPYLFPVAAMEAPKMPNGMYDGSALIRASGKLLLLQKMLKNLKEGGHRVLIFSQMTKMLDLLEDFLEHEGYKYERIDGGITGNMRQEAIDRFNAPGAQQFCFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQNKKVMIYRFVTRASVEERITQVAKKKMMLTHLVVRPGLGSKTG-SMSKQELDDILKFGTEELFKDEATDGGGDNKEGEDSSVIHYDDKAIERLLDRNQDETEDTELQGMNEYLSSFKVAQYVVREEEMG------EEEEVEREIIKQE-ESVDPDYWEKLLRHHYEQQQEDLARNLGKGKRIRKQVNYNDGSQEDRDWQDDQSDNQSDY-SVASEEGDEDFDERSEAPRRPSRKGLRNDKDKPLPPLLARVGGNIEVLGFNARQRKAFLNAIMRYGMPPQDAFTTQWLVRDLRGKSEKEFKAYVSLFMRHLCEPGADGAETFADGVPREGLSRQHVLTRIGVMSLIRKKVQEFEHVNGRWS 1517          

HSP 2 Score: 248.825 bits (634), Expect = 2.802e-65
Identity = 128/217 (58.99%), Postives = 165/217 (76.04%), Query Frame = -1
Query:  245 KIVINKFMFNIADGGFTELHTIWQNEQRAL-VEGHEQDIWHRKHDYWLLAGVVAHGYGRWQDIHNDVRFAIVNEPFRNEQQKPNYLEIKNRFLARRFKLLEQALTIEEQLRRAAQLNLTYAPNDQVQNLNRRFTELECLATSQQNVYTEAVQGNKTLVPVLHRVLTQLEDLLSDMKQDXXXXXXXXXXXXXXSQRLNLTQTNLIQKLTVQMQQTKPQ 892
            K +  +FMFNIADGGFTELH++WQNE+RA  V     +IWHR+HDYWLLAG++ HGY RWQDI ND R+AI+NEPF+ E  + N+LEIKN+FLARRFKLLEQAL IEEQLRRAA LN++  P+     LN RF E+ECLA S Q++  E++ GNK    VLH+VL QLE+LLSDMK DV RLPA++AR+ PV+ RL +++ N++ +L  +  +  PQ
Sbjct: 1690 KNIKQRFMFNIADGGFTELHSLWQNEERAATVTKKTYEIWHRRHDYWLLAGIINHGYARWQDIQNDPRYAILNEPFKGEMNRGNFLEIKNKFLARRFKLLEQALVIEEQLRRAAYLNMSEDPSHPSMALNTRFAEVECLAESHQHLSKESMAGNKPANAVLHKVLKQLEELLSDMKADVTRLPATIARIPPVAVRLQMSERNILSRLANRAPEPTPQ 1906          
BLAST of chromodomain helicase DNA-binding protein 4 vs. Ensembl Human
Match: CHD4 (chromodomain helicase DNA binding protein 4 [Source:HGNC Symbol;Acc:HGNC:1919])

HSP 1 Score: 1441.4 bits (3730), Expect = 0.000e+0
Identity = 710/1180 (60.17%), Postives = 890/1180 (75.42%), Query Frame = -1
Query: 1136 MSGYDTDHQDYCEVCQQGGEIMLCDTCPRAFHLVCLDPELEEAPEGSWSCPHCEKEGVVAASRSTTPATGGDMSQNPQNIRKSAQPNEEEKDEHQEFCNECKDGGDLICCAKCPVSYHPECLYPPLSEIPEGPWLCPRCGCGPLKAKVHKILTWRWMEPPKGKDELDHTHKSTEVEKNPTGGHGRQRAPMREFFVKFRDLSYWNCEWLTELQLDVHHPILLRNYFKKNDMDEPPAPEDGSTYKGRAREKVADPH--NLEERFYKWSVRPEWMQIHRIIDHMTHRNNSIWYLIKWRDLAYDECTWEQLDGEYEVIDMKHLVEEYHIMRKLFTGDIYKKKFKNSSXXXXXXXXXXXXXXPTTDLKKRMSKQPDYIEETGGKLHQYQLEGLNWLRFSFGNVVDTILADEMGLGKTIQTITFLYSLYKEGHSKGPFLVAAPLSTVINWEREFEFWAPDFYVVTYVGDKDSRAVVREHEFSYEEGAMRTSKHACRMRQGTRTKFHVLLTSYELISIDQALLGSISWEVLVVDEAHRLKNNQSKFFRILSSYKINYKLLLTGTPLQNNLEELFHLLHFMTPEKFNDMQGFLDEFADISKEEQVKRLHEILGEHLLRRLKADVLTDMPSKGEFIVRVELSPMQAKFYKYILTRNFDALSVKGGGSQISLINIVMDLKKCCNHPYLFPSGSDEAPKLRNGAYEGLALIKASGKLELLYKMLPKLKTGGHRVLIFSQMTRLLDILEDFMDYMGYKFERIDGAVTGQQRQDSIDRFNAPDSVSFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQSNKVMIYRFVTRNTVEERVTQVAKKKMMLTHLVVRPGLGGKGGASMSKKELDEILKFGTEDLFKEK--------DENEDDHKIVYDDGAIDRLIDRSQQGIEEKE-DMMTDYLSSFKVAHYSKREVSVNXXXXXXXXXETRGEIIKQDLDPADPTYWEKLLRHHYEQDQEDLSKSLGKGKRIRKQVNYSATQQEDDNWNDAVGDSDHESGSINKEEDDEEYDE-SRGEIIGTRRSKRERDGTKMPPLLVKVNGQLEVLGFNVRQRKAFINAVMRYGLPPMDFINSHWMVRELRCKSDRVMRAYINLFLRHLCEPESDNTDCYSDQVPREGVSRQHVLTRIGIMAVVRKKVQEFEKINGQYS 4639
            + GY+TDHQDYCEVCQQGGEI+LCDTCPRA+H+VCLDP++E+APEG WSCPHCEKEG+   ++        D S+  + + +     EEE D H EFC  CKDGG+L+CC  CP SYH  CL PPL EIP G WLCPRC C  LK KV KIL W+W +            +  + + N       +  P R+FFVK++ +SYW+C W++ELQL++H  ++ RNY +KNDMDEPP+ + G   +   + K  DP    +EERFY++ ++PEWM IHRI++H   +   + YLIKWRDL YD+ +WE  D E +  D+    + Y   R+L  G+  + +        ++   + PPE PT D   +  +QP+Y++ TGG LH YQ+EGLNWLRFS+    DTILADEMGLGKT+QT  FLYSLYKEGHSKGPFLV+APLST+INWEREFE WAPD YVVTYVGDKDSRA++RE+EFS+E+ A+R  K A RM++    KFHVLLTSYELI+ID A+LGSI W  L+VDEAHRLKNNQSKFFR+L+ Y + +KLLLTGTPLQNNLEELFHLL+F+TPE+F++++GFL+EFADI+KE+Q+K+LH++LG H+LRRLKADV  +MPSK E IVRVELSPMQ K+YKYILTRNF+AL+ +GGG+Q+SL+N+VMDLKKCCNHPYLFP  + EAPK+ NG Y+G ALI+ASGKL LL KML  LK GGHRVLIFSQMT++LD+LEDF+++ GYK+ERIDG +TG  RQ++IDRFNAP +  F FLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQ+ KVMIYRFVTR +VEER+TQVAKKKMMLTHLVVRPGLG K G SMSK+ELD+ILKFGTE+LFK++         E ED   I YDD AI+RL+DR+Q   E+ E   M +YLSSFKVA Y  RE  +        +EE   EIIKQ+ +  DP YWEKLLRHHYEQ QEDL+++LGKGKRIRKQVNY+   QED +W D   D+  +  S+  EE DE++DE S      +R+  R      +PPLL +V G +EVLGFN RQRKAF+NA+MRYG+PP D   + W+VR+LR KS++  +AY++LF+RHLCEP +D  + ++D VPREG+SRQHVLTRIG+M+++RKKVQEFE +NG++S
Sbjct:  355 VDGYETDHQDYCEVCQQGGEIILCDTCPRAYHMVCLDPDMEKAPEGKWSCPHCEKEGIQWEAKE-------DNSEGEEILEEVGGDLEEEDDHHMEFCRVCKDGGELLCCDTCPSSYHIHCLNPPLPEIPNGEWLCPRCTCPALKGKVQKILIWKWGQ----PPSPTPVPRPPDADPNTPSPKPLEGRPERQFFVKWQGMSYWHCSWVSELQLELHCQVMFRNYQRKNDMDEPPSGDFGGDEEKSRKRKNKDPKFAEMEERFYRYGIKPEWMMIHRILNHSVDKKGHVHYLIKWRDLPYDQASWESEDVEIQDYDL--FKQSYWNHRELMRGE--EGRPGKKLKKVKLRKLERPPETPTVDPTVKYERQPEYLDATGGTLHPYQMEGLNWLRFSWAQGTDTILADEMGLGKTVQTAVFLYSLYKEGHSKGPFLVSAPLSTIINWEREFEMWAPDMYVVTYVGDKDSRAIIRENEFSFEDNAIRGGKKASRMKKEASVKFHVLLTSYELITIDMAILGSIDWACLIVDEAHRLKNNQSKFFRVLNGYSLQHKLLLTGTPLQNNLEELFHLLNFLTPERFHNLEGFLEEFADIAKEDQIKKLHDMLGPHMLRRLKADVFKNMPSKTELIVRVELSPMQKKYYKYILTRNFEALNARGGGNQVSLLNVVMDLKKCCNHPYLFPVAAMEAPKMPNGMYDGSALIRASGKLLLLQKMLKNLKEGGHRVLIFSQMTKMLDLLEDFLEHEGYKYERIDGGITGNMRQEAIDRFNAPGAQQFCFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQNKKVMIYRFVTRASVEERITQVAKKKMMLTHLVVRPGLGSKTG-SMSKQELDDILKFGTEELFKDEATDGGGDNKEGEDSSVIHYDDKAIERLLDRNQDETEDTELQGMNEYLSSFKVAQYVVREEEMG-------EEEVEREIIKQE-ESVDPDYWEKLLRHHYEQQQEDLARNLGKGKRIRKQVNYNDGSQEDRDWQDDQSDNQSDY-SVASEEGDEDFDERSEAPRRPSRKGLRNDKDKPLPPLLARVGGNIEVLGFNARQRKAFLNAIMRYGMPPQDAFTTQWLVRDLRGKSEKEFKAYVSLFMRHLCEPGADGAETFADGVPREGLSRQHVLTRIGVMSLIRKKVQEFEHVNGRWS 1509          

HSP 2 Score: 248.825 bits (634), Expect = 2.878e-65
Identity = 128/217 (58.99%), Postives = 165/217 (76.04%), Query Frame = -1
Query:  245 KIVINKFMFNIADGGFTELHTIWQNEQRAL-VEGHEQDIWHRKHDYWLLAGVVAHGYGRWQDIHNDVRFAIVNEPFRNEQQKPNYLEIKNRFLARRFKLLEQALTIEEQLRRAAQLNLTYAPNDQVQNLNRRFTELECLATSQQNVYTEAVQGNKTLVPVLHRVLTQLEDLLSDMKQDXXXXXXXXXXXXXXSQRLNLTQTNLIQKLTVQMQQTKPQ 892
            K +  +FMFNIADGGFTELH++WQNE+RA  V     +IWHR+HDYWLLAG++ HGY RWQDI ND R+AI+NEPF+ E  + N+LEIKN+FLARRFKLLEQAL IEEQLRRAA LN++  P+     LN RF E+ECLA S Q++  E++ GNK    VLH+VL QLE+LLSDMK DV RLPA++AR+ PV+ RL +++ N++ +L  +  +  PQ
Sbjct: 1681 KNIKQRFMFNIADGGFTELHSLWQNEERAATVTKKTYEIWHRRHDYWLLAGIINHGYARWQDIQNDPRYAILNEPFKGEMNRGNFLEIKNKFLARRFKLLEQALVIEEQLRRAAYLNMSEDPSHPSMALNTRFAEVECLAESHQHLSKESMAGNKPANAVLHKVLKQLEELLSDMKADVTRLPATIARIPPVAVRLQMSERNILSRLANRAPEPTPQ 1897          
BLAST of chromodomain helicase DNA-binding protein 4 vs. Ensembl Human
Match: CHD4 (chromodomain helicase DNA binding protein 4 [Source:HGNC Symbol;Acc:HGNC:1919])

HSP 1 Score: 1441.4 bits (3730), Expect = 0.000e+0
Identity = 710/1180 (60.17%), Postives = 891/1180 (75.51%), Query Frame = -1
Query: 1136 MSGYDTDHQDYCEVCQQGGEIMLCDTCPRAFHLVCLDPELEEAPEGSWSCPHCEKEGVVAASRSTTPATGGDMSQNPQNIRKSAQPNEEEKDEHQEFCNECKDGGDLICCAKCPVSYHPECLYPPLSEIPEGPWLCPRCGCGPLKAKVHKILTWRWMEPPKGKDELDHTHKSTEVEKNPTGGHGRQRAPMREFFVKFRDLSYWNCEWLTELQLDVHHPILLRNYFKKNDMDEPPAPEDGSTYKGRAREKVADPH--NLEERFYKWSVRPEWMQIHRIIDHMTHRNNSIWYLIKWRDLAYDECTWEQLDGEYEVIDMKHLVEEYHIMRKLFTGDIYKKKFKNSSXXXXXXXXXXXXXXPTTDLKKRMSKQPDYIEETGGKLHQYQLEGLNWLRFSFGNVVDTILADEMGLGKTIQTITFLYSLYKEGHSKGPFLVAAPLSTVINWEREFEFWAPDFYVVTYVGDKDSRAVVREHEFSYEEGAMRTSKHACRMRQGTRTKFHVLLTSYELISIDQALLGSISWEVLVVDEAHRLKNNQSKFFRILSSYKINYKLLLTGTPLQNNLEELFHLLHFMTPEKFNDMQGFLDEFADISKEEQVKRLHEILGEHLLRRLKADVLTDMPSKGEFIVRVELSPMQAKFYKYILTRNFDALSVKGGGSQISLINIVMDLKKCCNHPYLFPSGSDEAPKLRNGAYEGLALIKASGKLELLYKMLPKLKTGGHRVLIFSQMTRLLDILEDFMDYMGYKFERIDGAVTGQQRQDSIDRFNAPDSVSFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQSNKVMIYRFVTRNTVEERVTQVAKKKMMLTHLVVRPGLGGKGGASMSKKELDEILKFGTEDLFKEK--------DENEDDHKIVYDDGAIDRLIDRSQQGIEEKE-DMMTDYLSSFKVAHYSKREVSVNXXXXXXXXXETRGEIIKQDLDPADPTYWEKLLRHHYEQDQEDLSKSLGKGKRIRKQVNYSATQQEDDNWNDAVGDSDHESGSINKEEDDEEYDE-SRGEIIGTRRSKRERDGTKMPPLLVKVNGQLEVLGFNVRQRKAFINAVMRYGLPPMDFINSHWMVRELRCKSDRVMRAYINLFLRHLCEPESDNTDCYSDQVPREGVSRQHVLTRIGIMAVVRKKVQEFEKINGQYS 4639
            + GY+TDHQDYCEVCQQGGEI+LCDTCPRA+H+VCLDP++E+APEG WSCPHCEKEG+   ++        D S+  + + +     EEE D H EFC  CKDGG+L+CC  CP SYH  CL PPL EIP G WLCPRC C  LK KV KIL W+W +            +  + + N       +  P R+FFVK++ +SYW+C W++ELQL++H  ++ RNY +KNDMDEPP+ + G   +   + K  DP    +EERFY++ ++PEWM IHRI++H   +   + YLIKWRDL YD+ +WE  D E +  D+    + Y   R+L  G+  + +        ++   + PPE PT D   +  +QP+Y++ TGG LH YQ+EGLNWLRFS+    DTILADEMGLGKT+QT  FLYSLYKEGHSKGPFLV+APLST+INWEREFE WAPD YVVTYVGDKDSRA++RE+EFS+E+ A+R  K A RM++    KFHVLLTSYELI+ID A+LGSI W  L+VDEAHRLKNNQSKFFR+L+ Y + +KLLLTGTPLQNNLEELFHLL+F+TPE+F++++GFL+EFADI+KE+Q+K+LH++LG H+LRRLKADV  +MPSK E IVRVELSPMQ K+YKYILTRNF+AL+ +GGG+Q+SL+N+VMDLKKCCNHPYLFP  + EAPK+ NG Y+G ALI+ASGKL LL KML  LK GGHRVLIFSQMT++LD+LEDF+++ GYK+ERIDG +TG  RQ++IDRFNAP +  F FLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQ+ KVMIYRFVTR +VEER+TQVAKKKMMLTHLVVRPGLG K G SMSK+ELD+ILKFGTE+LFK++         E ED   I YDD AI+RL+DR+Q   E+ E   M +YLSSFKVA Y  RE  +       ++EE   EIIKQ+ +  DP YWEKLLRHHYEQ QEDL+++LGKGKRIRKQVNY+   QED +W D   D+  +  S+  EE DE++DE S      +R+  R      +PPLL +V G +EVLGFN RQRKAF+NA+MRYG+PP D   + W+VR+LR KS++  +AY++LF+RHLCEP +D  + ++D VPREG+SRQHVLTRIG+M+++RKKVQEFE +NG++S
Sbjct:  355 VDGYETDHQDYCEVCQQGGEIILCDTCPRAYHMVCLDPDMEKAPEGKWSCPHCEKEGIQWEAKE-------DNSEGEEILEEVGGDLEEEDDHHMEFCRVCKDGGELLCCDTCPSSYHIHCLNPPLPEIPNGEWLCPRCTCPALKGKVQKILIWKWGQ----PPSPTPVPRPPDADPNTPSPKPLEGRPERQFFVKWQGMSYWHCSWVSELQLELHCQVMFRNYQRKNDMDEPPSGDFGGDEEKSRKRKNKDPKFAEMEERFYRYGIKPEWMMIHRILNHSVDKKGHVHYLIKWRDLPYDQASWESEDVEIQDYDL--FKQSYWNHRELMRGE--EGRPGKKLKKVKLRKLERPPETPTVDPTVKYERQPEYLDATGGTLHPYQMEGLNWLRFSWAQGTDTILADEMGLGKTVQTAVFLYSLYKEGHSKGPFLVSAPLSTIINWEREFEMWAPDMYVVTYVGDKDSRAIIRENEFSFEDNAIRGGKKASRMKKEASVKFHVLLTSYELITIDMAILGSIDWACLIVDEAHRLKNNQSKFFRVLNGYSLQHKLLLTGTPLQNNLEELFHLLNFLTPERFHNLEGFLEEFADIAKEDQIKKLHDMLGPHMLRRLKADVFKNMPSKTELIVRVELSPMQKKYYKYILTRNFEALNARGGGNQVSLLNVVMDLKKCCNHPYLFPVAAMEAPKMPNGMYDGSALIRASGKLLLLQKMLKNLKEGGHRVLIFSQMTKMLDLLEDFLEHEGYKYERIDGGITGNMRQEAIDRFNAPGAQQFCFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQNKKVMIYRFVTRASVEERITQVAKKKMMLTHLVVRPGLGSKTG-SMSKQELDDILKFGTEELFKDEATDGGGDNKEGEDSSVIHYDDKAIERLLDRNQDETEDTELQGMNEYLSSFKVAQYVVREEEMG------EEEEVEREIIKQE-ESVDPDYWEKLLRHHYEQQQEDLARNLGKGKRIRKQVNYNDGSQEDRDWQDDQSDNQSDY-SVASEEGDEDFDERSEAPRRPSRKGLRNDKDKPLPPLLARVGGNIEVLGFNARQRKAFLNAIMRYGMPPQDAFTTQWLVRDLRGKSEKEFKAYVSLFMRHLCEPGADGAETFADGVPREGLSRQHVLTRIGVMSLIRKKVQEFEHVNGRWS 1510          

HSP 2 Score: 248.825 bits (634), Expect = 2.907e-65
Identity = 128/217 (58.99%), Postives = 165/217 (76.04%), Query Frame = -1
Query:  245 KIVINKFMFNIADGGFTELHTIWQNEQRAL-VEGHEQDIWHRKHDYWLLAGVVAHGYGRWQDIHNDVRFAIVNEPFRNEQQKPNYLEIKNRFLARRFKLLEQALTIEEQLRRAAQLNLTYAPNDQVQNLNRRFTELECLATSQQNVYTEAVQGNKTLVPVLHRVLTQLEDLLSDMKQDXXXXXXXXXXXXXXSQRLNLTQTNLIQKLTVQMQQTKPQ 892
            K +  +FMFNIADGGFTELH++WQNE+RA  V     +IWHR+HDYWLLAG++ HGY RWQDI ND R+AI+NEPF+ E  + N+LEIKN+FLARRFKLLEQAL IEEQLRRAA LN++  P+     LN RF E+ECLA S Q++  E++ GNK    VLH+VL QLE+LLSDMK DV RLPA++AR+ PV+ RL +++ N++ +L  +  +  PQ
Sbjct: 1683 KNIKQRFMFNIADGGFTELHSLWQNEERAATVTKKTYEIWHRRHDYWLLAGIINHGYARWQDIQNDPRYAILNEPFKGEMNRGNFLEIKNKFLARRFKLLEQALVIEEQLRRAAYLNMSEDPSHPSMALNTRFAEVECLAESHQHLSKESMAGNKPANAVLHKVLKQLEELLSDMKADVTRLPATIARIPPVAVRLQMSERNILSRLANRAPEPTPQ 1899          
BLAST of chromodomain helicase DNA-binding protein 4 vs. Ensembl Celegans
Match: chd-3 (Chromodomain-helicase-DNA-binding protein 3 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q22516])

HSP 1 Score: 1294.26 bits (3348), Expect = 0.000e+0
Identity = 653/1198 (54.51%), Postives = 840/1198 (70.12%), Query Frame = -1
Query: 1136 DHQDYCEVCQQGGEIMLCDTCPRAFHLVCLDPELEEAPEGSWSCPHCEKEGVVAASRSTTPATGGDMSQNPQNIRKSAQPNEEEKDEHQEFCNECKDGGDLICCAKCPVSYHPECLYPPLSEIPEGPWLCPRCGCGPLKAKVHKILTWRWME----PPKGKDELDHTHKSTEVEKNPTGGHGRQRAPMREFFVKFRDLSYWNCEWLTELQLDVHHPILLRNYFKKNDMDEPPAPEDGSTYKGRAREKVADPHNLEERFYKWSVRPEWMQIHRIIDHMTHRNNSIWYLIKWRDLAYDECTWEQLDGEYEVIDMKHLVEEYHIMRKLFTGD---------IYKKKFKNSSXXXXXXXXXXXXXXPTTDLKKRMSKQPDYIEETGGKLHQYQLEGLNWLRFSFGNVVDTILADEMGLGKTIQTITFLYSLYKEGHSKGPFLVAAPLSTVINWEREFEFWAPDFYVVTYVGDKDSRAVVREHEFSYEEGAMRTSKHACRMRQGTRTKFHVLLTSYELISIDQALLGSISWEVLVVDEAHRLKNNQSKFFRILSSYKINYKLLLTGTPLQNNLEELFHLLHFMTPEKFNDMQGFLDEFADISKEEQVKRLHEILGEHLLRRLKADVLTDMPSKGEFIVRVELSPMQAKFYKYILTRNFDALSVKGGGSQISLINIVMDLKKCCNHPYLFPSGSDEAPKLRNGAYEGLALIKASGKLELLYKMLPKLKTGGHRVLIFSQMTRLLDILEDFMDYMGYKFERIDGAVTGQQRQDSIDRFNAPDSVSFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQSNKVMIYRFVTRNTVEERVTQVAKKKMMLTHLVVRPGLGGKGGASMSKKELDEILKFGTEDLFKEKD-------------ENEDDHKIVYDDGAIDRLIDRSQ----QGIEEKEDMMTDYLSSFKVAHYSKREVSVNXXXXXXXXXETRGEIIKQDLDPADPTYWEKLLRHHYEQDQEDLSKSLGKGKRIRKQVNYSATQQEDDNWNDAVGDSDHESGSINKEEDDEEYDESRGEIIGT------RRSKRERDGTKMPPLLVKVNGQLEVLGFNVRQRKAFINAVMRYGLPPMDFINSHWMVRELRCKSDRVMRAYINLFLRHLCEPESDNTDCYSDQVPREGVSRQHVLTRIGIMAVVRKKVQEFEKINGQYS 4621
            +HQ+ CEVC Q GE+MLCDTC RA+H+ C+D  +E+ PEG WSCPHCE+ G         PA                         + ++C  CK+  +++ C  CP SYH  C+ PPL+EIPEG W CPRC       ++ KIL+WRW E     P    E +   K     K P     R+    REFFVK++ L+YW CEWL+E  +DV+   L+R Y++K D + PP  E+ +  +  +     DP+ L ERFY++ V+PEWMQIHRII+H+++  +   YL+KW++L+Y+  TWE+ D   ++ + +  + +Y   R+    D         I K++      PKE  +     +    D+ K+   QPD+I ETGG LH YQLEG+NWLR  + N  D ILADEMGLGKT+Q++TFLY+L KEGH+KGPFL+AAPLST+INWERE E W PDFYVVTYVGD++SR V+REHEFS+ +GA+R      +++     KFHVLLTSYE I++D+A+L SI W  LVVDEAHRLKNNQS FF+ L  Y I Y++LLTGTPLQNNLEELFHLL+F+ P++FN ++ F  EF++ISKE+Q+++LH +LG H+LRRLKADVLT MPSK E IVRVELS MQ K+YK ILTRNFDAL+VK GG+Q+SLINI+M+LKKCCNHPYLF     EAPKL+NG YEG ALIK +GK  LL KML KLK GGHRVLIFSQMT +LDILEDF D  GYK+ERIDG++TGQQRQD+IDR+NAP +  FVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHR+GQ +KVMIYRFVT+ +VEER+T VAKKKM+LTHLVVR GLG K G SMSK ELD++L++GTE+LFKE++             +  ++ +IV+DD A+D L+DR++    Q  E+KE    +YLSSFKVA Y+ +E    +DDED+       E+IK+  +  DP YWEKLL+HHYEQDQE   + LGKGKR+R+QVNY A++    +W+        ++    +E+D  EY    GE++ T      RR +RE    K+PPLL KVNGQ+EVLGFN RQRKAF NAVMR+G+PP D   S W VR+LR KS++V +AY +LF+RHLCEP  DN+D + D VPREG++RQ VL+RIG+M+++RKKVQEFEK NG++S
Sbjct:  263 NHQENCEVCNQDGELMLCDTCTRAYHVACIDENMEQPPEGDWSCPHCEEHGPDVLIVEEEPAKA-----------------------NMDYCRICKETSNILLCDTCPSSYHAYCIDPPLTEIPEGEWSCPRCIIPEPAQRIEKILSWRWKEISYPEPLECKEGEEASKDDVFLKPPRKMEPRRE---REFFVKWKYLAYWQCEWLSETLMDVYFTALVRMYWRKVDSENPPIFEESTLSRHHSDH---DPYKLRERFYQYGVKPEWMQIHRIINHLSYAKSQQDYLVKWKELSYEHATWERDDT--DIANYEDAIIKYWHHRERMLNDEVPRNVQKMIAKQREAKGLGPKEDEVTSRRKKREKIDILKKYEVQPDFISETGGNLHPYQLEGINWLRHCWSNGTDAILADEMGLGKTVQSLTFLYTLMKEGHTKGPFLIAAPLSTIINWEREAELWCPDFYVVTYVGDRESRMVIREHEFSFVDGAVRGGPKVSKIKTLENLKFHVLLTSYECINMDKAILSSIDWAALVVDEAHRLKNNQSTFFKNLREYNIQYRVLLTGTPLQNNLEELFHLLNFLAPDRFNQLESFTAEFSEISKEDQIEKLHNLLGPHMLRRLKADVLTGMPSKQELIVRVELSAMQKKYYKNILTRNFDALNVKNGGTQMSLINIIMELKKCCNHPYLFMKACLEAPKLKNGMYEGSALIKNAGKFVLLQKMLRKLKDGGHRVLIFSQMTMMLDILEDFCDVEGYKYERIDGSITGQQRQDAIDRYNAPGAKQFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRLGQKHKVMIYRFVTKGSVEERITSVAKKKMLLTHLVVRAGLGAKDGKSMSKTELDDVLRWGTEELFKEEEAPVEGADGEGTSSKKPNEQEIVWDDAAVDFLLDRNKEEEGQDGEKKEHWTNEYLSSFKVATYNTKEADDADDDEDET------EVIKEGTEEQDPNYWEKLLKHHYEQDQETELQKLGKGKRVRRQVNY-ASENMGQDWS-------AQNNQQQEEDDGSEYGSDNGELLQTDEDYEERRRRREERSEKLPPLLAKVNGQIEVLGFNPRQRKAFYNAVMRWGMPPQDLTQSSWQVRDLRNKSEKVFKAYSSLFMRHLCEPVVDNSDSFMDGVPREGLNRQAVLSRIGLMSILRKKVQEFEKFNGEWS 1415          

HSP 2 Score: 201.83 bits (512), Expect = 1.977e-51
Identity = 110/224 (49.11%), Postives = 155/224 (69.20%), Query Frame = -1
Query:  224 FMFNIADGGFTELHTIWQNEQRALVEGHEQDIWHRKHDYWLLAGVVAHGYGRW----QDIHNDVRFAIVNEPFRNEQQKP--NYLEIKNRFLARRFKLLEQALTIEEQLRRAAQLNLTYAPNDQVQNLNRRFTELECLATSQQNVYTEAVQGNKTLVPVLHRVLTQLEDLLSDMKQDXXXXXXXXXXXXXXSQRLNLTQTNLIQKLTVQMQ-QTKPQPPAICES 874
            + FNI DGG+TELH++W NE++    G E +IWHR+HD+WLLA V  +GYGR+    QDI ND +F+IVNEPF+     P  N+ ++KN+FLARRFKLLEQ+L IEEQLRRAA +N   +P DQV  L + F+ELE  A +  N+  E+  GN+    +LH+ L QL+DLLSD+K DVARLPA+++++ PV++RL +++  ++ +L V       P  PA+  S
Sbjct: 1483 YKFNICDGGYTELHSLWINEEKVARNGKEYEIWHRRHDFWLLAAVAVYGYGRYQINFQDIMNDPKFSIVNEPFKQTGADPATNFADVKNKFLARRFKLLEQSLVIEEQLRRAAHINKQQSP-DQVGQLAQHFSELEHTADAHVNIARESNNGNRNANAILHKCLAQLDDLLSDLKTDVARLPATISQVRPVTERLQMSERQILSRLVVAKDPDAAPSKPALPPS 1705          
BLAST of chromodomain helicase DNA-binding protein 4 vs. Ensembl Celegans
Match: let-418 (pep chromosome:WBcel235:V:5826833:5832866:1 gene:WBGene00002637.1 transcript:F26F12.7.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:let-418)

HSP 1 Score: 1281.93 bits (3316), Expect = 0.000e+0
Identity = 657/1225 (53.63%), Postives = 845/1225 (68.98%), Query Frame = -1
Query: 1136 EQEEANKKKTLHHRTTSKYPLMSGYDTDHQDYCEVCQQGGEIMLCDTCPRAFHLVCLDPELEEAPEGSWSCPHCEKEGVVAASRSTTPATGGDMSQNPQNIRKSAQPNEEEKDEHQEFCNECKDGGDLICCAKCPVSYHPECLYPPLSEIP-EGPWLCPRCGCGPLKAKVHKILTWRWMEPPKGKD-ELDHTHKSTEVEKNPTGGHGRQRAPMREFFVKFRDLSYWNCEWLTELQLDVHHPILLRNYFKKNDMDEPPAPEDGSTYKGRAREKVADPHNLEERFYKWSVRPEWMQIHRIIDHMTHRNNSIWYLIKWRDLAYDECTWEQLD---GEYEVIDMKHLVEEYHIMRKLFTGDIYK--KKFKNSSXXXXXXXXXXXXXXPTTDLKKRMSKQPDYIEETGGKLHQYQLEGLNWLRFSFGNVVDTILADEMGLGKTIQTITFLYSLYKEGHSKGPFLVAAPLSTVINWEREFEFWAPDFYVVTYVGDKDSRAVVREHEFSYEEGAMRTSKHACRMRQGTRTKFHVLLTSYELISIDQALLGSISWEVLVVDEAHRLKNNQSKFFRILSSYKINYKLLLTGTPLQNNLEELFHLLHFMTPEKFNDMQGFLDEFADISKEEQVKRLHEILGEHLLRRLKADVLTDMPSKGEFIVRVELSPMQAKFYKYILTRNFDALSVKGGGSQISLINIVMDLKKCCNHPYLFPSGSDEAPKLRNGAYEGLALIKASGKLELLYKMLPKLKTGGHRVLIFSQMTRLLDILEDFMDYMGYKFERIDGAVTGQQRQDSIDRFNAPDSVSFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQSNKVMIYRFVTRNTVEERVTQVAKKKMMLTHLVVRPGLGGKGGASMSKKELDEILKFGTEDLFKE---KDENEDDHK-------IVYDDGAIDRLIDRSQ-------QGIEEKEDMMTDYLSSFKVAHYSKREVSVNXXXXXXXXXETRGEIIKQDLDPADPTYWEKLLRHHYEQDQEDLSKSLGKGKRIRKQVNYSATQQEDDNW------------NDAVGDSDHESGSINKEEDDEEYDESRGEIIGTRRSKRERDGTKMPPLLVKVNGQLEVLGFNVRQRKAFINAVMRYGLPPMDFINSHWMVRELRCKSDRVMRAYINLFLRHLCEPESDNTDCYSDQVPREGVSRQHVLTRIGIMAVVRKKVQEFEKINGQYS 4702
            E+EE  K      R   K  L  G + ++ DYCE C+Q GE++LCDTCPRA+H VC+D  +EE PEG WSC HC + G                   P+ ++      EE   ++ EFC  CK+  +L+ C  C  S+H  C+ PPL+E+P E  W CPRC     + K+ KIL WRW E P  +  E      S +    P      +R   REFFVK++ LSYW C W++E+ L+VH  +L+  Y++KND D PP  E+  T +  +     DP+ L ERFY++ ++PEWMQIHRII+H ++  +   YL+KW++L+YD+ TWE+ D     YE   +K+       + +    ++ K   K + +        +K   +    D++K+   QPDY+ ETGGKLH YQLEGLNWLR  + N  D ILADEMGLGKT+Q++TFLYSL KEGH KGPFL+AAPLST+INWERE E W PDFYVVTYVG +D+R V+REHEFS+ EGA+R+   A +M+     KFHVLLTSYE I++D+ +L SI W  LVVDEAHRLKNNQS FF+ L+ Y I+Y++LLTGTPLQNNLEELFHLL+F++ E+FN ++ F  EF +ISKE+Q+++LH +LG H+LRRLKADVLT MPSK E IVRVELS MQ K+YK ILTRNFDAL+VK GG+Q+SL+N++M+LKKCCNHPYLF     EAPK +NG YEG ALIK SGK  LL KML KLK GGHRVLIFSQMTR+LDI+ED  +Y GY++ERIDG++ GQ RQD+IDR+NAP +  F+FLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHR+GQ +KVMIYRFVT+ +VEE++T VAKKKM+L HLVVR GLGGK G +MSK ELD++L++GTE+LF E     E E   K       IV+DD A+D L+DRS        +  EEK +   +YLSSFKVA Y  +E         +++EE   E+IK+D    DP YWEKLL+HHYEQD+E   + LGKGKR+RKQ+NY A++    +W            N++   SD+  G +N +EDD  YDE         + KR RD  KMPPL+ KVNGQ+E+LGFN RQRKAF  AVMR+G+PP D   S W+VR+LR KS++V RAY +LF+RHLCEP +D  D ++D VPREG++RQHVL RIG++++VR+KVQEFE+ NGQ+S
Sbjct:  227 EREEKKKGALEAARAAKKAKLEKGEEAENNDYCEECKQDGELLLCDTCPRAYHTVCIDENMEEPPEGDWSCAHCIEHG-------------------PEVVK------EEPAKQNDEFCKICKETENLLLCDSCVCSFHAYCIDPPLTEVPKEETWSCPRCETVKPEHKIEKILCWRWKEIPYPEPLEAGKEASSDDAMLKPPRKMEPRRE--REFFVKWKYLSYWQCSWVSEMLLEVHFRMLILLYWRKNDSDAPPEFEESVTSRHHSDN---DPYKLRERFYQYGIKPEWMQIHRIINHQSYAKSQQDYLVKWKELSYDQATWERDDSNIANYEEAIIKYWQHRESKLNEDIPKNVQKMIAKHREAKGLPPKEDEKKKKKREKIDIRKKYEVQPDYVTETGGKLHPYQLEGLNWLRHCWSNGTDAILADEMGLGKTVQSLTFLYSLMKEGHCKGPFLIAAPLSTIINWEREAEQWCPDFYVVTYVGLRDARVVLREHEFSFVEGAVRSGPKASKMKTTENMKFHVLLTSYETINMDKTILSSIEWGALVVDEAHRLKNNQSLFFKNLNEYTIHYRVLLTGTPLQNNLEELFHLLNFLSKERFNQLEAFTAEFNEISKEDQIEKLHNLLGPHMLRRLKADVLTGMPSKSELIVRVELSAMQKKWYKNILTRNFDALNVKNGGTQMSLMNVLMELKKCCNHPYLFVKAELEAPKEKNGMYEGTALIKNSGKFVLLQKMLRKLKDGGHRVLIFSQMTRMLDIMEDLCEYEGYRYERIDGSIMGQMRQDAIDRYNAPGAQQFIFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRLGQKHKVMIYRFVTKKSVEEKITSVAKKKMLLNHLVVRAGLGGKEGKTMSKTELDDVLRWGTEELFSEDLDAAEGEGSEKKGAAAQEIVWDDAAVDALLDRSNKEETPAGEDGEEKAEWQNEYLSSFKVASYQTKETEGQ-----EEEEEEETEVIKEDEKEPDPDYWEKLLKHHYEQDREIELQKLGKGKRVRKQINY-ASENMGTDWSKQNQTQDDDDDNESYRGSDNGDG-LNSDEDD--YDE---------KKKRRRDEEKMPPLMAKVNGQVEILGFNPRQRKAFYGAVMRWGMPPQDSHQSQWLVRDLRNKSEKVFRAYASLFMRHLCEPGADGHDTFNDGVPREGLNRQHVLGRIGLLSLVRRKVQEFEQYNGQWS 1403          

HSP 2 Score: 204.142 bits (518), Expect = 4.282e-52
Identity = 107/207 (51.69%), Postives = 147/207 (71.01%), Query Frame = -1
Query:  266 FMFNIADGGFTELHTIWQNEQRALVEGHEQDIWHRKHDYWLLAGVVAHGYGRWQ----DIHNDVRFAIVNEPFRNEQQKPNYLEIKNRFLARRFKLLEQALTIEEQLRRAAQLNLTYAPNDQVQNLNRRFTELECLATSQQNVYTEAVQGNKTLVPVLHRVLTQLEDLLSDMKQDXXXXXXXXXXXXXXSQRLNLTQTNLIQKLTVQ 874
            F FNI DGGFTELH++W NE++    G E +IW+R+HDYWLLAGVV HGYGR+Q    DI ND RF+++NEPF+    +    +IK +F+ RRFKL+EQ+L IEEQLRRAA  N    P D V  L +RF +LE +A SQ N+  E+  GN+    VLH+ L QL+++LSDMK DV+RLP++  +LA V++RLN+T+  ++ +LT +
Sbjct: 1496 FKFNICDGGFTELHSLWANEEKVARNGKEYEIWYRRHDYWLLAGVVVHGYGRFQANFNDIINDPRFSVLNEPFKEVGAEATGSDIKAKFMQRRFKLIEQSLVIEEQLRRAAHANRHLQP-DNVGPLAQRFADLENIAESQANIAKESSAGNRNANAVLHKTLVQLDEILSDMKADVSRLPSTFTQLATVTERLNMTERQILSRLTTK 1701          
BLAST of chromodomain helicase DNA-binding protein 4 vs. Ensembl Celegans
Match: chd-1 (Chromodomain and Helicase Domain protein [Source:UniProtKB/TrEMBL;Acc:O17909])

HSP 1 Score: 494.582 bits (1272), Expect = 1.635e-145
Identity = 316/829 (38.12%), Postives = 472/829 (56.94%), Query Frame = -1
Query: 1850 CPRCGCGPLKAKVHKILTWRWMEPPKGKDELDHTHKSTEVEKNPTGGHGRQRAP----MREFFVKFRDLSYWNCEWLTELQLDVHHPILLR---NYFKKNDMDEPPAPEDGSTYKGRAREKVADPHNLEERFYKWSVRPEWMQIHRIIDHMTHRNNS------IWYLIKWRDLAYDECTWEQLDGEYEVIDMKHLVEEYHIMRKLFTGDIYKKKFKNSSXXXXXXXXXXXXXXPTTDLKKR-----MSKQPDYIE---ETGGKLHQYQLEGLNWLRFSFGNVVDTILADEMGLGKTIQTITFLYSLYKEGHSKGPFLVAAPLSTVINWEREFEFWAPDFYVVTYVGDKDSRAVVREHEFSYEEGAMRTSKHACRMRQGTRTKFHVLLTSYELISIDQALLGSISWEVLVVDEAHRLKNNQSKFFRILSSYKINYKLLLTGTPLQNNLEELFHLLHFMTPEKFNDMQGFLDEFADISKEEQVKRLHEILGEHLLRRLKADVLTDMPSKGEFIVRVELSPMQAKFYKYILTRNFDALSVKGGGSQISLINIVMDLKKCCNHPYLFPSGSDEAPKLRNGAYEGLA-LIKASGKLELLYKMLPKLKTGGHRVLIFSQMTRLLDILEDFMDYMGYKFERIDGAVTGQQRQDSIDRFNAPDSVSFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQSNKVMIYRFVTRNTVEERVTQVAKKKMMLTHLVV-RPGLGGK----------GGASMSKKELDEILKFGTEDLFKEKDENEDDHKIVYDDGAIDRLIDRSQQGIEEKEDMM-TDYLSSFKVAHYS 4234
             P  G   L   V +++ WR   P         T  +T        G    + P     ++FFVK+   S+ +  W +E  L + +   L+   NY KK         ++   +K  A ++  +    E++  +  +  E+ ++ R++ H T R+ +        YLIKW  L Y +CTWE    + +++  + +   YH +  L      K   KNS++                 L+KR         PD+++   E+  KL  YQLEGLNW+ +++     +ILADEMGLGKTIQ+I+ L SL+      GP+LV  PLST+  W++EF  WAP+  +V Y+GD  SR ++R++E+    G  +            + K + +LT+YE++  D+A L SI W  L+VDEAHRLKN++S  ++ L+ ++ N+KLL+TGTPLQN+L+EL+ LLHF+ PEKF+  + F +   + S  + +  LH+ L   LLRR+K DV   +P K E I+RV+++  Q +FYK+ILT+N+  LS    GS    +N+VM+LKKCCNH  L    + +   + + A   L  L+K+SGKL LL K+L +LK  GHRVLIFSQM  +LDIL++++    +  +R+DG++    R+ ++D +NAP S  F FLLSTRAGGLGINLATADTVII+DSDWNP ND+QA SRAHRIGQ+  V IYR VT+ +VEE + + AK+K++L HLV+ R    GK          G     K+EL  ILKFG  +LFKEK+  E + ++      IDR++  ++    E+E M   + LSSFK A+++
Sbjct:  185 VPAEGPAILTETVERVIKWRHGVP-------GATGSATTCYNIADKGDPNDQIPGDKTEQQFFVKWTGWSHLHNTWESENSLALMNAKGLKKVQNYVKKQ--------KEVEMWKRSADKEYIEFFECEQQMAE-ELCEEYKKVERVVAHQTSRDRAADGSMATEYLIKWSGLPYSDCTWE----DEKMVAPEQIKAYYHRIENL------KSPNKNSNV-----------------LRKRPKFEKFESMPDFLKTDGESTHKLRDYQLEGLNWMVYAWCKGNSSILADEMGLGKTIQSISLLASLFHRYDLAGPYLVVVPLSTMAAWQKEFAQWAPEMNLVVYMGDVVSRDMIRQYEWFV--GGTK------------KMKINAILTTYEILLKDKAFLSSIDWAALLVDEAHRLKNDESLLYKSLTQFRFNHKLLITGTPLQNSLKELWALLHFIMPEKFDCWEEF-ETAHNESNHKGISALHKKLEPFLLRRVKKDVEKSLPPKTEQILRVDMTAHQKQFYKWILTKNYRELSKGVKGSINGFVNLVMELKKCCNHASL----TRQYDHIYDDAQGRLQQLLKSSGKLILLDKLLCRLKDKGHRVLIFSQMVMMLDILQEYLQLRRFPSQRLDGSMRADLRKQALDHYNAPGSTDFAFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAMSRAHRIGQTKTVNIYRLVTKGSVEEEIVERAKRKLVLDHLVIQRMDTTGKTVLSKNATASGSVPFDKQELSAILKFGAVELFKEKEGEEQEPEV-----DIDRILMGAETREAEEEVMKENELLSSFKYANFA 946          
BLAST of chromodomain helicase DNA-binding protein 4 vs. Ensembl Celegans
Match: chd-7 (Chromodomain and Helicase Domain protein [Source:UniProtKB/TrEMBL;Acc:O61845])

HSP 1 Score: 476.863 bits (1226), Expect = 2.070e-135
Identity = 310/862 (35.96%), Postives = 455/862 (52.78%), Query Frame = -1
Query: 1583 EFFVKFRDLSYWNCEWLTE---LQLDVHHPILLRNYFKKNDMDEPPAPEDGSTYKGRAREKVADPHNLEERFYKWSVRPEWMQIHRIIDHMTHRNNSIWYLIKWRDLAYDECTWEQLD----------GEYEVIDMKHLVE----EYHIMRKLFTGDIYKKKFKNSSXXXXXXXXXXXXXXPTTDLKKRMSKQPDYIEETGGKLHQYQLEGLNWLRFSFGNVVDTILADEMGLGKTIQTITFLYSLYKEGHSKGPFLVAAPLSTVINWEREFEFWAPDFYVVTYVGDKDSRAVVREHEFSYEEGAMRTSKHACRMRQGTR--TKFHVLLTSYELISIDQALLGSISWEVLVVDEAHRLKNNQSKFF-RILSSYKINYKLLLTGTPLQNNLEELFHLLHFMTPEKFNDMQGFLDEFADISKEEQVKRLHEILGEHLLRRLKADVLTDMPSKGEFIVRVELSPMQAKFYKYILTRNFDALSVKGGGSQISLINIVMDLKKCCNHPYLFPSGSDEA---------PKLRNGAYEGLALIKASGKLELLYKMLPKLKTGGHRVLIFSQMTRLLDILEDFMDYMGYKFERIDGAVTGQQRQDSIDRFNAPDSVSFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQSNKVMIYRFVTRNTVEERVTQVAKKKMMLTHLVVRPGLGGKG-GASMSKKELDEILKFGTEDLFKEKDENEDDHKIVYDDGAIDRLIDRSQQGI--EEKEDMMTDYLSSFKVAHYSKREVSVNXXXXXXXXXETRGEIIKQDLDPADPTYWEKLLRHHYEQDQEDLSKSLGK--GKRIRKQVNYSATQQEDDNWNDAVGDSDHESGS 4066
            +F +K++  SY +CEW T    L++D      ++  FK   M         S+Y       + D  +    F         + + R++D +T  +   + LIKW+ L Y+E TWE ++           E +VID   + E    E    +K+ T  ++K                                        G  L +YQ EG++WL + + N  + ILADEMGLGKT+QTITFL  +Y  G   GPFLV  PLST+ NW REFE W  D   + Y G   +R V++++E  Y+       K  C  +   +   K   L+T++E +  D   L  I W V V+DEAHRLKN   K     L ++++ +++LLTGTPLQNN++ELF LL+F+ P++F++   FL++F     ++QV++L EIL   +LRRLK DV   +  K E I+ V+LS MQ KFY+ IL RNF  L    G S  SL+N++M+L+KCCNHP+L  +G++EA         P          ALI+ASGK+ L+ K+LPKL+  GH+VLIFSQM ++LD+LE+F+  M Y FERIDG V G  RQ +IDRF+  +S  FVFLL TRAGGLGINL  ADTVII+DSDWNP ND+QA +R HRIGQ   V +YR +T NT E  +   A  K+ L   V++     K  G ++SKK+++E+LK G      + +ENE      +++  I+ ++ R  Q I  E  +       ++F  +H                    +G+    D+D  DP +W K      E+ Q D+ K+     G+ +  +     T++ ++N ++   D   ESG+
Sbjct: 1059 QFLIKWKGRSYVHCEWKTAAELLEIDKRVEAKIKR-FKVKKM---------SSY-------IEDDEDFNSDF---------VIVDRVVDLITEDDGQEFVLIKWKSLGYEEVTWEPIEMIPADKVELWRERQVIDPAKIREKQRPEPEEWKKMSTSKVWK---------------------------------------NGNSLREYQFEGVDWLLYCYYNAQNCILADEMGLGKTVQTITFLSRIYDYG-IHGPFLVVVPLSTIQNWVREFETWT-DMNAIVYHGSAYAREVLQQYEVFYD-------KRHCGAKNWKKNFVKIDALITTFETVVSDVEFLKKIPWRVCVIDEAHRLKNRNCKLLVNGLLAFRMEHRVLLTGTPLQNNIDELFSLLNFLHPQQFDNSATFLEQFGSCQTDDQVQKLQEILKPMMLRRLKEDVEKSLGPKEETIIEVQLSDMQKKFYRAILERNFSHLC--KGTSAPSLMNVMMELRKCCNHPFLI-NGAEEAIMNDFRLAHPDWDEETLAHKALIQASGKVVLIEKLLPKLRKDGHKVLIFSQMVKVLDLLEEFLISMSYPFERIDGNVRGDLRQAAIDRFSKENSDRFVFLLCTRAGGLGINLTAADTVIIFDSDWNPQNDLQAQARCHRIGQKKLVKVYRLITSNTYEREMFDKASLKLGLDKAVLQSTTALKAEGTALSKKDVEELLKKGAYGSIMD-EENESSK---FNEEDIETILQRRTQTITLEAGQKGSLFAKATFNSSH-------------------NKGD----DIDIDDPEFWTKWA----EKAQVDVEKATATPDGRELIIEEPRKRTKRFEENKDEGDSDGSEESGN 1812          
BLAST of chromodomain helicase DNA-binding protein 4 vs. Ensembl Celegans
Match: isw-1 (Chromatin-remodeling complex ATPase chain isw-1 [Source:UniProtKB/Swiss-Prot;Acc:P41877])

HSP 1 Score: 399.053 bits (1024), Expect = 5.252e-117
Identity = 212/522 (40.61%), Postives = 315/522 (60.34%), Query Frame = -1
Query: 1991 KQPDYIEETGGKLHQYQLEGLNWLRFSFGNVVDTILADEMGLGKTIQTITFLYSLYKEGHSKGPFLVAAPLSTVINWEREFEFWAPDFYVVTYVGDKDSR-AVVREHEFSYEEGAMRTSKHACRMRQGTRTKFHVLLTSYELISIDQALLGSISWEVLVVDEAHRLKNNQSKFFRILSSYKINYKLLLTGTPLQNNLEELFHLLHFMTPEKFNDMQGFLDEFADIS---KEEQVKRLHEILGEHLLRRLKADVLTDMPSKGEFIVRVELSPMQAKFYKYILTRNFDALSVKGGGSQISLINIVMDLKKCCNHPYLFPSGSDEAPKLRNGAYEGLALIKASGKLELLYKMLPKLKTGGHRVLIFSQMTRLLDILEDFMDYMGYKFERIDGAVTGQQRQDSIDRFNAPDSVSFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQSNKVMIYRFVTRNTVEERVTQVAKKKMMLTHLVVRPGLGGKGGASMSKKELDEILKFGTEDLFKEK 3544
            K P YIE   G++  YQ+ GLNWL     N ++ ILADEMGLGKT+QTI+ +  +    +   P LV  P ST+ NW  EF+ W P    V  +GD+ +R  V+R+                         KF V  T+YE++   +  L  ++W  +++DEAHR+KN +SK    +       +LL+TGTPLQNNL EL+ LL+F+ P+ F     F   F++ +     + V+RLH++L   LLRR+K+DV   +  K E  V V LS MQ ++Y  +L ++ D ++  G   +  L+NI+M L+KC NHPYLF  G++  P      +    L+  SGK+ +L K+L K K  G RVLIFSQ +R+LD+LEDF  +  Y++ R+DG+   + R ++I+ +NAPDS  F+F+L+TRAGGLGINLATAD VIIYDSDWNP +D+QA  RAHRIGQ  +V ++R +T NTV+ER+ + A+ K+ L ++V++ G   +   ++ K ++  +++ G E +F  K
Sbjct:  122 KSPFYIE--NGEMRDYQVRGLNWLASLQHNKINGILADEMGLGKTLQTISMIGYMKHYKNKASPHLVIVPKSTLQNWANEFKKWCPSINAVVLIGDEAARNQVLRDVILP--------------------QKFDVCCTTYEMMLKVKTQLKKLNWRYIIIDEAHRIKNEKSKLSETVRELNSENRLLITGTPLQNNLHELWALLNFLLPDIFTSSDDFDSWFSNDAMSGNTDLVQRLHKVLQPFLLRRIKSDVEKSLLPKKEVKVYVGLSKMQREWYTKVLMKDIDIINGAGKVEKARLMNILMHLRKCVNHPYLF-DGAEPGPPFTTDQH----LVDNSGKMVVLDKLLMKFKEQGSRVLIFSQFSRMLDLLEDFCWWRHYEYCRLDGSTPHEDRSNAIEAYNAPDSKKFIFMLTTRAGGLGINLATADVVIIYDSDWNPQSDLQAMDRAHRIGQKKQVRVFRLITENTVDERIIEKAEAKLRLDNIVIQQGRMSEAQKTLGKGDMISMIRHGAEQVFAAK 616          
BLAST of chromodomain helicase DNA-binding protein 4 vs. Ensembl Fly
Match: Mi-2 (gene:FBgn0262519 transcript:FBtr0332152)

HSP 1 Score: 1388.25 bits (3592), Expect = 0.000e+0
Identity = 709/1204 (58.89%), Postives = 881/1204 (73.17%), Query Frame = -1
Query: 1136 YPLMSGYDTDHQDYCEVCQQGGEIMLCDTCPRAFHLVCLDPELEEAPEGSWSCPHCEKEGVVAASRSTTPATGGDMSQNPQNIRKSAQPNEEEKDEHQEFCNECKDGGDLICCAKCPVSYHPECLYPPLSEIPEGPWLCPRCGCGPLKAKVHKILTWRWMEPPKGKDELDHTHKSTEVEKNPTGGHGRQRAPMREFFVKFRDLSYWNCEWLTELQLDVHHPILLRNYFKKNDMDEPPAPEDG-----STYK--GRAREKVA-----DPHNLEERFYKWSVRPEWMQIHRIIDHMTHRNNSIWYLIKWRDLAYDECTWEQLDGEYEVIDMKHLVEEYHIMRKLFTGDIYKKKFKNSSXXXXXXXXXXXXX------------XPTTDLKKRMSKQPDYIEETGGKLHQYQLEGLNWLRFSFGNVVDTILADEMGLGKTIQTITFLYSLYKEGHSKGPFLVAAPLSTVINWEREFEFWAPDFYVVTYVGDKDSRAVVREHEFSYEEGAMRTSKHACRMRQGTRTKFHVLLTSYELISIDQALLGSISWEVLVVDEAHRLKNNQSKFFRILSSYKINYKLLLTGTPLQNNLEELFHLLHFMTPEKFNDMQGFLDEFADISKEEQVKRLHEILGEHLLRRLKADVLTDMPSKGEFIVRVELSPMQAKFYKYILTRNFDALSVKGGGSQISLINIVMDLKKCCNHPYLFPSGSDEAPKLRNGAYEGLALIKASGKLELLYKMLPKLKTGGHRVLIFSQMTRLLDILEDFMDYMGYKFERIDGAVTGQQRQDSIDRFNAPDSVSFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQSNKVMIYRFVTRNTVEERVTQVAKKKMMLTHLVVRPGLGGKGGASMSKKELDEILKFGTEDLFKEKDENEDDHKIVYDDGAIDRLIDRSQQGIEEKEDMMTDYLSSFKVAHYSKREVSVNXXXXXXXXXETRGEIIKQDLDPADPTYWEKLLRHHYEQDQEDLSKSLGKGKRIRKQVNY-------SATQQEDDNWNDAVG--DSDHESGSINKEEDDEEYDESRGEIIGTRRSKRERDGTKMPPLLVKVNGQLEVLGFNVRQRKAFINAVMRYGLPPMDFINSHWMVRELRCKSDRVMRAYINLFLRHLCEPESDNTDCYSDQVPREGVSRQHVLTRIGIMAVVRKKVQEFEKINGQYS 4648
            +P     + +HQDYCEVCQQGGEI+LCDTCPRA+HLVCL+PEL+E PEG WSCPHCE +G  A                                EHQEFC  CKDGG+L+CC  CP +YH  CL PPL  IP+G W CPRC C PL  K  KI+TWRW +  +  D+   T K          G     + +RE+F+K+ ++SYW+CEW+ E+QLDVHHP+++R++ +K DM+EPP  E+      + YK   R ++KV      D   LEERFYK  V+PEW+ + R+I+H T R+ S  YL+KWR+L YD+ TWE+ +G+ ++  ++  ++ Y  +R + T +  + + K S   ++  LK    E             PTTDLKK+   QP ++E TG +LH YQ+EG+NWLR+S+G  +DTILADEMGLGKTIQT+TFLYSLYKEGH +GPFLVA PLST++NWEREFE WAPDFY +TY+GDKDSRAV+RE+E S+EEGA+R SK   R+R  T+ KF+VLLTSYELIS+D A LGSI W VLVVDEAHRLK+NQSKFFRIL+SY I YKLLLTGTPLQNNLEELFHLL+F++ +KFND+Q F  EFAD+SKEEQVKRLHE+LG H+LRRLK DVL +MPSK EFIVRVELS MQ KFYK+ILT+N++AL+ K GG   SLINI+MDLKKCCNHPYLFPS ++EA     G YE  +L KA+GKL LL KML +LK   HRVLIFSQMT++LDILEDF++   YK+ERIDG +TG  RQ++IDRFNAP +  FVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQ+NKVMIYRFVTRN+VEERVTQVAK+KMMLTHLVVRPG+GGK GA+ +K+ELD+IL+FGTEDLFKE D+ E  H   YDD A+  L+DR+ +GIEEKE    +YLSSFKVA Y+ +E                 EIIKQD + +DP YW KLLRHHYEQ QED+ +SLGKGKR+RKQVNY       + T ++D NW D     +S++ +GS     DD+  D++  E    RR +R RD   +PPLL +V G +EVLGFN RQRK+F+NA+MRYG+PP D  NS W+VR+LR KS+R  +AY++LF+RHLCEP +DN + ++D VPREG+SRQHVLTRIG+M+++RKKVQEFE ING YS
Sbjct:  357 FPEGEDGEHEHQDYCEVCQQGGEIILCDTCPRAYHLVCLEPELDEPPEGKWSCPHCEADGGAAEEEDDD--------------------------EHQEFCRVCKDGGELLCCDSCPSAYHTFCLNPPLDTIPDGDWRCPRCSCPPLTGKAEKIITWRWAQ--RSNDDGPSTSK----------GSKNSNSRVREYFIKWHNMSYWHCEWVPEVQLDVHHPLMIRSFQRKYDMEEPPKFEESLDEADTRYKRIQRHKDKVGMKANDDAEVLEERFYKNGVKPEWLIVQRVINHRTARDGSTMYLVKWRELPYDKSTWEE-EGD-DIQGLRQAIDYYQDLRAVCTSETTQSRSKKSKKGRKSKLKVEDDEDRPVKHYTPPPEKPTTDLKKKYEDQPAFLEGTGMQLHPYQIEGINWLRYSWGQGIDTILADEMGLGKTIQTVTFLYSLYKEGHCRGPFLVAVPLSTLVNWEREFELWAPDFYCITYIGDKDSRAVIRENELSFEEGAIRGSK-VSRLRT-TQYKFNVLLTSYELISMDAACLGSIDWAVLVVDEAHRLKSNQSKFFRILNSYTIAYKLLLTGTPLQNNLEELFHLLNFLSRDKFNDLQAFQGEFADVSKEEQVKRLHEMLGPHMLRRLKTDVLKNMPSKSEFIVRVELSAMQKKFYKFILTKNYEALNSKSGGGSCSLINIMMDLKKCCNHPYLFPSAAEEATTAAGGLYEINSLTKAAGKLVLLSKMLKQLKAQNHRVLIFSQMTKMLDILEDFLEGEQYKYERIDGGITGTLRQEAIDRFNAPGAQQFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQANKVMIYRFVTRNSVEERVTQVAKRKMMLTHLVVRPGMGGK-GANFTKQELDDILRFGTEDLFKEDDKEEAIH---YDDKAVAELLDRTNRGIEEKESWANEYLSSFKVASYATKEEEEE----------EETEIIKQDAENSDPAYWVKLLRHHYEQHQEDVGRSLGKGKRVRKQVNYTDGGVVAADTTRDDSNWQDNGSEYNSEYSAGSDEDGGDDDFDDQNGAERKAKRRLER-RDDRPLPPLLARVGGNIEVLGFNARQRKSFLNAIMRYGMPPQDAFNSQWLVRDLRGKSERNFKAYVSLFMRHLCEPGADNAETFADGVPREGLSRQHVLTRIGVMSLIRKKVQEFEHINGYYS 1503          

HSP 2 Score: 264.233 bits (674), Expect = 2.671e-70
Identity = 133/213 (62.44%), Postives = 170/213 (79.81%), Query Frame = -1
Query:  269 ADECNKIVINKFMFNIADGGFTELHTIWQNEQRALVEGHEQDIWHRKHDYWLLAGVVAHGYGRWQDIHNDVRFAIVNEPFRNEQQKPNYLEIKNRFLARRFKLLEQALTIEEQLRRAAQLNLTYAPNDQVQNLNRRFTELECLATSQQNVYTEAVQGNKTLVPVLHRVLTQLEDLLSDMKQDXXXXXXXXXXXXXXSQRLNLTQTNLIQKLTV 907
            A++  +++  KFMFNIADGGFTELHT+W NE++A V G E +IWHR+HDYWLLAG+V HGYGRWQDI ND+RFAI+NEPF+ +  K N+LEIKN+FLARRFKLLEQAL IEEQLRRAA LNL   P+    +LN RF E+ECLA S Q++  E++ GNK    VLH+VL QLE+LLSDMK DV+RLPA+LAR+ PV+QRL +++ +++ +L  
Sbjct: 1707 AEDSLEVLKRKFMFNIADGGFTELHTLWLNEEKAAVPGREYEIWHRRHDYWLLAGIVTHGYGRWQDIQNDIRFAIINEPFKMDVGKGNFLEIKNKFLARRFKLLEQALVIEEQLRRAAYLNLAQDPSHPAMSLNARFAEVECLAESHQHLSKESLAGNKPANAVLHKVLNQLEELLSDMKSDVSRLPATLARIPPVAQRLQMSERSILSRLAA 1919          

HSP 3 Score: 54.299 bits (129), Expect = 2.241e-6
Identity = 22/70 (31.43%), Postives = 42/70 (60.00%), Query Frame = -3
Query: 5277 TVEGLCEEMGIANVEVSYRMDDFENWTIQRLFDQYMRPKLEEKNPHATSDDIQRVLDAKWKEFALLNPYI 5486
            +VE +C    + NVE+ Y  ++ ++ T  + F  ++RP L+++NP   +  +  ++ AKW+EF   NP+I
Sbjct:  114 SVEDVCSAFSVCNVEIEYSEEELQSLTTYKAFMHHVRPILQKENPKIAAPKLVMLVAAKWREFCESNPHI 183          
BLAST of chromodomain helicase DNA-binding protein 4 vs. Ensembl Fly
Match: Mi-2 (gene:FBgn0262519 transcript:FBtr0074919)

HSP 1 Score: 1388.25 bits (3592), Expect = 0.000e+0
Identity = 709/1204 (58.89%), Postives = 881/1204 (73.17%), Query Frame = -1
Query: 1136 YPLMSGYDTDHQDYCEVCQQGGEIMLCDTCPRAFHLVCLDPELEEAPEGSWSCPHCEKEGVVAASRSTTPATGGDMSQNPQNIRKSAQPNEEEKDEHQEFCNECKDGGDLICCAKCPVSYHPECLYPPLSEIPEGPWLCPRCGCGPLKAKVHKILTWRWMEPPKGKDELDHTHKSTEVEKNPTGGHGRQRAPMREFFVKFRDLSYWNCEWLTELQLDVHHPILLRNYFKKNDMDEPPAPEDG-----STYK--GRAREKVA-----DPHNLEERFYKWSVRPEWMQIHRIIDHMTHRNNSIWYLIKWRDLAYDECTWEQLDGEYEVIDMKHLVEEYHIMRKLFTGDIYKKKFKNSSXXXXXXXXXXXXX------------XPTTDLKKRMSKQPDYIEETGGKLHQYQLEGLNWLRFSFGNVVDTILADEMGLGKTIQTITFLYSLYKEGHSKGPFLVAAPLSTVINWEREFEFWAPDFYVVTYVGDKDSRAVVREHEFSYEEGAMRTSKHACRMRQGTRTKFHVLLTSYELISIDQALLGSISWEVLVVDEAHRLKNNQSKFFRILSSYKINYKLLLTGTPLQNNLEELFHLLHFMTPEKFNDMQGFLDEFADISKEEQVKRLHEILGEHLLRRLKADVLTDMPSKGEFIVRVELSPMQAKFYKYILTRNFDALSVKGGGSQISLINIVMDLKKCCNHPYLFPSGSDEAPKLRNGAYEGLALIKASGKLELLYKMLPKLKTGGHRVLIFSQMTRLLDILEDFMDYMGYKFERIDGAVTGQQRQDSIDRFNAPDSVSFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQSNKVMIYRFVTRNTVEERVTQVAKKKMMLTHLVVRPGLGGKGGASMSKKELDEILKFGTEDLFKEKDENEDDHKIVYDDGAIDRLIDRSQQGIEEKEDMMTDYLSSFKVAHYSKREVSVNXXXXXXXXXETRGEIIKQDLDPADPTYWEKLLRHHYEQDQEDLSKSLGKGKRIRKQVNY-------SATQQEDDNWNDAVG--DSDHESGSINKEEDDEEYDESRGEIIGTRRSKRERDGTKMPPLLVKVNGQLEVLGFNVRQRKAFINAVMRYGLPPMDFINSHWMVRELRCKSDRVMRAYINLFLRHLCEPESDNTDCYSDQVPREGVSRQHVLTRIGIMAVVRKKVQEFEKINGQYS 4648
            +P     + +HQDYCEVCQQGGEI+LCDTCPRA+HLVCL+PEL+E PEG WSCPHCE +G  A                                EHQEFC  CKDGG+L+CC  CP +YH  CL PPL  IP+G W CPRC C PL  K  KI+TWRW +  +  D+   T K          G     + +RE+F+K+ ++SYW+CEW+ E+QLDVHHP+++R++ +K DM+EPP  E+      + YK   R ++KV      D   LEERFYK  V+PEW+ + R+I+H T R+ S  YL+KWR+L YD+ TWE+ +G+ ++  ++  ++ Y  +R + T +  + + K S   ++  LK    E             PTTDLKK+   QP ++E TG +LH YQ+EG+NWLR+S+G  +DTILADEMGLGKTIQT+TFLYSLYKEGH +GPFLVA PLST++NWEREFE WAPDFY +TY+GDKDSRAV+RE+E S+EEGA+R SK   R+R  T+ KF+VLLTSYELIS+D A LGSI W VLVVDEAHRLK+NQSKFFRIL+SY I YKLLLTGTPLQNNLEELFHLL+F++ +KFND+Q F  EFAD+SKEEQVKRLHE+LG H+LRRLK DVL +MPSK EFIVRVELS MQ KFYK+ILT+N++AL+ K GG   SLINI+MDLKKCCNHPYLFPS ++EA     G YE  +L KA+GKL LL KML +LK   HRVLIFSQMT++LDILEDF++   YK+ERIDG +TG  RQ++IDRFNAP +  FVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQ+NKVMIYRFVTRN+VEERVTQVAK+KMMLTHLVVRPG+GGK GA+ +K+ELD+IL+FGTEDLFKE D+ E  H   YDD A+  L+DR+ +GIEEKE    +YLSSFKVA Y+ +E                 EIIKQD + +DP YW KLLRHHYEQ QED+ +SLGKGKR+RKQVNY       + T ++D NW D     +S++ +GS     DD+  D++  E    RR +R RD   +PPLL +V G +EVLGFN RQRK+F+NA+MRYG+PP D  NS W+VR+LR KS+R  +AY++LF+RHLCEP +DN + ++D VPREG+SRQHVLTRIG+M+++RKKVQEFE ING YS
Sbjct:  366 FPEGEDGEHEHQDYCEVCQQGGEIILCDTCPRAYHLVCLEPELDEPPEGKWSCPHCEADGGAAEEEDDD--------------------------EHQEFCRVCKDGGELLCCDSCPSAYHTFCLNPPLDTIPDGDWRCPRCSCPPLTGKAEKIITWRWAQ--RSNDDGPSTSK----------GSKNSNSRVREYFIKWHNMSYWHCEWVPEVQLDVHHPLMIRSFQRKYDMEEPPKFEESLDEADTRYKRIQRHKDKVGMKANDDAEVLEERFYKNGVKPEWLIVQRVINHRTARDGSTMYLVKWRELPYDKSTWEE-EGD-DIQGLRQAIDYYQDLRAVCTSETTQSRSKKSKKGRKSKLKVEDDEDRPVKHYTPPPEKPTTDLKKKYEDQPAFLEGTGMQLHPYQIEGINWLRYSWGQGIDTILADEMGLGKTIQTVTFLYSLYKEGHCRGPFLVAVPLSTLVNWEREFELWAPDFYCITYIGDKDSRAVIRENELSFEEGAIRGSK-VSRLRT-TQYKFNVLLTSYELISMDAACLGSIDWAVLVVDEAHRLKSNQSKFFRILNSYTIAYKLLLTGTPLQNNLEELFHLLNFLSRDKFNDLQAFQGEFADVSKEEQVKRLHEMLGPHMLRRLKTDVLKNMPSKSEFIVRVELSAMQKKFYKFILTKNYEALNSKSGGGSCSLINIMMDLKKCCNHPYLFPSAAEEATTAAGGLYEINSLTKAAGKLVLLSKMLKQLKAQNHRVLIFSQMTKMLDILEDFLEGEQYKYERIDGGITGTLRQEAIDRFNAPGAQQFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQANKVMIYRFVTRNSVEERVTQVAKRKMMLTHLVVRPGMGGK-GANFTKQELDDILRFGTEDLFKEDDKEEAIH---YDDKAVAELLDRTNRGIEEKESWANEYLSSFKVASYATKEEEEE----------EETEIIKQDAENSDPAYWVKLLRHHYEQHQEDVGRSLGKGKRVRKQVNYTDGGVVAADTTRDDSNWQDNGSEYNSEYSAGSDEDGGDDDFDDQNGAERKAKRRLER-RDDRPLPPLLARVGGNIEVLGFNARQRKSFLNAIMRYGMPPQDAFNSQWLVRDLRGKSERNFKAYVSLFMRHLCEPGADNAETFADGVPREGLSRQHVLTRIGVMSLIRKKVQEFEHINGYYS 1512          

HSP 2 Score: 264.233 bits (674), Expect = 2.579e-70
Identity = 133/213 (62.44%), Postives = 170/213 (79.81%), Query Frame = -1
Query:  269 ADECNKIVINKFMFNIADGGFTELHTIWQNEQRALVEGHEQDIWHRKHDYWLLAGVVAHGYGRWQDIHNDVRFAIVNEPFRNEQQKPNYLEIKNRFLARRFKLLEQALTIEEQLRRAAQLNLTYAPNDQVQNLNRRFTELECLATSQQNVYTEAVQGNKTLVPVLHRVLTQLEDLLSDMKQDXXXXXXXXXXXXXXSQRLNLTQTNLIQKLTV 907
            A++  +++  KFMFNIADGGFTELHT+W NE++A V G E +IWHR+HDYWLLAG+V HGYGRWQDI ND+RFAI+NEPF+ +  K N+LEIKN+FLARRFKLLEQAL IEEQLRRAA LNL   P+    +LN RF E+ECLA S Q++  E++ GNK    VLH+VL QLE+LLSDMK DV+RLPA+LAR+ PV+QRL +++ +++ +L  
Sbjct: 1716 AEDSLEVLKRKFMFNIADGGFTELHTLWLNEEKAAVPGREYEIWHRRHDYWLLAGIVTHGYGRWQDIQNDIRFAIINEPFKMDVGKGNFLEIKNKFLARRFKLLEQALVIEEQLRRAAYLNLAQDPSHPAMSLNARFAEVECLAESHQHLSKESLAGNKPANAVLHKVLNQLEELLSDMKSDVSRLPATLARIPPVAQRLQMSERSILSRLAA 1928          

HSP 3 Score: 54.299 bits (129), Expect = 2.223e-6
Identity = 22/70 (31.43%), Postives = 42/70 (60.00%), Query Frame = -3
Query: 5277 TVEGLCEEMGIANVEVSYRMDDFENWTIQRLFDQYMRPKLEEKNPHATSDDIQRVLDAKWKEFALLNPYI 5486
            +VE +C    + NVE+ Y  ++ ++ T  + F  ++RP L+++NP   +  +  ++ AKW+EF   NP+I
Sbjct:  123 SVEDVCSAFSVCNVEIEYSEEELQSLTTYKAFMHHVRPILQKENPKIAAPKLVMLVAAKWREFCESNPHI 192          
BLAST of chromodomain helicase DNA-binding protein 4 vs. Ensembl Fly
Match: Mi-2 (gene:FBgn0262519 transcript:FBtr0302046)

HSP 1 Score: 1388.25 bits (3592), Expect = 0.000e+0
Identity = 709/1204 (58.89%), Postives = 881/1204 (73.17%), Query Frame = -1
Query: 1136 YPLMSGYDTDHQDYCEVCQQGGEIMLCDTCPRAFHLVCLDPELEEAPEGSWSCPHCEKEGVVAASRSTTPATGGDMSQNPQNIRKSAQPNEEEKDEHQEFCNECKDGGDLICCAKCPVSYHPECLYPPLSEIPEGPWLCPRCGCGPLKAKVHKILTWRWMEPPKGKDELDHTHKSTEVEKNPTGGHGRQRAPMREFFVKFRDLSYWNCEWLTELQLDVHHPILLRNYFKKNDMDEPPAPEDG-----STYK--GRAREKVA-----DPHNLEERFYKWSVRPEWMQIHRIIDHMTHRNNSIWYLIKWRDLAYDECTWEQLDGEYEVIDMKHLVEEYHIMRKLFTGDIYKKKFKNSSXXXXXXXXXXXXX------------XPTTDLKKRMSKQPDYIEETGGKLHQYQLEGLNWLRFSFGNVVDTILADEMGLGKTIQTITFLYSLYKEGHSKGPFLVAAPLSTVINWEREFEFWAPDFYVVTYVGDKDSRAVVREHEFSYEEGAMRTSKHACRMRQGTRTKFHVLLTSYELISIDQALLGSISWEVLVVDEAHRLKNNQSKFFRILSSYKINYKLLLTGTPLQNNLEELFHLLHFMTPEKFNDMQGFLDEFADISKEEQVKRLHEILGEHLLRRLKADVLTDMPSKGEFIVRVELSPMQAKFYKYILTRNFDALSVKGGGSQISLINIVMDLKKCCNHPYLFPSGSDEAPKLRNGAYEGLALIKASGKLELLYKMLPKLKTGGHRVLIFSQMTRLLDILEDFMDYMGYKFERIDGAVTGQQRQDSIDRFNAPDSVSFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQSNKVMIYRFVTRNTVEERVTQVAKKKMMLTHLVVRPGLGGKGGASMSKKELDEILKFGTEDLFKEKDENEDDHKIVYDDGAIDRLIDRSQQGIEEKEDMMTDYLSSFKVAHYSKREVSVNXXXXXXXXXETRGEIIKQDLDPADPTYWEKLLRHHYEQDQEDLSKSLGKGKRIRKQVNY-------SATQQEDDNWNDAVG--DSDHESGSINKEEDDEEYDESRGEIIGTRRSKRERDGTKMPPLLVKVNGQLEVLGFNVRQRKAFINAVMRYGLPPMDFINSHWMVRELRCKSDRVMRAYINLFLRHLCEPESDNTDCYSDQVPREGVSRQHVLTRIGIMAVVRKKVQEFEKINGQYS 4648
            +P     + +HQDYCEVCQQGGEI+LCDTCPRA+HLVCL+PEL+E PEG WSCPHCE +G  A                                EHQEFC  CKDGG+L+CC  CP +YH  CL PPL  IP+G W CPRC C PL  K  KI+TWRW +  +  D+   T K          G     + +RE+F+K+ ++SYW+CEW+ E+QLDVHHP+++R++ +K DM+EPP  E+      + YK   R ++KV      D   LEERFYK  V+PEW+ + R+I+H T R+ S  YL+KWR+L YD+ TWE+ +G+ ++  ++  ++ Y  +R + T +  + + K S   ++  LK    E             PTTDLKK+   QP ++E TG +LH YQ+EG+NWLR+S+G  +DTILADEMGLGKTIQT+TFLYSLYKEGH +GPFLVA PLST++NWEREFE WAPDFY +TY+GDKDSRAV+RE+E S+EEGA+R SK   R+R  T+ KF+VLLTSYELIS+D A LGSI W VLVVDEAHRLK+NQSKFFRIL+SY I YKLLLTGTPLQNNLEELFHLL+F++ +KFND+Q F  EFAD+SKEEQVKRLHE+LG H+LRRLK DVL +MPSK EFIVRVELS MQ KFYK+ILT+N++AL+ K GG   SLINI+MDLKKCCNHPYLFPS ++EA     G YE  +L KA+GKL LL KML +LK   HRVLIFSQMT++LDILEDF++   YK+ERIDG +TG  RQ++IDRFNAP +  FVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQ+NKVMIYRFVTRN+VEERVTQVAK+KMMLTHLVVRPG+GGK GA+ +K+ELD+IL+FGTEDLFKE D+ E  H   YDD A+  L+DR+ +GIEEKE    +YLSSFKVA Y+ +E                 EIIKQD + +DP YW KLLRHHYEQ QED+ +SLGKGKR+RKQVNY       + T ++D NW D     +S++ +GS     DD+  D++  E    RR +R RD   +PPLL +V G +EVLGFN RQRK+F+NA+MRYG+PP D  NS W+VR+LR KS+R  +AY++LF+RHLCEP +DN + ++D VPREG+SRQHVLTRIG+M+++RKKVQEFE ING YS
Sbjct:  366 FPEGEDGEHEHQDYCEVCQQGGEIILCDTCPRAYHLVCLEPELDEPPEGKWSCPHCEADGGAAEEEDDD--------------------------EHQEFCRVCKDGGELLCCDSCPSAYHTFCLNPPLDTIPDGDWRCPRCSCPPLTGKAEKIITWRWAQ--RSNDDGPSTSK----------GSKNSNSRVREYFIKWHNMSYWHCEWVPEVQLDVHHPLMIRSFQRKYDMEEPPKFEESLDEADTRYKRIQRHKDKVGMKANDDAEVLEERFYKNGVKPEWLIVQRVINHRTARDGSTMYLVKWRELPYDKSTWEE-EGD-DIQGLRQAIDYYQDLRAVCTSETTQSRSKKSKKGRKSKLKVEDDEDRPVKHYTPPPEKPTTDLKKKYEDQPAFLEGTGMQLHPYQIEGINWLRYSWGQGIDTILADEMGLGKTIQTVTFLYSLYKEGHCRGPFLVAVPLSTLVNWEREFELWAPDFYCITYIGDKDSRAVIRENELSFEEGAIRGSK-VSRLRT-TQYKFNVLLTSYELISMDAACLGSIDWAVLVVDEAHRLKSNQSKFFRILNSYTIAYKLLLTGTPLQNNLEELFHLLNFLSRDKFNDLQAFQGEFADVSKEEQVKRLHEMLGPHMLRRLKTDVLKNMPSKSEFIVRVELSAMQKKFYKFILTKNYEALNSKSGGGSCSLINIMMDLKKCCNHPYLFPSAAEEATTAAGGLYEINSLTKAAGKLVLLSKMLKQLKAQNHRVLIFSQMTKMLDILEDFLEGEQYKYERIDGGITGTLRQEAIDRFNAPGAQQFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQANKVMIYRFVTRNSVEERVTQVAKRKMMLTHLVVRPGMGGK-GANFTKQELDDILRFGTEDLFKEDDKEEAIH---YDDKAVAELLDRTNRGIEEKESWANEYLSSFKVASYATKEEEEE----------EETEIIKQDAENSDPAYWVKLLRHHYEQHQEDVGRSLGKGKRVRKQVNYTDGGVVAADTTRDDSNWQDNGSEYNSEYSAGSDEDGGDDDFDDQNGAERKAKRRLER-RDDRPLPPLLARVGGNIEVLGFNARQRKSFLNAIMRYGMPPQDAFNSQWLVRDLRGKSERNFKAYVSLFMRHLCEPGADNAETFADGVPREGLSRQHVLTRIGVMSLIRKKVQEFEHINGYYS 1512          

HSP 2 Score: 264.233 bits (674), Expect = 2.579e-70
Identity = 133/213 (62.44%), Postives = 170/213 (79.81%), Query Frame = -1
Query:  269 ADECNKIVINKFMFNIADGGFTELHTIWQNEQRALVEGHEQDIWHRKHDYWLLAGVVAHGYGRWQDIHNDVRFAIVNEPFRNEQQKPNYLEIKNRFLARRFKLLEQALTIEEQLRRAAQLNLTYAPNDQVQNLNRRFTELECLATSQQNVYTEAVQGNKTLVPVLHRVLTQLEDLLSDMKQDXXXXXXXXXXXXXXSQRLNLTQTNLIQKLTV 907
            A++  +++  KFMFNIADGGFTELHT+W NE++A V G E +IWHR+HDYWLLAG+V HGYGRWQDI ND+RFAI+NEPF+ +  K N+LEIKN+FLARRFKLLEQAL IEEQLRRAA LNL   P+    +LN RF E+ECLA S Q++  E++ GNK    VLH+VL QLE+LLSDMK DV+RLPA+LAR+ PV+QRL +++ +++ +L  
Sbjct: 1716 AEDSLEVLKRKFMFNIADGGFTELHTLWLNEEKAAVPGREYEIWHRRHDYWLLAGIVTHGYGRWQDIQNDIRFAIINEPFKMDVGKGNFLEIKNKFLARRFKLLEQALVIEEQLRRAAYLNLAQDPSHPAMSLNARFAEVECLAESHQHLSKESLAGNKPANAVLHKVLNQLEELLSDMKSDVSRLPATLARIPPVAQRLQMSERSILSRLAA 1928          

HSP 3 Score: 54.299 bits (129), Expect = 2.223e-6
Identity = 22/70 (31.43%), Postives = 42/70 (60.00%), Query Frame = -3
Query: 5277 TVEGLCEEMGIANVEVSYRMDDFENWTIQRLFDQYMRPKLEEKNPHATSDDIQRVLDAKWKEFALLNPYI 5486
            +VE +C    + NVE+ Y  ++ ++ T  + F  ++RP L+++NP   +  +  ++ AKW+EF   NP+I
Sbjct:  123 SVEDVCSAFSVCNVEIEYSEEELQSLTTYKAFMHHVRPILQKENPKIAAPKLVMLVAAKWREFCESNPHI 192          
BLAST of chromodomain helicase DNA-binding protein 4 vs. Ensembl Fly
Match: Mi-2 (gene:FBgn0262519 transcript:FBtr0100394)

HSP 1 Score: 1388.25 bits (3592), Expect = 0.000e+0
Identity = 709/1204 (58.89%), Postives = 881/1204 (73.17%), Query Frame = -1
Query: 1136 YPLMSGYDTDHQDYCEVCQQGGEIMLCDTCPRAFHLVCLDPELEEAPEGSWSCPHCEKEGVVAASRSTTPATGGDMSQNPQNIRKSAQPNEEEKDEHQEFCNECKDGGDLICCAKCPVSYHPECLYPPLSEIPEGPWLCPRCGCGPLKAKVHKILTWRWMEPPKGKDELDHTHKSTEVEKNPTGGHGRQRAPMREFFVKFRDLSYWNCEWLTELQLDVHHPILLRNYFKKNDMDEPPAPEDG-----STYK--GRAREKVA-----DPHNLEERFYKWSVRPEWMQIHRIIDHMTHRNNSIWYLIKWRDLAYDECTWEQLDGEYEVIDMKHLVEEYHIMRKLFTGDIYKKKFKNSSXXXXXXXXXXXXX------------XPTTDLKKRMSKQPDYIEETGGKLHQYQLEGLNWLRFSFGNVVDTILADEMGLGKTIQTITFLYSLYKEGHSKGPFLVAAPLSTVINWEREFEFWAPDFYVVTYVGDKDSRAVVREHEFSYEEGAMRTSKHACRMRQGTRTKFHVLLTSYELISIDQALLGSISWEVLVVDEAHRLKNNQSKFFRILSSYKINYKLLLTGTPLQNNLEELFHLLHFMTPEKFNDMQGFLDEFADISKEEQVKRLHEILGEHLLRRLKADVLTDMPSKGEFIVRVELSPMQAKFYKYILTRNFDALSVKGGGSQISLINIVMDLKKCCNHPYLFPSGSDEAPKLRNGAYEGLALIKASGKLELLYKMLPKLKTGGHRVLIFSQMTRLLDILEDFMDYMGYKFERIDGAVTGQQRQDSIDRFNAPDSVSFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQSNKVMIYRFVTRNTVEERVTQVAKKKMMLTHLVVRPGLGGKGGASMSKKELDEILKFGTEDLFKEKDENEDDHKIVYDDGAIDRLIDRSQQGIEEKEDMMTDYLSSFKVAHYSKREVSVNXXXXXXXXXETRGEIIKQDLDPADPTYWEKLLRHHYEQDQEDLSKSLGKGKRIRKQVNY-------SATQQEDDNWNDAVG--DSDHESGSINKEEDDEEYDESRGEIIGTRRSKRERDGTKMPPLLVKVNGQLEVLGFNVRQRKAFINAVMRYGLPPMDFINSHWMVRELRCKSDRVMRAYINLFLRHLCEPESDNTDCYSDQVPREGVSRQHVLTRIGIMAVVRKKVQEFEKINGQYS 4648
            +P     + +HQDYCEVCQQGGEI+LCDTCPRA+HLVCL+PEL+E PEG WSCPHCE +G  A                                EHQEFC  CKDGG+L+CC  CP +YH  CL PPL  IP+G W CPRC C PL  K  KI+TWRW +  +  D+   T K          G     + +RE+F+K+ ++SYW+CEW+ E+QLDVHHP+++R++ +K DM+EPP  E+      + YK   R ++KV      D   LEERFYK  V+PEW+ + R+I+H T R+ S  YL+KWR+L YD+ TWE+ +G+ ++  ++  ++ Y  +R + T +  + + K S   ++  LK    E             PTTDLKK+   QP ++E TG +LH YQ+EG+NWLR+S+G  +DTILADEMGLGKTIQT+TFLYSLYKEGH +GPFLVA PLST++NWEREFE WAPDFY +TY+GDKDSRAV+RE+E S+EEGA+R SK   R+R  T+ KF+VLLTSYELIS+D A LGSI W VLVVDEAHRLK+NQSKFFRIL+SY I YKLLLTGTPLQNNLEELFHLL+F++ +KFND+Q F  EFAD+SKEEQVKRLHE+LG H+LRRLK DVL +MPSK EFIVRVELS MQ KFYK+ILT+N++AL+ K GG   SLINI+MDLKKCCNHPYLFPS ++EA     G YE  +L KA+GKL LL KML +LK   HRVLIFSQMT++LDILEDF++   YK+ERIDG +TG  RQ++IDRFNAP +  FVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQ+NKVMIYRFVTRN+VEERVTQVAK+KMMLTHLVVRPG+GGK GA+ +K+ELD+IL+FGTEDLFKE D+ E  H   YDD A+  L+DR+ +GIEEKE    +YLSSFKVA Y+ +E                 EIIKQD + +DP YW KLLRHHYEQ QED+ +SLGKGKR+RKQVNY       + T ++D NW D     +S++ +GS     DD+  D++  E    RR +R RD   +PPLL +V G +EVLGFN RQRK+F+NA+MRYG+PP D  NS W+VR+LR KS+R  +AY++LF+RHLCEP +DN + ++D VPREG+SRQHVLTRIG+M+++RKKVQEFE ING YS
Sbjct:  367 FPEGEDGEHEHQDYCEVCQQGGEIILCDTCPRAYHLVCLEPELDEPPEGKWSCPHCEADGGAAEEEDDD--------------------------EHQEFCRVCKDGGELLCCDSCPSAYHTFCLNPPLDTIPDGDWRCPRCSCPPLTGKAEKIITWRWAQ--RSNDDGPSTSK----------GSKNSNSRVREYFIKWHNMSYWHCEWVPEVQLDVHHPLMIRSFQRKYDMEEPPKFEESLDEADTRYKRIQRHKDKVGMKANDDAEVLEERFYKNGVKPEWLIVQRVINHRTARDGSTMYLVKWRELPYDKSTWEE-EGD-DIQGLRQAIDYYQDLRAVCTSETTQSRSKKSKKGRKSKLKVEDDEDRPVKHYTPPPEKPTTDLKKKYEDQPAFLEGTGMQLHPYQIEGINWLRYSWGQGIDTILADEMGLGKTIQTVTFLYSLYKEGHCRGPFLVAVPLSTLVNWEREFELWAPDFYCITYIGDKDSRAVIRENELSFEEGAIRGSK-VSRLRT-TQYKFNVLLTSYELISMDAACLGSIDWAVLVVDEAHRLKSNQSKFFRILNSYTIAYKLLLTGTPLQNNLEELFHLLNFLSRDKFNDLQAFQGEFADVSKEEQVKRLHEMLGPHMLRRLKTDVLKNMPSKSEFIVRVELSAMQKKFYKFILTKNYEALNSKSGGGSCSLINIMMDLKKCCNHPYLFPSAAEEATTAAGGLYEINSLTKAAGKLVLLSKMLKQLKAQNHRVLIFSQMTKMLDILEDFLEGEQYKYERIDGGITGTLRQEAIDRFNAPGAQQFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQANKVMIYRFVTRNSVEERVTQVAKRKMMLTHLVVRPGMGGK-GANFTKQELDDILRFGTEDLFKEDDKEEAIH---YDDKAVAELLDRTNRGIEEKESWANEYLSSFKVASYATKEEEEE----------EETEIIKQDAENSDPAYWVKLLRHHYEQHQEDVGRSLGKGKRVRKQVNYTDGGVVAADTTRDDSNWQDNGSEYNSEYSAGSDEDGGDDDFDDQNGAERKAKRRLER-RDDRPLPPLLARVGGNIEVLGFNARQRKSFLNAIMRYGMPPQDAFNSQWLVRDLRGKSERNFKAYVSLFMRHLCEPGADNAETFADGVPREGLSRQHVLTRIGVMSLIRKKVQEFEHINGYYS 1513          

HSP 2 Score: 264.233 bits (674), Expect = 3.032e-70
Identity = 133/213 (62.44%), Postives = 170/213 (79.81%), Query Frame = -1
Query:  269 ADECNKIVINKFMFNIADGGFTELHTIWQNEQRALVEGHEQDIWHRKHDYWLLAGVVAHGYGRWQDIHNDVRFAIVNEPFRNEQQKPNYLEIKNRFLARRFKLLEQALTIEEQLRRAAQLNLTYAPNDQVQNLNRRFTELECLATSQQNVYTEAVQGNKTLVPVLHRVLTQLEDLLSDMKQDXXXXXXXXXXXXXXSQRLNLTQTNLIQKLTV 907
            A++  +++  KFMFNIADGGFTELHT+W NE++A V G E +IWHR+HDYWLLAG+V HGYGRWQDI ND+RFAI+NEPF+ +  K N+LEIKN+FLARRFKLLEQAL IEEQLRRAA LNL   P+    +LN RF E+ECLA S Q++  E++ GNK    VLH+VL QLE+LLSDMK DV+RLPA+LAR+ PV+QRL +++ +++ +L  
Sbjct: 1717 AEDSLEVLKRKFMFNIADGGFTELHTLWLNEEKAAVPGREYEIWHRRHDYWLLAGIVTHGYGRWQDIQNDIRFAIINEPFKMDVGKGNFLEIKNKFLARRFKLLEQALVIEEQLRRAAYLNLAQDPSHPAMSLNARFAEVECLAESHQHLSKESLAGNKPANAVLHKVLNQLEELLSDMKSDVSRLPATLARIPPVAQRLQMSERSILSRLAA 1929          

HSP 3 Score: 54.299 bits (129), Expect = 2.242e-6
Identity = 22/70 (31.43%), Postives = 42/70 (60.00%), Query Frame = -3
Query: 5277 TVEGLCEEMGIANVEVSYRMDDFENWTIQRLFDQYMRPKLEEKNPHATSDDIQRVLDAKWKEFALLNPYI 5486
            +VE +C    + NVE+ Y  ++ ++ T  + F  ++RP L+++NP   +  +  ++ AKW+EF   NP+I
Sbjct:  124 SVEDVCSAFSVCNVEIEYSEEELQSLTTYKAFMHHVRPILQKENPKIAAPKLVMLVAAKWREFCESNPHI 193          
BLAST of chromodomain helicase DNA-binding protein 4 vs. Ensembl Fly
Match: Chd3 (gene:FBgn0023395 transcript:FBtr0074998)

HSP 1 Score: 952.199 bits (2460), Expect = 0.000e+0
Identity = 490/942 (52.02%), Postives = 634/942 (67.30%), Query Frame = -1
Query: 1649 QNPQNIRKSAQPNEEEKDEH---QEFCNECKDGGDLICCAKCPVSYHPECLYPPLSEIPEGPWLCPRCGCGPLKAKVHKILTWRWMEPPKGKDELDHTHKSTEVEKNPTGGHGRQRAPMREFFVKFRDLSYWNCEWLTELQLDVHHPILLRNYFKKNDMDEPPAPE----DGSTYKGRAREKVADPHNLEERFYKWSVRPEWMQIHRIIDHMTHRNNSIWYLIKWRDLAYDECTWEQLDGEYEVIDMKHLVEEYHIMRKLFTGDIYKKKFKNSSXXXXXXXXXXXXXXPTTDLKKRMSKQPDYIEETGGKLHQYQLEGLNWLRFSFGNVVDTILADEMGLGKTIQTITFLYSLYKEGHSKGPFLVAAPLSTVINWEREFEFWAPDFYVVTYVGDKDSRAVVREHEFSYEEGAMRTSKHACRMRQG-TRTKFHVLLTSYELISIDQALLGSISWEVLVVDEAHRLKNNQSKFFRILSSYKINYKLLLTGTPLQNNLEELFHLLHFMTPEKFNDMQGFLDEFADISKEEQVKRLHEILGEHLLRRLKADVLTDMPSKGEFIVRVELSPMQAKFYKYILTRNFDALSVKGGGSQISLINIVMDLKKCCNHPYLFPSGSDEAPKLRNGAYEGLALIKASGKLELLYKMLPKLKTGGHRVLIFSQMTRLLDILEDFMDYMGYKFERIDGAVTGQQRQDSIDRFNAPDSVSFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQSNKVMIYRFVTRNTVEERVTQVAKKKMMLTHLVVRPGLGGKGGASMSKKELDEILKFGTEDLFKEKDENEDDHKIVYDDGAIDRLIDRSQQGIEEKEDMMTDYLSSFKVAHYSKREVSVNXXXXXXXXXETRGEIIKQDLDPADPTYWEKLLRHHYEQDQE-----------DLSKSLGKGKRIRKQVNYS 4417
            + P    K  +P    K +    +E+C  C DGGDL+CC  CP  YH  CL PPL  IP+G W+CPRC   PL  K  KIL+WRW         LD +     VE   + G  R     RE+F+K+  +SYW+CEW+ E Q+ +HH  ++ ++ +++DM+EP   E    DG               NL ERFY++ ++PEW+ + R+I+H    N    YL+KWR+L+Y++ +WE+     E   +  L +   + +KL + +  +++ + +                T DL K+   QP +++E G KLH +Q+EG++WLR+S+G  + TILADEMGLGKTIQT+ FLYSL+KEGH +GPFL++ PLST+ NWERE E WAP+ Y VTYVG K +RAV+R+HE S+EE   +T      MR+  T+ KF+V+LTSYE IS+D A LG I W  LVVDEAHRL++NQSKFFRILS Y+I YKLLLTGTPLQNNLEELFHLL+F++  KFND+Q F  EF D+SKEEQVKRLHEIL  H+LRRLKADVL  MP K EFIVRVELS MQ KFYK+ILT+NF AL+ KGGG   SL+NI+MDL+KCCNHPYLFPS ++EA    +G YE  +L KASGKL+LL KML +LK   HRVL+FSQMT++L++LE F++  GY+++RIDG++ G  RQ +IDRFN P S  FVFLLSTRAGGLGINLATADTVII+DSDWNPHND+QAFSRAHR+GQ  KVMIYRFVT N+VEER+ QVAK KMMLTHLVVRPG+GG    + SK EL++IL+FGTEDLFK+         I YDD A+  L+DR+ +GIEEKE    +YLSSFKVA Y+ +E            +    +    D +  DP YWE L+     +  +           D+   +GKGKRIRK+++YS
Sbjct:   12 KTPGKASKDKRPKTNAKKQKFRDEEYCKVCSDGGDLLCCDSCPSVYHRTCLSPPLKSIPKGDWICPRCI--PLPGKAEKILSWRWA--------LDRS-----VELRTSKGEKR-----REYFIKWHGMSYWHCEWIPEGQMLLHHASMVASFQRRSDMEEPSLEELDDQDG---------------NLHERFYRYGIKPEWLLVQRVINHSEEPNGGTMYLVKWRELSYNDSSWER-----ESDSIPGLNQAIALYKKLRSSNKGRQRDRPAP---------------TIDLNKKYEDQPVFLKEAGLKLHPFQIEGVSWLRYSWGQGIPTILADEMGLGKTIQTVVFLYSLFKEGHCRGPFLISVPLSTLTNWERELELWAPELYCVTYVGGKTARAVIRKHEISFEEVTTKT------MRENQTQYKFNVMLTSYEFISVDAAFLGCIDWAALVVDEAHRLRSNQSKFFRILSKYRIGYKLLLTGTPLQNNLEELFHLLNFLSSGKFNDLQTFQAEFTDVSKEEQVKRLHEILEPHMLRRLKADVLKSMPPKSEFIVRVELSSMQKKFYKHILTKNFKALNQKGGGRVCSLLNIMMDLRKCCNHPYLFPSAAEEATISPSGLYEMSSLTKASGKLDLLSKMLKQLKADNHRVLLFSQMTKMLNVLEHFLEGEGYQYDRIDGSIKGDLRQKAIDRFNDPVSEHFVFLLSTRAGGLGINLATADTVIIFDSDWNPHNDVQAFSRAHRMGQKKKVMIYRFVTHNSVEERIMQVAKHKMMLTHLVVRPGMGGM-TTNFSKDELEDILRFGTEDLFKDG----KSEAIHYDDKAVADLLDRTNRGIEEKESWANEYLSSFKVASYATKE------------DHEEHDDYNNDAENTDPFYWENLMGKSQPKLPKKQKKQSQQSQVDVESIMGKGKRIRKEIDYS 875          

HSP 2 Score: 68.1662 bits (165), Expect = 1.105e-10
Identity = 21/45 (46.67%), Postives = 31/45 (68.89%), Query Frame = -1
Query: 4481 QDYCEVCQQGGEIMLCDTCPRAFHLVCLDPELEEAPEGSWSCPHC 4615
            ++YC+VC  GG+++ CD+CP  +H  CL P L+  P+G W CP C
Sbjct:   35 EEYCKVCSDGGDLLCCDSCPSVYHRTCLSPPLKSIPKGDWICPRC 79          
BLAST of chromodomain helicase DNA-binding protein 4 vs. Ensembl Zebrafish
Match: chd4a (chromodomain helicase DNA binding protein 4a [Source:ZFIN;Acc:ZDB-GENE-041111-187])

HSP 1 Score: 1466.44 bits (3795), Expect = 0.000e+0
Identity = 727/1183 (61.45%), Postives = 893/1183 (75.49%), Query Frame = -1
Query: 1136 GYDTDHQDYCEVCQQGGEIMLCDTCPRAFHLVCLDPELEEAPEGSWSCPHCEKEGVVAASRSTTPATGGDMSQNPQNIRKSAQPNEEEKDEHQEFCNECKDGGDLICCAKCPVSYHPECLYPPLSEIPEGPWLCPRCGCGPLKAKVHKILTWRWMEPPKGKDELDHTHKSTEVEKNPTGGHGRQRAPMREFFVKFRDLSYWNCEWLTELQLDVHHPILLRNYFKKNDMDEPPAPE---DGSTYKGRAREKVADP--HNLEERFYKWSVRPEWMQIHRIIDHMTHRNNSIWYLIKWRDLAYDECTWEQLDGEYEVIDMKHLVEEYHIMRKLFTGDIYKKKFKNSSXXXXXXXXXXXXXXPTTDLKKRMSKQPDYIEETGGKLHQYQLEGLNWLRFSFGNVVDTILADEMGLGKTIQTITFLYSLYKEGHSKGPFLVAAPLSTVINWEREFEFWAPDFYVVTYVGDKDSRAVVREHEFSYEEGAMRTSKHACRMRQGTRTKFHVLLTSYELISIDQALLGSISWEVLVVDEAHRLKNNQSKFFRILSSYKINYKLLLTGTPLQNNLEELFHLLHFMTPEKFNDMQGFLDEFADISKEEQVKRLHEILGEHLLRRLKADVLTDMPSKGEFIVRVELSPMQAKFYKYILTRNFDALSVKGGGSQISLINIVMDLKKCCNHPYLFPSGSDEAPKLRNGAYEGLALIKASGKLELLYKMLPKLKTGGHRVLIFSQMTRLLDILEDFMDYMGYKFERIDGAVTGQQRQDSIDRFNAPDSVSFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQSNKVMIYRFVTRNTVEERVTQVAKKKMMLTHLVVRPGLGGKGGASMSKKELDEILKFGTEDLFKEKDEN------EDDHKIVYDDGAIDRLIDRSQQGIEEKE-DMMTDYLSSFKVAHYSKREVSVNXXXXXXXXXETRGEIIKQDLDPADPTYWEKLLRHHYEQDQEDLSKSLGKGKRIRKQVNYSATQQEDDNWND--AVGDSDHESGSINKEEDDEEYDESRGEIIG---TRRSKRERDGTKMPPLLVKVNGQLEVLGFNVRQRKAFINAVMRYGLPPMDFINSHWMVRELRCKSDRVMRAYINLFLRHLCEPESDNTDCYSDQVPREGVSRQHVLTRIGIMAVVRKKVQEFEKINGQYS 4633
            GY+TDHQDYCEVCQQGGEI+LCDTCPRA+H+VCLDP++E+APEG+WSCPHCEK G+   +R        D S+  ++    A    EE D H EFC  CKDGG+L+CC  CP SYH  CL PPL EIP G W+CPRC C  +K KV KILTWRW EPP        +   T+   +PT   GR   P REFFVK++++SYW+C W+TELQL++H  ++ RNY +KNDMDEPP  +   +G   K   R+K  DP    +EE++Y++ ++ EWM IHRI++H   + N+  YLIKWRDL YD+ TWE  D +    D   L  +Y   R+L  GD   K  K   I  ++     PPE+P  D   +  +QPDY++ TGG LH YQLEGLNWLRFS+    DTILADEMGLGKT+QT  FLYSLYKEGHSKGPFLV+APLST+INWEREFE WAPD YVVTYVGDKDSRAV+RE+EFS+E  A+R  K   +M++    KFHVLLTSYELI+ID A+LGSI W  LVVDEAHRLKNNQSKFFRIL++Y + +KLLLTGTPLQNNLEELFHLL+F+TPE+F++++GFL+EFADI+KE+Q+K+LH++LG H+LRRLKADV   MPSK E IVRVELSPMQ K+YK+ILTRNF+AL+ +GGG+Q+SL+N+VMDLKKCCNHPYLFP+ + EA K+ NG YEG  L K+SGKL LL KML KLK GGHRVLIFSQMT++LD+LEDF++  GYK+ERIDG +TG  RQ++IDRFNAP +  FVFLLSTRAGGLGINLATADTV+IYDSDWNPHNDIQAFSRAHRIGQ+ KVMIYRFVT+ +VEER+TQVAKKKMMLTHLVVRPGLG K G SMSK+ELD+ILKFGTE+LFK++ E       ED   I YDD AIDRL+DR+Q   ++ E   M +YLSSFKVA Y + EV              + EIIKQ+ +  DP YWEKLLRHHYEQ QEDL+++LGKGKRIRKQVNY+   QED +W D  + G SD+   S+  EE DE++DE R E       R+  R      +PPLL +V+G +EVLGFN RQRKAF+NAVMRYG+PP D   + W+VR+LR KS+R  +AY++LF+RHLCEP +D  + ++D VPREG+SRQHVLTRIG+M+++RKKVQEFE +NGQ+S
Sbjct:  348 GYETDHQDYCEVCQQGGEIILCDTCPRAYHMVCLDPDMEKAPEGTWSCPHCEKMGIQWEARE-------DASEGEED--NEAGGEAEEDDHHMEFCRVCKDGGELLCCDSCPSSYHIHCLNPPLPEIPNGEWICPRCTCPSMKGKVQKILTWRWTEPPPPTPVPRPSDLPTDA-PDPTPLAGR---PEREFFVKWQNMSYWHCSWVTELQLEIHCQVMFRNYQRKNDMDEPPPIDFGGEGEEEKSDKRKK-KDPTYARMEEKYYRFGIKMEWMVIHRILNHSVDKKNNCHYLIKWRDLTYDQATWELEDMDLPDYDTYKL--QYWNHRELMMGD-EGKPGKKIKIKGKMRKLDRPPENPVVDPTIKFERQPDYLDTTGGTLHPYQLEGLNWLRFSWAQGTDTILADEMGLGKTVQTAVFLYSLYKEGHSKGPFLVSAPLSTIINWEREFEMWAPDMYVVTYVGDKDSRAVIRENEFSFENNAIRGGKKPSKMKKEASVKFHVLLTSYELITIDTAVLGSIDWACLVVDEAHRLKNNQSKFFRILNNYPLQHKLLLTGTPLQNNLEELFHLLNFLTPERFSNLEGFLEEFADIAKEDQIKKLHDMLGPHMLRRLKADVFKHMPSKTELIVRVELSPMQKKYYKFILTRNFEALNTRGGGNQVSLLNVVMDLKKCCNHPYLFPAAAMEAAKMPNGMYEGGGLTKSSGKLLLLQKMLRKLKEGGHRVLIFSQMTKMLDLLEDFLENEGYKYERIDGGITGGMRQEAIDRFNAPGAPQFVFLLSTRAGGLGINLATADTVVIYDSDWNPHNDIQAFSRAHRIGQNKKVMIYRFVTKASVEERITQVAKKKMMLTHLVVRPGLGSKTG-SMSKQELDDILKFGTEELFKDEGEGENKEGQEDSSVIHYDDKAIDRLLDRNQDATDDTELQSMNEYLSSFKVAQYVEEEV--------------QREIIKQE-ESVDPDYWEKLLRHHYEQQQEDLARNLGKGKRIRKQVNYNDGSQEDRDWQDDQSDGQSDY---SVASEEGDEDFDE-RSEANSRRPNRKGLRNDKDKPLPPLLARVSGNIEVLGFNARQRKAFLNAVMRYGMPPQDAFTTQWLVRDLRGKSEREFKAYVSLFMRHLCEPGADGAESFADGVPREGLSRQHVLTRIGVMSLIRKKVQEFEHVNGQWS 1493          

HSP 2 Score: 248.825 bits (634), Expect = 2.086e-65
Identity = 133/233 (57.08%), Postives = 169/233 (72.53%), Query Frame = -1
Query:  245 DAVMSEADECNKIVINKFMFNIADGGFTELHTIWQNEQRAL-VEGHEQDIWHRKHDYWLLAGVVA-----HGYGRWQDIHNDVRFAIVNEPFRNEQQKPNYLEIKNRFLARRFKLLEQALTIEEQLRRAAQLNLTYAPNDQVQNLNRRFTELECLATSQQNVYTEAVQGNKTLVPVLHRVLTQLEDLLSDMKQDXXXXXXXXXXXXXXSQRLNLTQTNLIQKLTVQMQQTKPQ 925
            D+      E  K    +FMFNIADGGFTELH++WQNE+RA  V     +IWHR+HDYWLLAG++      HGY RWQDI NDVRFAI+NEPF+ E  + N+LEIKN+FLARRFKLLEQAL IEEQLRRAA LN+T  P+     LN RF+E+ECLA S Q++  E++ GNK    VLH+VL QLE+LLSDMK DV RLPA++AR+ PV+ RL +++ N++ +L  +   T+ Q
Sbjct: 1693 DSAAGAGIEERKKAKTRFMFNIADGGFTELHSLWQNEERAATVTKKTNEIWHRRHDYWLLAGIIQYLLMQHGYARWQDIQNDVRFAILNEPFKGEINRGNFLEIKNKFLARRFKLLEQALVIEEQLRRAAYLNMTEDPSHPSMALNTRFSEVECLAESHQHLSKESMSGNKPANAVLHKVLKQLEELLSDMKADVTRLPATIARIPPVAVRLQMSERNILSRLASRGPDTQSQ 1925          
BLAST of chromodomain helicase DNA-binding protein 4 vs. Ensembl Zebrafish
Match: chd5 (chromodomain helicase DNA binding protein 5 [Source:ZFIN;Acc:ZDB-GENE-120314-2])

HSP 1 Score: 1452.19 bits (3758), Expect = 0.000e+0
Identity = 728/1193 (61.02%), Postives = 897/1193 (75.19%), Query Frame = -1
Query: 1136 GYDTDHQDYCEVCQQGGEIMLCDTCPRAFHLVCLDPELEEAPEGSWSCPHCEKEGVVAASRSTTPATGGDMSQNPQNIRKSAQPNEEEKDEHQEFCNECKDGGDLICCAKCPVSYHPECLYPPLSEIPEGPWLCPRCGCGPLKAKVHKILTWRWMEPPK------GKDELDHTHKSTEVEKNPTGGHGRQRAPMREFFVKFRDLSYWNCEWLTELQLDVHHPILLRNYFKKNDMDEPPAPEDGSTYKGRAREK--VADPH--NLEERFYKWSVRPEWMQIHRIIDHMTHRNNSIWYLIKWRDLAYDECTWEQLDGEYEVIDMKHLVEEYHIMRKLFTGDIYK----KKFKNSSXXXXXXXXXXXXXXPTTDLKKRMSKQPDYIEETGGKLHQYQLEGLNWLRFSFGNVVDTILADEMGLGKTIQTITFLYSLYKEGHSKGPFLVAAPLSTVINWEREFEFWAPDFYVVTYVGDKDSRAVVREHEFSYEEGAMRTSKHACRMRQGTRTKFHVLLTSYELISIDQALLGSISWEVLVVDEAHRLKNNQSKFFRILSSYKINYKLLLTGTPLQNNLEELFHLLHFMTPEKFNDMQGFLDEFADISKEEQVKRLHEILGEHLLRRLKADVLTDMPSKGEFIVRVELSPMQAKFYKYILTRNFDALSVKGGGSQISLINIVMDLKKCCNHPYLFPSGSDEAPKLRNGAYEGLALIKASGKLELLYKMLPKLKTGGHRVLIFSQMTRLLDILEDFMDYMGYKFERIDGAVTGQQRQDSIDRFNAPDSVSFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQSNKVMIYRFVTRNTVEERVTQVAKKKMMLTHLVVRPGLGGKGGASMSKKELDEILKFGTEDLFK----------EKDENEDDHKIVYDDGAIDRLIDRSQQGIEEKE-DMMTDYLSSFKVAHYSKREVSVNXXXXXXXXXETRGEIIKQDLDPADPTYWEKLLRHHYEQDQEDLSKSLGKGKRIRKQVNYSATQQEDDNWNDAVGD--SDHESGSINKEEDDEEYDESRGEIIGTRRSKRERDGTKMPPLLVKVNGQLEVLGFNVRQRKAFINAVMRYGLPPMDFINSHWMVRELRCKSDRVMRAYINLFLRHLCEPESDNTDCYSDQVPREGVSRQHVLTRIGIMAVVRKKVQEFEKINGQYS 4633
            GY+TDHQDYCEVCQQGGEI+LCDTCPRA+HLVCLDPELE+APEG WSCPHCEKEG+   ++                  +  +   EE+D+H EFC  CKDGG+L+CC  CP SYH  CL PPL EIP G WLCPRC C PLK KV KIL W W +PP       G D      K   + K P  G      P R+ FVK+  LSYW+C W++ELQL+++H ++ RNY +KNDMDEPP  + GS  +    EK    DP    +EERFY++ ++PEW+ IHRI++H   ++  + YLIKWRDL YD+C+WE  D  ++V D   L + Y   R    G+ ++    +K K      +              +K    +QP YI++TGG LH YQLEGLNWLRFS+    DTILADEMGLGKT+QTI FLYSLYKEGHSKGPFLV+APLST+INWEREFE WAPDFYVVTY GDK+SRA++RE+EF++E+ A+++ +   RM++ T  KFHVLLTSYELI+IDQA+LGSI+W  LVVDEAHRLKNNQSKFFRIL+ YKI YKLLLTGTPLQNNLEELFHLL+F+TPE+FN+++GFL+EFADISKE+Q+K+LH++LG H+LRRLKADV  +MP+K E IVRVELSPMQ K+YK+ILTRNF+AL+ KGGG+Q+SL+NI+MDLKKCCNHPYLFP  + EAP L NG+Y+G  L+K+SGKL LL KML KLK GGHRVLIFSQMT++LD+LEDF+++ GYK+ERIDG +TG  RQ++IDRFNAP +  F FLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQ+ KVMIYRFVTR +VEER+TQVAK+KMMLTHLVVRPGLG K G SMSK+ELD+ILKFGTE+LFK          +  E E+   I YDD AI +L+DRSQ   E+ E   M +YLSSFKVA Y  RE        +D +EE + EIIKQ+ +  DP YWEKLLRHHYEQ QEDL+++LGKGKRIRKQVNY+   QED  W D + D  S++  GS +++ED EE  E  G     R+ K +RD   +PPLL +V+G +EVLGFN RQRKAF+NA+MR+G+PP D  NSHW+VR+LR KS++  RAY++LF+RHLCEP +D  + ++D VPREG+SRQHVLTRIG+M++VRKKVQEFE +NG++S
Sbjct:  345 GYETDHQDYCEVCQQGGEIILCDTCPRAYHLVCLDPELEKAPEGKWSCPHCEKEGIQWEAKDDE--------------EEEDEVAGEEEDDHMEFCRVCKDGGELLCCDTCPSSYHIHCLNPPLPEIPNGEWLCPRCMCPPLKGKVQKILHWSWGDPPLPPEVPLGPD----GEKVDNLAKTPLKGR-----PERQLFVKWAGLSYWHCSWVSELQLELYHTVMYRNYQRKNDMDEPPPYDYGSGEEELNNEKRRSKDPQYAAMEERFYRYGIKPEWLIIHRILNHSFDKDGDVQYLIKWRDLPYDQCSWEADD--FDVPDYDSLKQAYWDHRNQVLGENHQPLLFRKGKRPKEEMKRREPPPDTPVVDPTIK--FEQQPWYIDDTGGTLHPYQLEGLNWLRFSWAQGTDTILADEMGLGKTVQTIVFLYSLYKEGHSKGPFLVSAPLSTIINWEREFEMWAPDFYVVTYTGDKESRAIIRENEFTFEDSAVKSGRKVFRMKKDTPIKFHVLLTSYELITIDQAILGSITWACLVVDEAHRLKNNQSKFFRILNGYKIYYKLLLTGTPLQNNLEELFHLLNFLTPERFNNLEGFLEEFADISKEDQIKKLHDLLGPHMLRRLKADVFKNMPAKTELIVRVELSPMQKKYYKFILTRNFEALNSKGGGNQVSLLNIMMDLKKCCNHPYLFPVAAVEAPVLPNGSYDGNLLVKSSGKLTLLQKMLIKLKDGGHRVLIFSQMTKMLDLLEDFLEFEGYKYERIDGGITGGLRQEAIDRFNAPGAQQFCFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQNKKVMIYRFVTRASVEERITQVAKRKMMLTHLVVRPGLGSKTG-SMSKQELDDILKFGTEELFKDDVEAARTMGDNKEGEEVSVIHYDDNAISKLLDRSQDATEDTEIQNMNEYLSSFKVAQYVVRE--------EDGEEEVQREIIKQEEN-VDPDYWEKLLRHHYEQQQEDLARNLGKGKRIRKQVNYNDASQEDQEWQDDLSDNQSEYSVGSEDEDEDFEERPEG-GRRHSRRQLKSDRD-KPLPPLLARVSGNIEVLGFNARQRKAFLNAIMRWGMPPQDAFNSHWLVRDLRGKSEKEFRAYVSLFMRHLCEPGADGAETFADGVPREGLSRQHVLTRIGVMSLVRKKVQEFEHVNGKFS 1498          

HSP 2 Score: 256.144 bits (653), Expect = 1.013e-67
Identity = 135/221 (61.09%), Postives = 166/221 (75.11%), Query Frame = -1
Query:  272 VMSEADECNK----IVINKFMFNIADGGFTELHTIWQNEQRALVE-GHEQDIWHRKHDYWLLAGVVAHGYGRWQDIHNDVRFAIVNEPFRNEQQKPNYLEIKNRFLARRFKLLEQALTIEEQLRRAAQLNLTYAPNDQVQNLNRRFTELECLATSQQNVYTEAVQGNKTLVPVLHRVLTQLEDLLSDMKQDXXXXXXXXXXXXXXSQRLNLTQTNLIQKLT 919
            V  E DE ++     +  +FMFNIADGGFTELHT+WQNE+RA V  G   DIWHR+HDYWLLAG+V HGY RWQDI ND R+AI+NEPF+ E  K NYLE+KN+FLARRFKLLEQAL IEEQLRRAA LN+T  P+     LN RF E+ECLA S Q++  E++ GNK    VLH+VL QLE+LLSDMK DV RLP+ L+R+ PVS RL +++  ++ +LT
Sbjct: 1682 VRDETDEGHRDDKSSIKTRFMFNIADGGFTELHTLWQNEERAAVSSGKIYDIWHRRHDYWLLAGIVTHGYARWQDIQNDPRYAILNEPFKTEMHKGNYLEMKNKFLARRFKLLEQALVIEEQLRRAAYLNMTQDPSHPAMALNTRFAEVECLAESHQHLSKESLAGNKPANAVLHKVLNQLEELLSDMKADVTRLPSMLSRVPPVSARLQMSERGILSRLT 1902          

HSP 3 Score: 65.0846 bits (157), Expect = 1.506e-9
Identity = 29/80 (36.25%), Postives = 43/80 (53.75%), Query Frame = -1
Query: 4223 AASRSTTPATGGDMSQNPQNIRKSAQPNEEEKDEHQEFCNECKDGGDLICCAKCPVSYHPECLYPPLSEIPEGPWLCPRC 4462
            A+ RS T A     S      ++  +  +  + +HQ++C  C+ GG++I C  CP +YH  CL P L + PEG W CP C
Sbjct:  316 ASVRSDTSAAAKKKSSRKGRKKRKREDGDGYETDHQDYCEVCQQGGEIILCDTCPRAYHLVCLDPELEKAPEGKWSCPHC 395          

HSP 4 Score: 55.0694 bits (131), Expect = 1.397e-6
Identity = 24/70 (34.29%), Postives = 42/70 (60.00%), Query Frame = -3
Query: 5280 KTVEGLCEEMGIANVEVSYRMDDFENWTIQRLFDQYMRPKLEEKNPHATSDDIQRVLDAKWKEFALLNPY 5489
            K+   L +E G+ +V+ ++  DD++  T  + F Q++RP + +KNP      +  VL AKW+EF+  NP+
Sbjct:  141 KSSSQLMQEWGLEDVQYAFSEDDYKTITNYKAFSQFLRPLIAKKNPKIPMSKMMTVLGAKWREFSANNPF 210          
BLAST of chromodomain helicase DNA-binding protein 4 vs. Ensembl Zebrafish
Match: chd4b (chromodomain helicase DNA binding protein 4b [Source:ZFIN;Acc:ZDB-GENE-030131-4532])

HSP 1 Score: 1410.59 bits (3650), Expect = 0.000e+0
Identity = 717/1184 (60.56%), Postives = 889/1184 (75.08%), Query Frame = -1
Query: 1136 GYDTDHQDYCEVCQQGGEIMLCDTCPRAFHLVCLDPELEEAPEGSWSCPHCEKEGVVAASRSTTPATGGDMSQNPQNIRKSAQPNEEEKDEHQEFCNECKDGGDLICCAKCPVSYHPECLYPPLSEIPEGPWLCPRCGCGPLKAKVHKILTWRWMEPPKGKDELDHTHKSTEVEKNPTGGHGRQRAPMREFFVKFRDLSYWNCEWLTELQLDVHHPILLRNYFKKNDMDEPPAPEDGST--YKGRAREKVADPH--NLEERFYKWSVRPEWMQIHRIIDHMTHRNNSIWYLIKWRDLAYDECTWEQLDGEYEVIDMKHLVEEYHIMRKLFTGDIYKKKFKNSSXXXXXXXXXXXXXXPTTDLKKRMSKQPDYIEETGGKLHQYQLEGLNWLRFSFGNVVDTILADEMGLGKTIQTITFLYSLYKEGHSKGPFLVAAPLSTVINWEREFEFWAPDFYVVTYVGDKDSRAVVREHEFSYEEGAMRTSKHACRMRQGTRTKFHVLLTSYELISIDQALLGSISWEVLVVDEAHRLKNNQSKFFRILSSYKINYKLLLTGTPLQNNLEELFHLLHFMTPEKFNDMQGFLDEFADISKEEQVKRLHEILGEHLLRRLKADVLTDMPSKGEFIVRVELSPMQAKFYKYILTRNFDALSVKGGGSQISLINIVMDLKKCCNHPYLFPSGSDEAPKLRNGAYEGLALIKASGKLELLYKMLPKLKTGGHRVLIFSQMTRLLDILEDFMDYMGYKFERIDGAVTGQQRQDSIDRFNAPDSVSFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQSNKVMIYRFVTRNTVEERVTQVAKKKMMLTHLVVRPGLGGKGGASMSKKELDEILKFGTEDLFK----EKDENEDDHKIV-YDDGAIDRLIDRSQQGIEEKE-DMMTDYLSSFKVAHYSKREVSVNXXXXXXXXXETRGEIIKQDLDPADPTYWEKLLRHHYEQDQEDLSKSLGKGKRIRKQVNYSATQQED----DNWNDAVGDSDHESGSINKEEDDEEYDESRGEIIGTRRSKRE---RDGTK-MPPLLVKVNGQLEVLGFNVRQRKAFINAVMRYGLPPMDFINSHWMVRELRCKSDRVMRAYINLFLRHLCEPESDNTDCYSDQVPREGVSRQHVLTRIGIMAVVRKKVQEFEKINGQYS 4633
            GY+TDHQDYCEVCQQGGEI+LCDTCPRA+H+VCLDP++E APEG+WSCPHCEKEG+   +R  +        +   + R+     EEE D H EFC  CKDGG+L+CC  CP SYH  CL PPL +IP G W+CPRC   PLK KV K+LTWRW E P             E   +P    GR+    REFFVK+ + SYW+C W+ ELQL+++  ++ RNY +K DM+EPP  E G+        + K  DP    +E+++ ++ V+ EW+ IHRI++H   + N++ YLIKWRDL YD+ TWE  D   +V D +   + Y   R+L  G+  + +        ++   + PP +P  D   +  +QPDY++ TGG LH YQLEGLNWLRFS+    DTILADEMGLGKT+QT  FLYSLYKEGHSKGPFLV+APLST+INWEREFE WAPD YVVTYVGDKDSRAV+RE+EF++E+ A+R  K A +M++    KFHVLLTSYELI+IDQA+LGSI W  LVVDEAHRLKNNQSKFFR+L++Y + +KLLLTGTPLQNNLEELFHLL+F+TPE+FN+++GFL+EFADI+KE+Q+K+LH++LG H+LRRLKADV   MPSK E IVRVELSPMQ K+YKYILTRNF+AL+ +GGG+Q+SL+N+VMDLKKCCNHPYLFP+ + EAPK+ NG Y+G AL KASGKL LL+KML KLK GGHRVLIFSQMT++LD+LEDF++  GYK+ERIDG VTG  RQ++IDRFNAP +  FVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQ+ KVMIYRFVT+ +VEER+TQVAKKKMMLTHLVVRPGLG K G SMSK+ELD+ILKFGTE LFK    E D  E+D  ++ YDD AIDRL+DR+Q   E+ E   M +YLSSFKVA Y  ++    E+D D        EIIKQ+ +  DP YWEKLLRHHYEQ QEDL++ LGKGKR RK VNY+   QED     +W D   D+  +  S+  EE DE++DE R E   +RR  R+    D  K +PPLL +V G +EVLGFN RQRKAF+NAVMRYG+PP D   + W+VR+LR KS++  +AY++LF+RHLCEP +D  + ++D VPREG+SRQHVLTRIG+M+++RKKVQEFE +NGQ+S
Sbjct:  369 GYETDHQDYCEVCQQGGEIILCDTCPRAYHMVCLDPDMERAPEGTWSCPHCEKEGIQWEAREESSEG----EEENDDGRRDDGDVEEEDDHHMEFCRVCKDGGELLCCDTCPSSYHLHCLNPPLPDIPNGEWICPRCLSPPLKGKVQKVLTWRWGEAPPPMPVPRPADLPAEA-PDPPPMIGRKE---REFFVKWCNKSYWHCSWVQELQLELNCQVMFRNYQRKTDMEEPPNLEMGAEGDEDKSCKRKNKDPFYARMEDKYGRFGVKIEWLFIHRILNHSVDKKNNVHYLIKWRDLPYDQSTWESED--MDVPDFETYKQHYWNHRELMLGE--EGRPGKKMKKVKVRKTERPPANPVVDPTIKFDRQPDYLDSTGGTLHPYQLEGLNWLRFSWAQGTDTILADEMGLGKTVQTAVFLYSLYKEGHSKGPFLVSAPLSTIINWEREFEMWAPDMYVVTYVGDKDSRAVIRENEFTFEDNAIRGGKKASKMKKEAAVKFHVLLTSYELITIDQAILGSIDWACLVVDEAHRLKNNQSKFFRVLNNYPLQHKLLLTGTPLQNNLEELFHLLNFLTPERFNNLEGFLEEFADIAKEDQIKKLHDMLGPHMLRRLKADVFKHMPSKTELIVRVELSPMQKKYYKYILTRNFEALNTRGGGNQVSLLNVVMDLKKCCNHPYLFPTAATEAPKMPNGMYDGSALTKASGKLMLLFKMLKKLKEGGHRVLIFSQMTKMLDLLEDFLENEGYKYERIDGGVTGGMRQEAIDRFNAPGAPQFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQNKKVMIYRFVTKASVEERITQVAKKKMMLTHLVVRPGLGSKAG-SMSKQELDDILKFGTEQLFKDELGEGDNKEEDSSVIHYDDKAIDRLLDRNQDATEDTELQSMNEYLSSFKVAQYVVKDEDEEEEDVDR-------EIIKQE-ESVDPDYWEKLLRHHYEQQQEDLARHLGKGKRPRKPVNYNDCSQEDRGSRRDWQDDQSDNQSDY-SVASEEGDEDFDE-RSEAANSRRPSRKGLRNDKDKPLPPLLARVGGNIEVLGFNARQRKAFLNAVMRYGMPPQDAFTTQWLVRDLRGKSEKEFKAYVSLFMRHLCEPGADGAETFADGVPREGLSRQHVLTRIGVMSLIRKKVQEFEHVNGQWS 1529          

HSP 2 Score: 250.366 bits (638), Expect = 6.071e-66
Identity = 131/225 (58.22%), Postives = 171/225 (76.00%), Query Frame = -1
Query:  245 ADECNKIVINKFMFNIADGGFTELHTIWQNEQRAL-VEGHEQDIWHRKHDYWLLAGVVAHGYGRWQDIHNDVRFAIVNEPFRNEQQKPNYLEIKNRFLARRFKLLEQALTIEEQLRRAAQLNLTYAPNDQVQNLNRRFTELECLATSQQNVYTEAVQGNKTLVPVLHRVLTQLEDLLSDMKQDXXXXXXXXXXXXXXSQRLNLTQTNLIQKLTV---QMQQTKPQ 907
            ++E  K V  +FMFNIADGGFTELH++WQNE+RA  V     +IWHR+HDYWLLAG++ HGY RWQD+ ND RFAI+NEPF+ E  + N+LEIKN+FLARRFKLLEQAL IEEQLRRAA LN+T  P+     LN RF+E+ECLA S Q++  E++ GNK    VLH+VL QLE+LLSDMK DV RLPA++AR+ PV+ RL +++ +++ +L     ++ QT+ Q
Sbjct: 1728 SEEKKKAVKQRFMFNIADGGFTELHSLWQNEERAATVTKKTYEIWHRRHDYWLLAGIIFHGYARWQDVQNDPRFAILNEPFKGEMSRGNFLEIKNKFLARRFKLLEQALVIEEQLRRAAYLNMTEDPSHPSMALNTRFSEVECLAESHQHLSKESMSGNKPANAVLHKVLKQLEELLSDMKADVTRLPATIARIPPVAVRLQMSERSILSRLASRGPEVTQTQAQ 1952          
BLAST of chromodomain helicase DNA-binding protein 4 vs. Ensembl Zebrafish
Match: chd4b (chromodomain helicase DNA binding protein 4b [Source:ZFIN;Acc:ZDB-GENE-030131-4532])

HSP 1 Score: 1410.59 bits (3650), Expect = 0.000e+0
Identity = 717/1184 (60.56%), Postives = 889/1184 (75.08%), Query Frame = -1
Query: 1136 GYDTDHQDYCEVCQQGGEIMLCDTCPRAFHLVCLDPELEEAPEGSWSCPHCEKEGVVAASRSTTPATGGDMSQNPQNIRKSAQPNEEEKDEHQEFCNECKDGGDLICCAKCPVSYHPECLYPPLSEIPEGPWLCPRCGCGPLKAKVHKILTWRWMEPPKGKDELDHTHKSTEVEKNPTGGHGRQRAPMREFFVKFRDLSYWNCEWLTELQLDVHHPILLRNYFKKNDMDEPPAPEDGST--YKGRAREKVADPH--NLEERFYKWSVRPEWMQIHRIIDHMTHRNNSIWYLIKWRDLAYDECTWEQLDGEYEVIDMKHLVEEYHIMRKLFTGDIYKKKFKNSSXXXXXXXXXXXXXXPTTDLKKRMSKQPDYIEETGGKLHQYQLEGLNWLRFSFGNVVDTILADEMGLGKTIQTITFLYSLYKEGHSKGPFLVAAPLSTVINWEREFEFWAPDFYVVTYVGDKDSRAVVREHEFSYEEGAMRTSKHACRMRQGTRTKFHVLLTSYELISIDQALLGSISWEVLVVDEAHRLKNNQSKFFRILSSYKINYKLLLTGTPLQNNLEELFHLLHFMTPEKFNDMQGFLDEFADISKEEQVKRLHEILGEHLLRRLKADVLTDMPSKGEFIVRVELSPMQAKFYKYILTRNFDALSVKGGGSQISLINIVMDLKKCCNHPYLFPSGSDEAPKLRNGAYEGLALIKASGKLELLYKMLPKLKTGGHRVLIFSQMTRLLDILEDFMDYMGYKFERIDGAVTGQQRQDSIDRFNAPDSVSFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQSNKVMIYRFVTRNTVEERVTQVAKKKMMLTHLVVRPGLGGKGGASMSKKELDEILKFGTEDLFK----EKDENEDDHKIV-YDDGAIDRLIDRSQQGIEEKE-DMMTDYLSSFKVAHYSKREVSVNXXXXXXXXXETRGEIIKQDLDPADPTYWEKLLRHHYEQDQEDLSKSLGKGKRIRKQVNYSATQQED----DNWNDAVGDSDHESGSINKEEDDEEYDESRGEIIGTRRSKRE---RDGTK-MPPLLVKVNGQLEVLGFNVRQRKAFINAVMRYGLPPMDFINSHWMVRELRCKSDRVMRAYINLFLRHLCEPESDNTDCYSDQVPREGVSRQHVLTRIGIMAVVRKKVQEFEKINGQYS 4633
            GY+TDHQDYCEVCQQGGEI+LCDTCPRA+H+VCLDP++E APEG+WSCPHCEKEG+   +R  +        +   + R+     EEE D H EFC  CKDGG+L+CC  CP SYH  CL PPL +IP G W+CPRC   PLK KV K+LTWRW E P             E   +P    GR+    REFFVK+ + SYW+C W+ ELQL+++  ++ RNY +K DM+EPP  E G+        + K  DP    +E+++ ++ V+ EW+ IHRI++H   + N++ YLIKWRDL YD+ TWE  D   +V D +   + Y   R+L  G+  + +        ++   + PP +P  D   +  +QPDY++ TGG LH YQLEGLNWLRFS+    DTILADEMGLGKT+QT  FLYSLYKEGHSKGPFLV+APLST+INWEREFE WAPD YVVTYVGDKDSRAV+RE+EF++E+ A+R  K A +M++    KFHVLLTSYELI+IDQA+LGSI W  LVVDEAHRLKNNQSKFFR+L++Y + +KLLLTGTPLQNNLEELFHLL+F+TPE+FN+++GFL+EFADI+KE+Q+K+LH++LG H+LRRLKADV   MPSK E IVRVELSPMQ K+YKYILTRNF+AL+ +GGG+Q+SL+N+VMDLKKCCNHPYLFP+ + EAPK+ NG Y+G AL KASGKL LL+KML KLK GGHRVLIFSQMT++LD+LEDF++  GYK+ERIDG VTG  RQ++IDRFNAP +  FVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQ+ KVMIYRFVT+ +VEER+TQVAKKKMMLTHLVVRPGLG K G SMSK+ELD+ILKFGTE LFK    E D  E+D  ++ YDD AIDRL+DR+Q   E+ E   M +YLSSFKVA Y  ++    E+D D        EIIKQ+ +  DP YWEKLLRHHYEQ QEDL++ LGKGKR RK VNY+   QED     +W D   D+  +  S+  EE DE++DE R E   +RR  R+    D  K +PPLL +V G +EVLGFN RQRKAF+NAVMRYG+PP D   + W+VR+LR KS++  +AY++LF+RHLCEP +D  + ++D VPREG+SRQHVLTRIG+M+++RKKVQEFE +NGQ+S
Sbjct:  369 GYETDHQDYCEVCQQGGEIILCDTCPRAYHMVCLDPDMERAPEGTWSCPHCEKEGIQWEAREESSEG----EEENDDGRRDDGDVEEEDDHHMEFCRVCKDGGELLCCDTCPSSYHLHCLNPPLPDIPNGEWICPRCLSPPLKGKVQKVLTWRWGEAPPPMPVPRPADLPAEA-PDPPPMIGRKE---REFFVKWCNKSYWHCSWVQELQLELNCQVMFRNYQRKTDMEEPPNLEMGAEGDEDKSCKRKNKDPFYARMEDKYGRFGVKIEWLFIHRILNHSVDKKNNVHYLIKWRDLPYDQSTWESED--MDVPDFETYKQHYWNHRELMLGE--EGRPGKKMKKVKVRKTERPPANPVVDPTIKFDRQPDYLDSTGGTLHPYQLEGLNWLRFSWAQGTDTILADEMGLGKTVQTAVFLYSLYKEGHSKGPFLVSAPLSTIINWEREFEMWAPDMYVVTYVGDKDSRAVIRENEFTFEDNAIRGGKKASKMKKEAAVKFHVLLTSYELITIDQAILGSIDWACLVVDEAHRLKNNQSKFFRVLNNYPLQHKLLLTGTPLQNNLEELFHLLNFLTPERFNNLEGFLEEFADIAKEDQIKKLHDMLGPHMLRRLKADVFKHMPSKTELIVRVELSPMQKKYYKYILTRNFEALNTRGGGNQVSLLNVVMDLKKCCNHPYLFPTAATEAPKMPNGMYDGSALTKASGKLMLLFKMLKKLKEGGHRVLIFSQMTKMLDLLEDFLENEGYKYERIDGGVTGGMRQEAIDRFNAPGAPQFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQNKKVMIYRFVTKASVEERITQVAKKKMMLTHLVVRPGLGSKAG-SMSKQELDDILKFGTEQLFKDELGEGDNKEEDSSVIHYDDKAIDRLLDRNQDATEDTELQSMNEYLSSFKVAQYVVKDEDEEEEDVDR-------EIIKQE-ESVDPDYWEKLLRHHYEQQQEDLARHLGKGKRPRKPVNYNDCSQEDRGSRRDWQDDQSDNQSDY-SVASEEGDEDFDE-RSEAANSRRPSRKGLRNDKDKPLPPLLARVGGNIEVLGFNARQRKAFLNAVMRYGMPPQDAFTTQWLVRDLRGKSEKEFKAYVSLFMRHLCEPGADGAETFADGVPREGLSRQHVLTRIGVMSLIRKKVQEFEHVNGQWS 1529          

HSP 2 Score: 250.366 bits (638), Expect = 6.071e-66
Identity = 131/225 (58.22%), Postives = 171/225 (76.00%), Query Frame = -1
Query:  245 ADECNKIVINKFMFNIADGGFTELHTIWQNEQRAL-VEGHEQDIWHRKHDYWLLAGVVAHGYGRWQDIHNDVRFAIVNEPFRNEQQKPNYLEIKNRFLARRFKLLEQALTIEEQLRRAAQLNLTYAPNDQVQNLNRRFTELECLATSQQNVYTEAVQGNKTLVPVLHRVLTQLEDLLSDMKQDXXXXXXXXXXXXXXSQRLNLTQTNLIQKLTV---QMQQTKPQ 907
            ++E  K V  +FMFNIADGGFTELH++WQNE+RA  V     +IWHR+HDYWLLAG++ HGY RWQD+ ND RFAI+NEPF+ E  + N+LEIKN+FLARRFKLLEQAL IEEQLRRAA LN+T  P+     LN RF+E+ECLA S Q++  E++ GNK    VLH+VL QLE+LLSDMK DV RLPA++AR+ PV+ RL +++ +++ +L     ++ QT+ Q
Sbjct: 1728 SEEKKKAVKQRFMFNIADGGFTELHSLWQNEERAATVTKKTYEIWHRRHDYWLLAGIIFHGYARWQDVQNDPRFAILNEPFKGEMSRGNFLEIKNKFLARRFKLLEQALVIEEQLRRAAYLNMTEDPSHPSMALNTRFSEVECLAESHQHLSKESMSGNKPANAVLHKVLKQLEELLSDMKADVTRLPATIARIPPVAVRLQMSERSILSRLASRGPEVTQTQAQ 1952          
BLAST of chromodomain helicase DNA-binding protein 4 vs. Ensembl Zebrafish
Match: chd4a (chromodomain helicase DNA binding protein 4a [Source:ZFIN;Acc:ZDB-GENE-041111-187])

HSP 1 Score: 1410.2 bits (3649), Expect = 0.000e+0
Identity = 717/1184 (60.56%), Postives = 889/1184 (75.08%), Query Frame = -1
Query: 1136 GYDTDHQDYCEVCQQGGEIMLCDTCPRAFHLVCLDPELEEAPEGSWSCPHCEKEGVVAASRSTTPATGGDMSQNPQNIRKSAQPNEEEKDEHQEFCNECKDGGDLICCAKCPVSYHPECLYPPLSEIPEGPWLCPRCGCGPLKAKVHKILTWRWMEPPKGKDELDHTHKSTEVEKNPTGGHGRQRAPMREFFVKFRDLSYWNCEWLTELQLDVHHPILLRNYFKKNDMDEPPAPEDGST--YKGRAREKVADPH--NLEERFYKWSVRPEWMQIHRIIDHMTHRNNSIWYLIKWRDLAYDECTWEQLDGEYEVIDMKHLVEEYHIMRKLFTGDIYKKKFKNSSXXXXXXXXXXXXXXPTTDLKKRMSKQPDYIEETGGKLHQYQLEGLNWLRFSFGNVVDTILADEMGLGKTIQTITFLYSLYKEGHSKGPFLVAAPLSTVINWEREFEFWAPDFYVVTYVGDKDSRAVVREHEFSYEEGAMRTSKHACRMRQGTRTKFHVLLTSYELISIDQALLGSISWEVLVVDEAHRLKNNQSKFFRILSSYKINYKLLLTGTPLQNNLEELFHLLHFMTPEKFNDMQGFLDEFADISKEEQVKRLHEILGEHLLRRLKADVLTDMPSKGEFIVRVELSPMQAKFYKYILTRNFDALSVKGGGSQISLINIVMDLKKCCNHPYLFPSGSDEAPKLRNGAYEGLALIKASGKLELLYKMLPKLKTGGHRVLIFSQMTRLLDILEDFMDYMGYKFERIDGAVTGQQRQDSIDRFNAPDSVSFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQSNKVMIYRFVTRNTVEERVTQVAKKKMMLTHLVVRPGLGGKGGASMSKKELDEILKFGTEDLFK----EKDENEDDHKIV-YDDGAIDRLIDRSQQGIEEKE-DMMTDYLSSFKVAHYSKREVSVNXXXXXXXXXETRGEIIKQDLDPADPTYWEKLLRHHYEQDQEDLSKSLGKGKRIRKQVNYSATQQED----DNWNDAVGDSDHESGSINKEEDDEEYDESRGEIIGTRRSKRE---RDGTK-MPPLLVKVNGQLEVLGFNVRQRKAFINAVMRYGLPPMDFINSHWMVRELRCKSDRVMRAYINLFLRHLCEPESDNTDCYSDQVPREGVSRQHVLTRIGIMAVVRKKVQEFEKINGQYS 4633
            GY+TDHQDYCEVCQQGGEI+LCDTCPRA+H+VCLDP++E APEG+WSCPHCEKEG+   +R  +        +   + R+     EEE D H EFC  CKDGG+L+CC  CP SYH  CL PPL +IP G W+CPRC   PLK KV K+LTWRW E P             E   +P    GR+    REFFVK+ + SYW+C W+ ELQL+++  ++ RNY +K DM+EPP  E G+        + K  DP    +E+++ ++ V+ EW+ IHRI++H   + N++ YLIKWRDL YD+ TWE  D   +V D +   + Y   R+L  G+  + +        ++   + PP +P  D   +  +QPDY++ TGG LH YQLEGLNWLRFS+    DTILADEMGLGKT+QT  FLYSLYKEGHSKGPFLV+APLST+INWEREFE WAPD YVVTYVGDKDSRAV+RE+EF++E+ A+R  K A +M++    KFHVLLTSYELI+IDQA+LGSI W  LVVDEAHRLKNNQSKFFR+L++Y + +KLLLTGTPLQNNLEELFHLL+F+TPE+FN+++GFL+EFADI+KE+Q+K+LH++LG H+LRRLKADV   MPSK E IVRVELSPMQ K+YKYILTRNF+AL+ +GGG+Q+SL+N+VMDLKKCCNHPYLFP+ + EAPK+ NG Y+G AL KASGKL LL+KML KLK GGHRVLIFSQMT++LD+LEDF++  GYK+ERIDG VTG  RQ++IDRFNAP +  FVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQ+ KVMIYRFVT+ +VEER+TQVAKKKMMLTHLVVRPGLG K G SMSK+ELD+ILKFGTE LFK    E D  E+D  ++ YDD AIDRL+DR+Q   E+ E   M +YLSSFKVA Y  ++    E+D D        EIIKQ+ +  DP YWEKLLRHHYEQ QEDL++ LGKGKR RK VNY+   QED     +W D   D+  +  S+  EE DE++DE R E   +RR  R+    D  K +PPLL +V G +EVLGFN RQRKAF+NAVMRYG+PP D   + W+VR+LR KS++  +AY++LF+RHLCEP +D  + ++D VPREG+SRQHVLTRIG+M+++RKKVQEFE +NGQ+S
Sbjct:  368 GYETDHQDYCEVCQQGGEIILCDTCPRAYHMVCLDPDMERAPEGTWSCPHCEKEGIQWEAREESSEG----EEENDDGRRDDGDVEEEDDHHMEFCRVCKDGGELLCCDTCPSSYHLHCLNPPLPDIPNGEWICPRCLSPPLKGKVQKVLTWRWGEAPPPMPVPRPADLPAEA-PDPPPMIGRKE---REFFVKWCNKSYWHCSWVQELQLELNCQVMFRNYQRKTDMEEPPNLEMGAEGDEDKSCKRKNKDPFYARMEDKYGRFGVKIEWLFIHRILNHSVDKKNNVHYLIKWRDLPYDQSTWESED--MDVPDFETYKQHYWNHRELMLGE--EGRPGKKMKKVKVRKTERPPANPVVDPTIKFDRQPDYLDSTGGTLHPYQLEGLNWLRFSWAQGTDTILADEMGLGKTVQTAVFLYSLYKEGHSKGPFLVSAPLSTIINWEREFEMWAPDMYVVTYVGDKDSRAVIRENEFTFEDNAIRGGKKASKMKKEAAVKFHVLLTSYELITIDQAILGSIDWACLVVDEAHRLKNNQSKFFRVLNNYPLQHKLLLTGTPLQNNLEELFHLLNFLTPERFNNLEGFLEEFADIAKEDQIKKLHDMLGPHMLRRLKADVFKHMPSKTELIVRVELSPMQKKYYKYILTRNFEALNTRGGGNQVSLLNVVMDLKKCCNHPYLFPTAATEAPKMPNGMYDGSALTKASGKLMLLFKMLKKLKEGGHRVLIFSQMTKMLDLLEDFLENEGYKYERIDGGVTGGMRQEAIDRFNAPGAPQFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQNKKVMIYRFVTKASVEERITQVAKKKMMLTHLVVRPGLGSKAG-SMSKQELDDILKFGTEQLFKDELGEGDNKEEDSSVIHYDDKAIDRLLDRNQDATEDTELQSMNEYLSSFKVAQYVVKDEDEEEEDVDR-------EIIKQE-ESVDPDYWEKLLRHHYEQQQEDLARHLGKGKRPRKPVNYNDCSQEDRGSRRDWQDDQSDNQSDY-SVASEEGDEDFDE-RSEAANSRRPSRKGLRNDKDKPLPPLLARVGGNIEVLGFNARQRKAFLNAVMRYGMPPQDAFTTQWLVRDLRGKSEKEFKAYVSLFMRHLCEPGADGAETFADGVPREGLSRQHVLTRIGVMSLIRKKVQEFEHVNGQWS 1528          

HSP 2 Score: 250.366 bits (638), Expect = 5.964e-66
Identity = 131/225 (58.22%), Postives = 171/225 (76.00%), Query Frame = -1
Query:  245 ADECNKIVINKFMFNIADGGFTELHTIWQNEQRAL-VEGHEQDIWHRKHDYWLLAGVVAHGYGRWQDIHNDVRFAIVNEPFRNEQQKPNYLEIKNRFLARRFKLLEQALTIEEQLRRAAQLNLTYAPNDQVQNLNRRFTELECLATSQQNVYTEAVQGNKTLVPVLHRVLTQLEDLLSDMKQDXXXXXXXXXXXXXXSQRLNLTQTNLIQKLTV---QMQQTKPQ 907
            ++E  K V  +FMFNIADGGFTELH++WQNE+RA  V     +IWHR+HDYWLLAG++ HGY RWQD+ ND RFAI+NEPF+ E  + N+LEIKN+FLARRFKLLEQAL IEEQLRRAA LN+T  P+     LN RF+E+ECLA S Q++  E++ GNK    VLH+VL QLE+LLSDMK DV RLPA++AR+ PV+ RL +++ +++ +L     ++ QT+ Q
Sbjct: 1727 SEEKKKAVKQRFMFNIADGGFTELHSLWQNEERAATVTKKTYEIWHRRHDYWLLAGIIFHGYARWQDVQNDPRFAILNEPFKGEMSRGNFLEIKNKFLARRFKLLEQALVIEEQLRRAAYLNMTEDPSHPSMALNTRFSEVECLAESHQHLSKESMSGNKPANAVLHKVLKQLEELLSDMKADVTRLPATIARIPPVAVRLQMSERSILSRLASRGPEVTQTQAQ 1951          
BLAST of chromodomain helicase DNA-binding protein 4 vs. Ensembl Xenopus
Match: son (SON DNA binding protein [Source:Xenbase;Acc:XB-GENE-6037418])

HSP 1 Score: 1452.19 bits (3758), Expect = 0.000e+0
Identity = 715/1180 (60.59%), Postives = 892/1180 (75.59%), Query Frame = -1
Query: 1136 GYDTDHQDYCEVCQQGGEIMLCDTCPRAFHLVCLDPELEEAPEGSWSCPHCEKEGVVAASRSTTPATGGDMSQNPQNIRKSAQPNEEEKDEHQEFCNECKDGGDLICCAKCPVSYHPECLYPPLSEIPEGPWLCPRCGCGPLKAKVHKILTWRWMEPPKGKDELDHTHKSTEVEKNPTGGHGRQRAPMREFFVKFRDLSYWNCEWLTELQLDVHHPILLRNYFKKNDMDEPPAPEDGSTYKGRARE-KVADPHNLE--ERFYKWSVRPEWMQIHRIIDHMTHRNNSIWYLIKWRDLAYDECTWEQLDGEYEVIDMKHLVEEYHIMRKLFTGDIYKKKFKNSSXXXXXXXXXXXXXXPTTDLKKRMSKQPDYIEETGGKLHQYQLEGLNWLRFSFGNVVDTILADEMGLGKTIQTITFLYSLYKEGHSKGPFLVAAPLSTVINWEREFEFWAPDFYVVTYVGDKDSRAVVREHEFSYEEGAMRTSKHACRMRQGTRTKFHVLLTSYELISIDQALLGSISWEVLVVDEAHRLKNNQSKFFRILSSYKINYKLLLTGTPLQNNLEELFHLLHFMTPEKFNDMQGFLDEFADISKEEQVKRLHEILGEHLLRRLKADVLTDMPSKGEFIVRVELSPMQAKFYKYILTRNFDALSVKGGGSQISLINIVMDLKKCCNHPYLFPSGSDEAPKLRNGAYEGLALIKASGKLELLYKMLPKLKTGGHRVLIFSQMTRLLDILEDFMDYMGYKFERIDGAVTGQQRQDSIDRFNAPDSVSFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQSNKVMIYRFVTRNTVEERVTQVAKKKMMLTHLVVRPGLGGKGGASMSKKELDEILKFGTEDLFK-----EKDENEDDHKIVYDDGAIDRLIDRSQQGIEEKEDM-----MTDYLSSFKVAHYSKREVSVNXXXXXXXXXETRGEIIKQDLDPADPTYWEKLLRHHYEQDQEDLSKSLGKGKRIRKQVNYSATQQEDDNWNDAVGDSDHESGSINKEEDDEEYDE-SRGEIIGTRRSKRERDGTKMPPLLVKVNGQLEVLGFNVRQRKAFINAVMRYGLPPMDFINSHWMVRELRCKSDRVMRAYINLFLRHLCEPESDNTDCYSDQVPREGVSRQHVLTRIGIMAVVRKKVQEFEKINGQYS 4633
            GY+TDHQDYCEVCQQGGEI+LCDTCPRA+H+VCLDP++++APEG WSCPHCEKEGV   ++        D S+   ++  +    EEE D H EFC  CKDGG+L+CC  CP SYH  CL PPL EIP G WLCPRC C  LK K+ KILTW+W +PP             E    P    GR   P REFFVK++ +SY +C W+TELQL++H  ++ RNY +KNDMDEPPA + G   + ++R+ K  DP  LE  E+FY++ ++PEWM IHR+++H   +   + YLIKWRDL YD+ +WE  + + +  D+    + Y   R+L  GD  + +    +   ++   + PP+ P  D   +  +QP+Y++ TGG LH YQLEGLNWLRFS+    DTILADEMGLGKT+QT  FLYSLYKEGHSKGPFLV+APLST+INWEREFE WAPD YVVTYVGDKDSRAV+RE+EFS+E+ A+R  K A RM++    KFHVLLTSYELI+ID A+LGSI W  LVVDEAHRLKNNQSKFFR+L+ Y + +KLLLTGTPLQNNLEELFHLL+F+TPE+FN+++GFL+EFADI+KE+Q+K+LH++LG H+LRRLKADV  +MPSK E IVRVELSPMQ K+YK+ILTRNF+AL+ +GGG+Q+SL+N+VMDLKKCCNHPYLFP  + EAPK+ NG Y+G ALIK +GKL LL KML KLK  GHRVLIFSQMT++LD+LEDF+++ GYK+ERIDG +TG  RQ++IDRFNAP +  F FLLSTRAGGLGINLATADTV+IYDSDWNPHNDIQAFSRAHRIGQ+ KVMIYRFVTR +VEER+TQVAKKKMMLTHLVVRPGLG K G SMSK+ELD+ILKFGTE+LFK     E  E +D   I YDD AI RL+DR+Q   +E ED+     M +YLSSFKVA Y  RE  + +++E         EIIKQ+ +  DP YWEKLLRHHYEQ QEDL+++LGKGKRIRKQVNY+   QED +W D   D+  +  S+  EE DE++DE S       R+  R      +PPLL +V G +EVLGFN RQRKAF+NA+MRYG+PP D   + W+VR+LR KS++  +AY++LF+RHLCEP +D  + ++D VPREG+SRQHVLTRIG+M+++RKKVQEFE +NG++S
Sbjct:  355 GYETDHQDYCEVCQQGGEIILCDTCPRAYHMVCLDPDMDKAPEGKWSCPHCEKEGVQWEAKE-------DNSEIDDDMDDTVGDPEEE-DHHMEFCRVCKDGGELLCCDACPSSYHIHCLNPPLPEIPNGEWLCPRCTCPALKGKIQKILTWKWGQPPPPTPVPRPADADPEAPP-PKPLEGR---PEREFFVKWQAMSYLHCSWVTELQLELHCQVMFRNYQRKNDMDEPPAGDYGGDDEEKSRKRKNKDPKYLEMEEKFYRYGIKPEWMMIHRVLNHSVDKKGFVHYLIKWRDLPYDQASWESEESDIQDYDIYR--QAYWNHRELMCGD--EGRPGKKTKKVKLRKVERPPDTPAVDPTVKYDRQPEYLDATGGTLHPYQLEGLNWLRFSWAQGTDTILADEMGLGKTVQTAVFLYSLYKEGHSKGPFLVSAPLSTIINWEREFEMWAPDMYVVTYVGDKDSRAVIRENEFSFEDNAIRGGKKASRMKKEASVKFHVLLTSYELITIDMAVLGSIDWACLVVDEAHRLKNNQSKFFRVLNGYSLQHKLLLTGTPLQNNLEELFHLLNFLTPERFNNLEGFLEEFADIAKEDQIKKLHDMLGPHMLRRLKADVFKNMPSKTELIVRVELSPMQKKYYKFILTRNFEALNARGGGNQVSLLNVVMDLKKCCNHPYLFPVAAMEAPKMPNGMYDGSALIKGAGKLLLLQKMLRKLKDDGHRVLIFSQMTKMLDLLEDFLEHEGYKYERIDGGITGNMRQEAIDRFNAPGAQQFCFLLSTRAGGLGINLATADTVVIYDSDWNPHNDIQAFSRAHRIGQNKKVMIYRFVTRASVEERITQVAKKKMMLTHLVVRPGLGSKTG-SMSKQELDDILKFGTEELFKDEATEENKEGDDISVIHYDDKAIARLLDRNQ---DETEDLVELQGMNEYLSSFKVAQYVVREEEMGDEEEVVR------EIIKQE-ESVDPDYWEKLLRHHYEQQQEDLARNLGKGKRIRKQVNYNDGSQEDRDWQDDQSDNQSDY-SVASEEGDEDFDERSEAARRPNRKGLRNDKDKPLPPLLARVGGNIEVLGFNARQRKAFLNAIMRYGMPPQDAFTTQWLVRDLRGKSEKEFKAYVSLFMRHLCEPGADGAETFADGVPREGLSRQHVLTRIGVMSLIRKKVQEFEHVNGRWS 1506          

HSP 2 Score: 250.366 bits (638), Expect = 9.818e-66
Identity = 127/212 (59.91%), Postives = 165/212 (77.83%), Query Frame = -1
Query:  245 KFMFNIADGGFTELHTIWQNEQRAL-VEGHEQDIWHRKHDYWLLAGVVAHGYGRWQDIHNDVRFAIVNEPFRNEQQKPNYLEIKNRFLARRFKLLEQALTIEEQLRRAAQLNLTYAPNDQVQNLNRRFTELECLATSQQNVYTEAVQGNKTLVPVLHRVLTQLEDLLSDMKQDXXXXXXXXXXXXXXSQRLNLTQTNLIQKLTVQMQQTKPQ 877
            +FMFNIADGGFTELH++WQNE+RA  V     +IWHR+HDYWLL+G++ HGY RWQDI NDVR+AI+NEPF+ E  + N+LEIKN+FLARRFKLLEQAL IEEQLRRAA LN++  P+     LN RF E+ECLA S Q++  E++ GNK    VLH+VL QLE+LLSDMK DV RLPA++AR+ PV+ RL +++ N++ +L  +  + +PQ
Sbjct: 1673 RFMFNIADGGFTELHSLWQNEERAATVTKKTYEIWHRRHDYWLLSGIITHGYARWQDIQNDVRYAILNEPFKGEVNRGNFLEIKNKFLARRFKLLEQALVIEEQLRRAAYLNMSEDPSHPSMALNTRFAEVECLAESHQHLSKESMAGNKPANAVLHKVLKQLEELLSDMKADVTRLPATIARIPPVAVRLQMSERNILSRLASRGGEPQPQ 1884          
BLAST of chromodomain helicase DNA-binding protein 4 vs. Ensembl Xenopus
Match: son (SON DNA binding protein [Source:Xenbase;Acc:XB-GENE-6037418])

HSP 1 Score: 1449.11 bits (3750), Expect = 0.000e+0
Identity = 715/1180 (60.59%), Postives = 892/1180 (75.59%), Query Frame = -1
Query: 1136 GYDTDHQDYCEVCQQGGEIMLCDTCPRAFHLVCLDPELEEAPEGSWSCPHCEKEGVVAASRSTTPATGGDMSQNPQNIRKSAQPNEEEKDEHQEFCNECKDGGDLICCAKCPVSYHPECLYPPLSEIPEGPWLCPRCGCGPLKAKVHKILTWRWMEPPKGKDELDHTHKSTEVEKNPTGGHGRQRAPMREFFVKFRDLSYWNCEWLTELQLDVHHPILLRNYFKKNDMDEPPAPEDGSTYKGRARE-KVADPHNLE--ERFYKWSVRPEWMQIHRIIDHMTHRNNSIWYLIKWRDLAYDECTWEQLDGEYEVIDMKHLVEEYHIMRKLFTGDIYKKKFKNSSXXXXXXXXXXXXXXPTTDLKKRMSKQPDYIEETGGKLHQYQLEGLNWLRFSFGNVVDTILADEMGLGKTIQTITFLYSLYKEGHSKGPFLVAAPLSTVINWEREFEFWAPDFYVVTYVGDKDSRAVVREHEFSYEEGAMRTSKHACRMRQGTRTKFHVLLTSYELISIDQALLGSISWEVLVVDEAHRLKNNQSKFFRILSSYKINYKLLLTGTPLQNNLEELFHLLHFMTPEKFNDMQGFLDEFADISKEEQVKRLHEILGEHLLRRLKADVLTDMPSKGEFIVRVELSPMQAKFYKYILTRNFDALSVKGGGSQISLINIVMDLKKCCNHPYLFPSGSDEAPKLRNGAYEGLALIKASGKLELLYKMLPKLKTGGHRVLIFSQMTRLLDILEDFMDYMGYKFERIDGAVTGQQRQDSIDRFNAPDSVSFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQSNKVMIYRFVTRNTVEERVTQVAKKKMMLTHLVVRPGLGGKGGASMSKKELDEILKFGTEDLFK-----EKDENEDDHKIVYDDGAIDRLIDRSQQGIEEKEDM-----MTDYLSSFKVAHYSKREVSVNXXXXXXXXXETRGEIIKQDLDPADPTYWEKLLRHHYEQDQEDLSKSLGKGKRIRKQVNYSATQQEDDNWNDAVGDSDHESGSINKEEDDEEYDE-SRGEIIGTRRSKRERDGTKMPPLLVKVNGQLEVLGFNVRQRKAFINAVMRYGLPPMDFINSHWMVRELRCKSDRVMRAYINLFLRHLCEPESDNTDCYSDQVPREGVSRQHVLTRIGIMAVVRKKVQEFEKINGQYS 4633
            GY+TDHQDYCEVCQQGGEI+LCDTCPRA+H+VCLDP++++APEG WSCPHCEKEGV   ++        D S+   ++  +    EEE D H EFC  CKDGG+L+CC  CP SYH  CL PPL EIP G WLCPRC C  LK K+ KILTW+W +PP             E    P    GR   P REFFVK++ +SY +C W+TELQL++H  ++ RNY +KNDMDEPPA + G   + ++R+ K  DP  LE  E+FY++ ++PEWM IHR+++H   +   + YLIKWRDL YD+ +WE  + + +  D+    + Y   R+L  GD  + +    +   ++   + PP+ P  D   +  +QP+Y++ TGG LH YQLEGLNWLRFS+    DTILADEMGLGKT+QT  FLYSLYKEGHSKGPFLV+APLST+INWEREFE WAPD YVVTYVGDKDSRAV+RE+EFS+E+ A+R  K A RM++    KFHVLLTSYELI+ID A+LGSI W  LVVDEAHRLKNNQSKFFR+L+ Y + +KLLLTGTPLQNNLEELFHLL+F+TPE+FN+++GFL+EFADI+KE+Q+K+LH++LG H+LRRLKADV  +MPSK E IVRVELSPMQ K+YK+ILTRNF+AL+ +GGG+Q+SL+N+VMDLKKCCNHPYLFP  + EAPK+ NG Y+G ALIK +GKL LL KML KLK  GHRVLIFSQMT++LD+LEDF+++ GYK+ERIDG +TG  RQ++IDRFNAP +  F FLLSTRAGGLGINLATADTV+IYDSDWNPHNDIQAFSRAHRIGQ+ KVMIYRFVTR +VEER+TQVAKKKMMLTHLVVRPGLG K G SMSK+ELD+ILKFGTE+LFK     E  E +D   I YDD AI RL+DR+Q   +E ED+     M +YLSSFKVA Y  RE  + +++E         EIIKQ+ +  DP YWEKLLRHHYEQ QEDL+++LGKGKRIRKQVNY+   QED +W D   D+  +  S+  EE DE++DE S       R+  R      +PPLL +V G +EVLGFN RQRKAF+NA+MRYG+PP D   + W+VR+LR KS++  +AY++LF+RHLCEP +D  + ++D VPREG+SRQHVLTRIG+M+++RKKVQEFE +NG++S
Sbjct:  332 GYETDHQDYCEVCQQGGEIILCDTCPRAYHMVCLDPDMDKAPEGKWSCPHCEKEGVQWEAKE-------DNSEIDDDMDDTVGDPEEE-DHHMEFCRVCKDGGELLCCDACPSSYHIHCLNPPLPEIPNGEWLCPRCTCPALKGKIQKILTWKWGQPPPPTPVPRPADADPEAPP-PKPLEGR---PEREFFVKWQAMSYLHCSWVTELQLELHCQVMFRNYQRKNDMDEPPAGDYGGDDEEKSRKRKNKDPKYLEMEEKFYRYGIKPEWMMIHRVLNHSVDKKGFVHYLIKWRDLPYDQASWESEESDIQDYDIYR--QAYWNHRELMCGD--EGRPGKKTKKVKLRKVERPPDTPAVDPTVKYDRQPEYLDATGGTLHPYQLEGLNWLRFSWAQGTDTILADEMGLGKTVQTAVFLYSLYKEGHSKGPFLVSAPLSTIINWEREFEMWAPDMYVVTYVGDKDSRAVIRENEFSFEDNAIRGGKKASRMKKEASVKFHVLLTSYELITIDMAVLGSIDWACLVVDEAHRLKNNQSKFFRVLNGYSLQHKLLLTGTPLQNNLEELFHLLNFLTPERFNNLEGFLEEFADIAKEDQIKKLHDMLGPHMLRRLKADVFKNMPSKTELIVRVELSPMQKKYYKFILTRNFEALNARGGGNQVSLLNVVMDLKKCCNHPYLFPVAAMEAPKMPNGMYDGSALIKGAGKLLLLQKMLRKLKDDGHRVLIFSQMTKMLDLLEDFLEHEGYKYERIDGGITGNMRQEAIDRFNAPGAQQFCFLLSTRAGGLGINLATADTVVIYDSDWNPHNDIQAFSRAHRIGQNKKVMIYRFVTRASVEERITQVAKKKMMLTHLVVRPGLGSKTG-SMSKQELDDILKFGTEELFKDEATEENKEGDDISVIHYDDKAIARLLDRNQ---DETEDLVELQGMNEYLSSFKVAQYVVREEEMGDEEEVVR------EIIKQE-ESVDPDYWEKLLRHHYEQQQEDLARNLGKGKRIRKQVNYNDGSQEDRDWQDDQSDNQSDY-SVASEEGDEDFDERSEAARRPNRKGLRNDKDKPLPPLLARVGGNIEVLGFNARQRKAFLNAIMRYGMPPQDAFTTQWLVRDLRGKSEKEFKAYVSLFMRHLCEPGADGAETFADGVPREGLSRQHVLTRIGVMSLIRKKVQEFEHVNGRWS 1483          

HSP 2 Score: 249.595 bits (636), Expect = 1.620e-65
Identity = 127/212 (59.91%), Postives = 165/212 (77.83%), Query Frame = -1
Query:  245 KFMFNIADGGFTELHTIWQNEQRAL-VEGHEQDIWHRKHDYWLLAGVVAHGYGRWQDIHNDVRFAIVNEPFRNEQQKPNYLEIKNRFLARRFKLLEQALTIEEQLRRAAQLNLTYAPNDQVQNLNRRFTELECLATSQQNVYTEAVQGNKTLVPVLHRVLTQLEDLLSDMKQDXXXXXXXXXXXXXXSQRLNLTQTNLIQKLTVQMQQTKPQ 877
            +FMFNIADGGFTELH++WQNE+RA  V     +IWHR+HDYWLL+G++ HGY RWQDI NDVR+AI+NEPF+ E  + N+LEIKN+FLARRFKLLEQAL IEEQLRRAA LN++  P+     LN RF E+ECLA S Q++  E++ GNK    VLH+VL QLE+LLSDMK DV RLPA++AR+ PV+ RL +++ N++ +L  +  + +PQ
Sbjct: 1648 RFMFNIADGGFTELHSLWQNEERAATVTKKTYEIWHRRHDYWLLSGIITHGYARWQDIQNDVRYAILNEPFKGEVNRGNFLEIKNKFLARRFKLLEQALVIEEQLRRAAYLNMSEDPSHPSMALNTRFAEVECLAESHQHLSKESMAGNKPANAVLHKVLKQLEELLSDMKADVTRLPATIARIPPVAVRLQMSERNILSRLASRGGEPQPQ 1859          
BLAST of chromodomain helicase DNA-binding protein 4 vs. Ensembl Xenopus
Match: son (SON DNA binding protein [Source:Xenbase;Acc:XB-GENE-6037418])

HSP 1 Score: 1447.57 bits (3746), Expect = 0.000e+0
Identity = 714/1180 (60.51%), Postives = 887/1180 (75.17%), Query Frame = -1
Query: 1136 GYDTDHQDYCEVCQQGGEIMLCDTCPRAFHLVCLDPELEEAPEGSWSCPHCEKEGVVAASRSTTPATGGDMSQNPQNIRKSAQPNEEEKDEHQEFCNECKDGGDLICCAKCPVSYHPECLYPPLSEIPEGPWLCPRCGCGPLKAKVHKILTWRWMEPPKGKDELDHTHKSTEVEKNPTGGHGRQRAPMREFFVKFRDLSYWNCEWLTELQLDVHHPILLRNYFKKNDMDEPPAPEDGSTYKGRARE-KVADPHNLE--ERFYKWSVRPEWMQIHRIIDHMTHRNNSIWYLIKWRDLAYDECTWEQLDGEYEVIDMKHLVEEYHIMRKLFTGDIYKKKFKNSSXXXXXXXXXXXXXXPTTDLKKRMSKQPDYIEETGGKLHQYQLEGLNWLRFSFGNVVDTILADEMGLGKTIQTITFLYSLYKEGHSKGPFLVAAPLSTVINWEREFEFWAPDFYVVTYVGDKDSRAVVREHEFSYEEGAMRTSKHACRMRQGTRTKFHVLLTSYELISIDQALLGSISWEVLVVDEAHRLKNNQSKFFRILSSYKINYKLLLTGTPLQNNLEELFHLLHFMTPEKFNDMQGFLDEFADISKEEQVKRLHEILGEHLLRRLKADVLTDMPSKGEFIVRVELSPMQAKFYKYILTRNFDALSVKGGGSQISLINIVMDLKKCCNHPYLFPSGSDEAPKLRNGAYEGLALIKASGKLELLYKMLPKLKTGGHRVLIFSQMTRLLDILEDFMDYMGYKFERIDGAVTGQQRQDSIDRFNAPDSVSFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQSNKVMIYRFVTRNTVEERVTQVAKKKMMLTHLVVRPGLGGKGGASMSKKELDEILKFGTEDLFK-----EKDENEDDHKIVYDDGAIDRLIDRSQQGIEEKEDM-----MTDYLSSFKVAHYSKREVSVNXXXXXXXXXETRGEIIKQDLDPADPTYWEKLLRHHYEQDQEDLSKSLGKGKRIRKQVNYSATQQEDDNWNDAVGDSDHESGSINKEEDDEEYDE-SRGEIIGTRRSKRERDGTKMPPLLVKVNGQLEVLGFNVRQRKAFINAVMRYGLPPMDFINSHWMVRELRCKSDRVMRAYINLFLRHLCEPESDNTDCYSDQVPREGVSRQHVLTRIGIMAVVRKKVQEFEKINGQYS 4633
            GY+TDHQDYCEVCQQGGEI+LCDTCPRA+H+VCLDP++++APEG WSCPHCEKEGV   ++        D S+   ++  +    EEE D H EFC  CKDGG+L+CC  CP SYH  CL PPL EIP G WLCPRC C  LK K+ KILTW+W +PP             E    P    GR   P REFFVK++ +SY +C W+TELQL++H  ++ RNY +KNDMDEPPA + G   + ++R+ K  DP  LE  E+FY++ ++PEWM IHR+++H   +   + YLIKWRDL YD+ +WE  + + +  D+    + Y   R+L  GD  + +    +   ++   + PP+ P  D   +  +QP+Y++ TGG LH YQLEGLNWLRFS+    DTILADEMGLGKT+QT  FLYSLYKEGHSKGPFLV+APLST+INWEREFE WAPD YVVTYVGDKDSRAV+RE+EFS+E+ A+R  K A RM++    KFHVLLTSYELI+ID A+LGSI W  LVVDEAHRLKNNQSKFFR+L+ Y + +KLLLTGTPLQNNLEELFHLL+F+TPE+FN+++GFL+EFADI+KE+Q+K+LH++LG H+LRRLKADV  +MPSK E IVRVELSPMQ K+YK+ILTRNF+AL+ +GGG+Q+SL+N+VMDLKKCCNHPYLFP  + EAPK+ NG Y+G ALIK +GKL LL KML KLK  GHRVLIFSQMT++LD+LEDF+++ GYK+ERIDG +TG  RQ++IDRFNAP +  F FLLSTRAGGLGINLATADTV+IYDSDWNPHNDIQAFSRAHRIGQ+ KVMIYRFVTR +VEER+TQVAKKKMMLTHLVVRPGLG K G SMSK+ELD+ILKFGTE+LFK     E  E +D   I YDD AI RL+DR+Q   +E ED+     M +YLSSFKVA Y   E  V              EIIKQ+ +  DP YWEKLLRHHYEQ QEDL+++LGKGKRIRKQVNY+   QED +W D   D+  +  S+  EE DE++DE S       R+  R      +PPLL +V G +EVLGFN RQRKAF+NA+MRYG+PP D   + W+VR+LR KS++  +AY++LF+RHLCEP +D  + ++D VPREG+SRQHVLTRIG+M+++RKKVQEFE +NG++S
Sbjct:  316 GYETDHQDYCEVCQQGGEIILCDTCPRAYHMVCLDPDMDKAPEGKWSCPHCEKEGVQWEAKE-------DNSEIDDDMDDTVGDPEEE-DHHMEFCRVCKDGGELLCCDACPSSYHIHCLNPPLPEIPNGEWLCPRCTCPALKGKIQKILTWKWGQPPPPTPVPRPADADPEAPP-PKPLEGR---PEREFFVKWQAMSYLHCSWVTELQLELHCQVMFRNYQRKNDMDEPPAGDYGGDDEEKSRKRKNKDPKYLEMEEKFYRYGIKPEWMMIHRVLNHSVDKKGFVHYLIKWRDLPYDQASWESEESDIQDYDIYR--QAYWNHRELMCGD--EGRPGKKTKKVKLRKVERPPDTPAVDPTVKYDRQPEYLDATGGTLHPYQLEGLNWLRFSWAQGTDTILADEMGLGKTVQTAVFLYSLYKEGHSKGPFLVSAPLSTIINWEREFEMWAPDMYVVTYVGDKDSRAVIRENEFSFEDNAIRGGKKASRMKKEASVKFHVLLTSYELITIDMAVLGSIDWACLVVDEAHRLKNNQSKFFRVLNGYSLQHKLLLTGTPLQNNLEELFHLLNFLTPERFNNLEGFLEEFADIAKEDQIKKLHDMLGPHMLRRLKADVFKNMPSKTELIVRVELSPMQKKYYKFILTRNFEALNARGGGNQVSLLNVVMDLKKCCNHPYLFPVAAMEAPKMPNGMYDGSALIKGAGKLLLLQKMLRKLKDDGHRVLIFSQMTKMLDLLEDFLEHEGYKYERIDGGITGNMRQEAIDRFNAPGAQQFCFLLSTRAGGLGINLATADTVVIYDSDWNPHNDIQAFSRAHRIGQNKKVMIYRFVTRASVEERITQVAKKKMMLTHLVVRPGLGSKTG-SMSKQELDDILKFGTEELFKDEATEENKEGDDISVIHYDDKAIARLLDRNQ---DETEDLVELQGMNEYLSSFKVAQYVDEEEVVR-------------EIIKQE-ESVDPDYWEKLLRHHYEQQQEDLARNLGKGKRIRKQVNYNDGSQEDRDWQDDQSDNQSDY-SVASEEGDEDFDERSEAARRPNRKGLRNDKDKPLPPLLARVGGNIEVLGFNARQRKAFLNAIMRYGMPPQDAFTTQWLVRDLRGKSEKEFKAYVSLFMRHLCEPGADGAETFADGVPREGLSRQHVLTRIGVMSLIRKKVQEFEHVNGRWS 1460          

HSP 2 Score: 242.276 bits (617), Expect = 2.211e-63
Identity = 127/219 (57.99%), Postives = 165/219 (75.34%), Query Frame = -1
Query:  245 KFMFNIADGGFTELHTIWQNEQRAL-VEGHEQDIWHRKHDYWLLAGVVA-------HGYGRWQDIHNDVRFAIVNEPFRNEQQKPNYLEIKNRFLARRFKLLEQALTIEEQLRRAAQLNLTYAPNDQVQNLNRRFTELECLATSQQNVYTEAVQGNKTLVPVLHRVLTQLEDLLSDMKQDXXXXXXXXXXXXXXSQRLNLTQTNLIQKLTVQMQQTKPQ 877
            +FMFNIADGGFTELH++WQNE+RA  V     +IWHR+HDYWLL+G++        HGY RWQDI NDVR+AI+NEPF+ E  + N+LEIKN+FLARRFKLLEQAL IEEQLRRAA LN++  P+     LN RF E+ECLA S Q++  E++ GNK    VLH+VL QLE+LLSDMK DV RLPA++AR+ PV+ RL +++ N++ +L  +  + +PQ
Sbjct: 1527 RFMFNIADGGFTELHSLWQNEERAATVTKKTYEIWHRRHDYWLLSGIITYPFGLVFHGYARWQDIQNDVRYAILNEPFKGEVNRGNFLEIKNKFLARRFKLLEQALVIEEQLRRAAYLNMSEDPSHPSMALNTRFAEVECLAESHQHLSKESMAGNKPANAVLHKVLKQLEELLSDMKADVTRLPATIARIPPVAVRLQMSERNILSRLASRGGEPQPQ 1745          
BLAST of chromodomain helicase DNA-binding protein 4 vs. Ensembl Xenopus
Match: son (SON DNA binding protein [Source:Xenbase;Acc:XB-GENE-6037418])

HSP 1 Score: 1447.18 bits (3745), Expect = 0.000e+0
Identity = 715/1180 (60.59%), Postives = 892/1180 (75.59%), Query Frame = -1
Query: 1136 GYDTDHQDYCEVCQQGGEIMLCDTCPRAFHLVCLDPELEEAPEGSWSCPHCEKEGVVAASRSTTPATGGDMSQNPQNIRKSAQPNEEEKDEHQEFCNECKDGGDLICCAKCPVSYHPECLYPPLSEIPEGPWLCPRCGCGPLKAKVHKILTWRWMEPPKGKDELDHTHKSTEVEKNPTGGHGRQRAPMREFFVKFRDLSYWNCEWLTELQLDVHHPILLRNYFKKNDMDEPPAPEDGSTYKGRARE-KVADPHNLE--ERFYKWSVRPEWMQIHRIIDHMTHRNNSIWYLIKWRDLAYDECTWEQLDGEYEVIDMKHLVEEYHIMRKLFTGDIYKKKFKNSSXXXXXXXXXXXXXXPTTDLKKRMSKQPDYIEETGGKLHQYQLEGLNWLRFSFGNVVDTILADEMGLGKTIQTITFLYSLYKEGHSKGPFLVAAPLSTVINWEREFEFWAPDFYVVTYVGDKDSRAVVREHEFSYEEGAMRTSKHACRMRQGTRTKFHVLLTSYELISIDQALLGSISWEVLVVDEAHRLKNNQSKFFRILSSYKINYKLLLTGTPLQNNLEELFHLLHFMTPEKFNDMQGFLDEFADISKEEQVKRLHEILGEHLLRRLKADVLTDMPSKGEFIVRVELSPMQAKFYKYILTRNFDALSVKGGGSQISLINIVMDLKKCCNHPYLFPSGSDEAPKLRNGAYEGLALIKASGKLELLYKMLPKLKTGGHRVLIFSQMTRLLDILEDFMDYMGYKFERIDGAVTGQQRQDSIDRFNAPDSVSFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQSNKVMIYRFVTRNTVEERVTQVAKKKMMLTHLVVRPGLGGKGGASMSKKELDEILKFGTEDLFK-----EKDENEDDHKIVYDDGAIDRLIDRSQQGIEEKEDM-----MTDYLSSFKVAHYSKREVSVNXXXXXXXXXETRGEIIKQDLDPADPTYWEKLLRHHYEQDQEDLSKSLGKGKRIRKQVNYSATQQEDDNWNDAVGDSDHESGSINKEEDDEEYDE-SRGEIIGTRRSKRERDGTKMPPLLVKVNGQLEVLGFNVRQRKAFINAVMRYGLPPMDFINSHWMVRELRCKSDRVMRAYINLFLRHLCEPESDNTDCYSDQVPREGVSRQHVLTRIGIMAVVRKKVQEFEKINGQYS 4633
            GY+TDHQDYCEVCQQGGEI+LCDTCPRA+H+VCLDP++++APEG WSCPHCEKEGV   ++        D S+   ++  +    EEE D H EFC  CKDGG+L+CC  CP SYH  CL PPL EIP G WLCPRC C  LK K+ KILTW+W +PP             E    P    GR   P REFFVK++ +SY +C W+TELQL++H  ++ RNY +KNDMDEPPA + G   + ++R+ K  DP  LE  E+FY++ ++PEWM IHR+++H   +   + YLIKWRDL YD+ +WE  + + +  D+    + Y   R+L  GD  + +    +   ++   + PP+ P  D   +  +QP+Y++ TGG LH YQLEGLNWLRFS+    DTILADEMGLGKT+QT  FLYSLYKEGHSKGPFLV+APLST+INWEREFE WAPD YVVTYVGDKDSRAV+RE+EFS+E+ A+R  K A RM++    KFHVLLTSYELI+ID A+LGSI W  LVVDEAHRLKNNQSKFFR+L+ Y + +KLLLTGTPLQNNLEELFHLL+F+TPE+FN+++GFL+EFADI+KE+Q+K+LH++LG H+LRRLKADV  +MPSK E IVRVELSPMQ K+YK+ILTRNF+AL+ +GGG+Q+SL+N+VMDLKKCCNHPYLFP  + EAPK+ NG Y+G ALIK +GKL LL KML KLK  GHRVLIFSQMT++LD+LEDF+++ GYK+ERIDG +TG  RQ++IDRFNAP +  F FLLSTRAGGLGINLATADTV+IYDSDWNPHNDIQAFSRAHRIGQ+ KVMIYRFVTR +VEER+TQVAKKKMMLTHLVVRPGLG K G SMSK+ELD+ILKFGTE+LFK     E  E +D   I YDD AI RL+DR+Q   +E ED+     M +YLSSFKVA Y  RE  + +++E         EIIKQ+ +  DP YWEKLLRHHYEQ QEDL+++LGKGKRIRKQVNY+   QED +W D   D+  +  S+  EE DE++DE S       R+  R      +PPLL +V G +EVLGFN RQRKAF+NA+MRYG+PP D   + W+VR+LR KS++  +AY++LF+RHLCEP +D  + ++D VPREG+SRQHVLTRIG+M+++RKKVQEFE +NG++S
Sbjct:  332 GYETDHQDYCEVCQQGGEIILCDTCPRAYHMVCLDPDMDKAPEGKWSCPHCEKEGVQWEAKE-------DNSEIDDDMDDTVGDPEEE-DHHMEFCRVCKDGGELLCCDACPSSYHIHCLNPPLPEIPNGEWLCPRCTCPALKGKIQKILTWKWGQPPPPTPVPRPADADPEAPP-PKPLEGR---PEREFFVKWQAMSYLHCSWVTELQLELHCQVMFRNYQRKNDMDEPPAGDYGGDDEEKSRKRKNKDPKYLEMEEKFYRYGIKPEWMMIHRVLNHSVDKKGFVHYLIKWRDLPYDQASWESEESDIQDYDIYR--QAYWNHRELMCGD--EGRPGKKTKKVKLRKVERPPDTPAVDPTVKYDRQPEYLDATGGTLHPYQLEGLNWLRFSWAQGTDTILADEMGLGKTVQTAVFLYSLYKEGHSKGPFLVSAPLSTIINWEREFEMWAPDMYVVTYVGDKDSRAVIRENEFSFEDNAIRGGKKASRMKKEASVKFHVLLTSYELITIDMAVLGSIDWACLVVDEAHRLKNNQSKFFRVLNGYSLQHKLLLTGTPLQNNLEELFHLLNFLTPERFNNLEGFLEEFADIAKEDQIKKLHDMLGPHMLRRLKADVFKNMPSKTELIVRVELSPMQKKYYKFILTRNFEALNARGGGNQVSLLNVVMDLKKCCNHPYLFPVAAMEAPKMPNGMYDGSALIKGAGKLLLLQKMLRKLKDDGHRVLIFSQMTKMLDLLEDFLEHEGYKYERIDGGITGNMRQEAIDRFNAPGAQQFCFLLSTRAGGLGINLATADTVVIYDSDWNPHNDIQAFSRAHRIGQNKKVMIYRFVTRASVEERITQVAKKKMMLTHLVVRPGLGSKTG-SMSKQELDDILKFGTEELFKDEATEENKEGDDISVIHYDDKAIARLLDRNQ---DETEDLVELQGMNEYLSSFKVAQYVVREEEMGDEEEVVR------EIIKQE-ESVDPDYWEKLLRHHYEQQQEDLARNLGKGKRIRKQVNYNDGSQEDRDWQDDQSDNQSDY-SVASEEGDEDFDERSEAARRPNRKGLRNDKDKPLPPLLARVGGNIEVLGFNARQRKAFLNAIMRYGMPPQDAFTTQWLVRDLRGKSEKEFKAYVSLFMRHLCEPGADGAETFADGVPREGLSRQHVLTRIGVMSLIRKKVQEFEHVNGRWS 1483          

HSP 2 Score: 249.21 bits (635), Expect = 1.847e-65
Identity = 127/212 (59.91%), Postives = 165/212 (77.83%), Query Frame = -1
Query:  245 KFMFNIADGGFTELHTIWQNEQRAL-VEGHEQDIWHRKHDYWLLAGVVAHGYGRWQDIHNDVRFAIVNEPFRNEQQKPNYLEIKNRFLARRFKLLEQALTIEEQLRRAAQLNLTYAPNDQVQNLNRRFTELECLATSQQNVYTEAVQGNKTLVPVLHRVLTQLEDLLSDMKQDXXXXXXXXXXXXXXSQRLNLTQTNLIQKLTVQMQQTKPQ 877
            +FMFNIADGGFTELH++WQNE+RA  V     +IWHR+HDYWLL+G++ HGY RWQDI NDVR+AI+NEPF+ E  + N+LEIKN+FLARRFKLLEQAL IEEQLRRAA LN++  P+     LN RF E+ECLA S Q++  E++ GNK    VLH+VL QLE+LLSDMK DV RLPA++AR+ PV+ RL +++ N++ +L  +  + +PQ
Sbjct: 1624 RFMFNIADGGFTELHSLWQNEERAATVTKKTYEIWHRRHDYWLLSGIITHGYARWQDIQNDVRYAILNEPFKGEVNRGNFLEIKNKFLARRFKLLEQALVIEEQLRRAAYLNMSEDPSHPSMALNTRFAEVECLAESHQHLSKESMAGNKPANAVLHKVLKQLEELLSDMKADVTRLPATIARIPPVAVRLQMSERNILSRLASRGGEPQPQ 1835          
BLAST of chromodomain helicase DNA-binding protein 4 vs. Ensembl Xenopus
Match: son (SON DNA binding protein [Source:Xenbase;Acc:XB-GENE-6037418])

HSP 1 Score: 1446.8 bits (3744), Expect = 0.000e+0
Identity = 713/1177 (60.58%), Postives = 891/1177 (75.70%), Query Frame = -1
Query: 1136 GYDTDHQDYCEVCQQGGEIMLCDTCPRAFHLVCLDPELEEAPEGSWSCPHCEKEGVVAASRSTTPATGGDMSQNPQNIRKSAQPNEEEKDEHQEFCNECKDGGDLICCAKCPVSYHPECLYPPLSEIPEGPWLCPRCGCGPLKAKVHKILTWRWMEPPKGKDELDHTHKSTEVEKNPTGGHGRQRAPMREFFVKFRDLSYWNCEWLTELQLDVHHPILLRNYFKKNDMDEPPAPEDGSTYKGRARE-KVADPHNLE--ERFYKWSVRPEWMQIHRIIDHMTHRNNSIWYLIKWRDLAYDECTWEQLDGEYEVIDMKHLVEEYHIMRKLFTGDIYKKKFKNSSXXXXXXXXXXXXXXPTTDLKKRMSKQPDYIEETGGKLHQYQLEGLNWLRFSFGNVVDTILADEMGLGKTIQTITFLYSLYKEGHSKGPFLVAAPLSTVINWEREFEFWAPDFYVVTYVGDKDSRAVVREHEFSYEEGAMRTSKHACRMRQGTRTKFHVLLTSYELISIDQALLGSISWEVLVVDEAHRLKNNQSKFFRILSSYKINYKLLLTGTPLQNNLEELFHLLHFMTPEKFNDMQGFLDEFADISKEEQVKRLHEILGEHLLRRLKADVLTDMPSKGEFIVRVELSPMQAKFYKYILTRNFDALSVKGGGSQISLINIVMDLKKCCNHPYLFPSGSDEAPKLRNGAYEGLALIKASGKLELLYKMLPKLKTGGHRVLIFSQMTRLLDILEDFMDYMGYKFERIDGAVTGQQRQDSIDRFNAPDSVSFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQSNKVMIYRFVTRNTVEERVTQVAKKKMMLTHLVVRPGLGGKGGASMSKKELDEILKFGTEDLFK-----EKDENEDDHKIVYDDGAIDRLIDRSQQGIEEKEDM--MTDYLSSFKVAHYSKREVSVNXXXXXXXXXETRGEIIKQDLDPADPTYWEKLLRHHYEQDQEDLSKSLGKGKRIRKQVNYSATQQEDDNWNDAVGDSDHESGSINKEEDDEEYDE-SRGEIIGTRRSKRERDGTKMPPLLVKVNGQLEVLGFNVRQRKAFINAVMRYGLPPMDFINSHWMVRELRCKSDRVMRAYINLFLRHLCEPESDNTDCYSDQVPREGVSRQHVLTRIGIMAVVRKKVQEFEKINGQYS 4633
            GY+TDHQDYCEVCQQGGEI+LCDTCPRA+H+VCLDP++++APEG WSCPHCEKEGV   ++        D S+   ++  +    EEE D H EFC  CKDGG+L+CC  CP SYH  CL PPL EIP G WLCPRC C  LK K+ KILTW+W +PP             E    P    GR   P REFFVK++ +SY +C W+TELQL++H  ++ RNY +KNDMDEPPA + G   + ++R+ K  DP  LE  E+FY++ ++PEWM IHR+++H   +   + YLIKWRDL YD+ +WE  + + +  D+    + Y   R+L  GD  + +    +   ++   + PP+ P  D   +  +QP+Y++ TGG LH YQLEGLNWLRFS+    DTILADEMGLGKT+QT  FLYSLYKEGHSKGPFLV+APLST+INWEREFE WAPD YVVTYVGDKDSRAV+RE+EFS+E+ A+R  K A RM++    KFHVLLTSYELI+ID A+LGSI W  LVVDEAHRLKNNQSKFFR+L+ Y + +KLLLTGTPLQNNLEELFHLL+F+TPE+FN+++GFL+EFADI+KE+Q+K+LH++LG H+LRRLKADV  +MPSK E IVRVELSPMQ K+YK+ILTRNF+AL+ +GGG+Q+SL+N+VMDLKKCCNHPYLFP  + EAPK+ NG Y+G ALIK +GKL LL KML KLK  GHRVLIFSQMT++LD+LEDF+++ GYK+ERIDG +TG  RQ++IDRFNAP +  F FLLSTRAGGLGINLATADTV+IYDSDWNPHNDIQAFSRAHRIGQ+ KVMIYRFVTR +VEER+TQVAKKKMMLTHLVVRPGLG K G SMSK+ELD+ILKFGTE+LFK     E  E +D   I YDD AI RL+DR+Q   E+  ++  M +YLSSFKVA Y  RE  + +++E         EIIKQ+ +  DP YWEKLLRHHYEQ QEDL+++LGKGKRIRKQVNY+   QED +W D   D+  +  S+  EE DE++DE S       R+  R      +PPLL +V G +EVLGFN RQRKAF+NA+MRYG+PP D   + W+VR+LR KS++  +AY++LF+RHLCEP +D  + ++D VPREG+SRQHVLTRIG+M+++RKKVQEFE +NG++S
Sbjct:  332 GYETDHQDYCEVCQQGGEIILCDTCPRAYHMVCLDPDMDKAPEGKWSCPHCEKEGVQWEAKE-------DNSEIDDDMDDTVGDPEEE-DHHMEFCRVCKDGGELLCCDACPSSYHIHCLNPPLPEIPNGEWLCPRCTCPALKGKIQKILTWKWGQPPPPTPVPRPADADPEAPP-PKPLEGR---PEREFFVKWQAMSYLHCSWVTELQLELHCQVMFRNYQRKNDMDEPPAGDYGGDDEEKSRKRKNKDPKYLEMEEKFYRYGIKPEWMMIHRVLNHSVDKKGFVHYLIKWRDLPYDQASWESEESDIQDYDIYR--QAYWNHRELMCGD--EGRPGKKTKKVKLRKVERPPDTPAVDPTVKYDRQPEYLDATGGTLHPYQLEGLNWLRFSWAQGTDTILADEMGLGKTVQTAVFLYSLYKEGHSKGPFLVSAPLSTIINWEREFEMWAPDMYVVTYVGDKDSRAVIRENEFSFEDNAIRGGKKASRMKKEASVKFHVLLTSYELITIDMAVLGSIDWACLVVDEAHRLKNNQSKFFRVLNGYSLQHKLLLTGTPLQNNLEELFHLLNFLTPERFNNLEGFLEEFADIAKEDQIKKLHDMLGPHMLRRLKADVFKNMPSKTELIVRVELSPMQKKYYKFILTRNFEALNARGGGNQVSLLNVVMDLKKCCNHPYLFPVAAMEAPKMPNGMYDGSALIKGAGKLLLLQKMLRKLKDDGHRVLIFSQMTKMLDLLEDFLEHEGYKYERIDGGITGNMRQEAIDRFNAPGAQQFCFLLSTRAGGLGINLATADTVVIYDSDWNPHNDIQAFSRAHRIGQNKKVMIYRFVTRASVEERITQVAKKKMMLTHLVVRPGLGSKTG-SMSKQELDDILKFGTEELFKDEATEENKEGDDISVIHYDDKAIARLLDRNQDETEDLVELQGMNEYLSSFKVAQYVVREEEMGDEEEVVR------EIIKQE-ESVDPDYWEKLLRHHYEQQQEDLARNLGKGKRIRKQVNYNDGSQEDRDWQDDQSDNQSDY-SVASEEGDEDFDERSEAARRPNRKGLRNDKDKPLPPLLARVGGNIEVLGFNARQRKAFLNAIMRYGMPPQDAFTTQWLVRDLRGKSEKEFKAYVSLFMRHLCEPGADGAETFADGVPREGLSRQHVLTRIGVMSLIRKKVQEFEHVNGRWS 1483          

HSP 2 Score: 249.21 bits (635), Expect = 1.733e-65
Identity = 127/212 (59.91%), Postives = 165/212 (77.83%), Query Frame = -1
Query:  245 KFMFNIADGGFTELHTIWQNEQRAL-VEGHEQDIWHRKHDYWLLAGVVAHGYGRWQDIHNDVRFAIVNEPFRNEQQKPNYLEIKNRFLARRFKLLEQALTIEEQLRRAAQLNLTYAPNDQVQNLNRRFTELECLATSQQNVYTEAVQGNKTLVPVLHRVLTQLEDLLSDMKQDXXXXXXXXXXXXXXSQRLNLTQTNLIQKLTVQMQQTKPQ 877
            +FMFNIADGGFTELH++WQNE+RA  V     +IWHR+HDYWLL+G++ HGY RWQDI NDVR+AI+NEPF+ E  + N+LEIKN+FLARRFKLLEQAL IEEQLRRAA LN++  P+     LN RF E+ECLA S Q++  E++ GNK    VLH+VL QLE+LLSDMK DV RLPA++AR+ PV+ RL +++ N++ +L  +  + +PQ
Sbjct: 1557 RFMFNIADGGFTELHSLWQNEERAATVTKKTYEIWHRRHDYWLLSGIITHGYARWQDIQNDVRYAILNEPFKGEVNRGNFLEIKNKFLARRFKLLEQALVIEEQLRRAAYLNMSEDPSHPSMALNTRFAEVECLAESHQHLSKESMAGNKPANAVLHKVLKQLEELLSDMKADVTRLPATIARIPPVAVRLQMSERNILSRLASRGGEPQPQ 1768          
BLAST of chromodomain helicase DNA-binding protein 4 vs. Ensembl Mouse
Match: Chd5 (chromodomain helicase DNA binding protein 5 [Source:MGI Symbol;Acc:MGI:3036258])

HSP 1 Score: 1452.57 bits (3759), Expect = 0.000e+0
Identity = 724/1182 (61.25%), Postives = 891/1182 (75.38%), Query Frame = -1
Query: 1136 GYDTDHQDYCEVCQQGGEIMLCDTCPRAFHLVCLDPELEEAPEGSWSCPHCEKEGVVAASRSTTPATGGDMSQNPQNIRKSAQPNEEEKDEHQEFCNECKDGGDLICCAKCPVSYHPECLYPPLSEIPEGPWLCPRCGCGPLKAKVHKILTWRWMEPPKGKDELDHTHKSTEVEKNPTGGHGRQRAPMREFFVKFRDLSYWNCEWLTELQLDVHHPILLRNYFKKNDMDEPP------APEDGSTYKGRAREKVADPHNLEERFYKWSVRPEWMQIHRIIDHMTHRNNSIWYLIKWRDLAYDECTWEQLDGEYEVIDMKHLVEEYHIMRKLFTGDIYKKKFKNSSXXXXXXXXXXXXXXPT--TDLKKRMSKQPDYIEETGGKLHQYQLEGLNWLRFSFGNVVDTILADEMGLGKTIQTITFLYSLYKEGHSKGPFLVAAPLSTVINWEREFEFWAPDFYVVTYVGDKDSRAVVREHEFSYEEGAMRTSKHACRMRQGTRTKFHVLLTSYELISIDQALLGSISWEVLVVDEAHRLKNNQSKFFRILSSYKINYKLLLTGTPLQNNLEELFHLLHFMTPEKFNDMQGFLDEFADISKEEQVKRLHEILGEHLLRRLKADVLTDMPSKGEFIVRVELSPMQAKFYKYILTRNFDALSVKGGGSQISLINIVMDLKKCCNHPYLFPSGSDEAPKLRNGAYEGLALIKASGKLELLYKMLPKLKTGGHRVLIFSQMTRLLDILEDFMDYMGYKFERIDGAVTGQQRQDSIDRFNAPDSVSFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQSNKVMIYRFVTRNTVEERVTQVAKKKMMLTHLVVRPGLGGKGGASMSKKELDEILKFGTEDLFKEKDEN-----EDDHKIVYDDGAIDRLIDRSQQGIEEKE-DMMTDYLSSFKVAHYSKREVSVNXXXXXXXXXETRGEIIKQDLDPADPTYWEKLLRHHYEQDQEDLSKSLGKGKRIRKQVNYSATQQEDDNWNDAVGD--SDHESGSINKEEDDEEYDESRGEIIGTRRSKRERDGTKMPPLLVKVNGQLEVLGFNVRQRKAFINAVMRYGLPPMDFINSHWMVRELRCKSDRVMRAYINLFLRHLCEPESDNTDCYSDQVPREGVSRQHVLTRIGIMAVVRKKVQEFEKINGQYS 4633
            GY+TDHQDYCEVCQQGGEI+LCDTCPRA+HLVCLDPELE+APEG WSCPHCEKEG+    +                  +     EEE+D+H EFC  CKDGG+L+CC  CP SYH  CL PPL EIP G WLCPRC C PLK KV +IL WRW EPP             EVE         +  P REFFVK+  LSYW+C W+ ELQL+++H ++ RNY +KNDMDEPP        EDG + K + ++ +     +EERFY++ ++PEWM +HRI++H   +   I YLIKW+DL YD+CTWE +D E ++    +L + Y   R+L  G+  +   +     K++   K      T   D   +  KQP YI+ TGG LH YQLEGLNWLRFS+    DTILADEMGLGKT+QTI FLYSLYKEGHSKGP+LV+APLST+INWEREFE WAPDFYVVTY GDK+SR+V+RE+EFS+E+ A+R  K   RM++  + KFHVLLTSYELI+IDQA+LGSI W  LVVDEAHRLKNNQSKFFR+L+SYKI+YKLLLTGTPLQNNLEELFHLL+F+TPE+FN+++GFL+EFADISKE+Q+K+LH++LG H+LRRLKADV  +MP+K E IVRVELS MQ K+YK+ILTRNF+AL+ KGGG+Q+SL+NI+MDLKKCCNHPYLFP  + EAP L NG+Y+G +L+K+SGKL LL KML KL+  GHRVLIFSQMT++LD+LEDF++Y GYK+ERIDG +TG  RQ++IDRFNAP +  F FLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQ+ KVMIYRFVTR +VEER+TQVAK+KMMLTHLVVRPGLG K G SM+K+ELD+ILKFGTE+LFK+  E      ED   I YDD AI +L+DR+Q   ++ E   M +YLSSFKVA Y  RE        +D  EE   E+IKQ+ +  DP YWEKLLRHHYEQ QEDL+++LGKGKRIRKQVNY+   QED  W D + D  S++  GS +++ED EE  E +     +RR  +      +PPLL +V G +EVLGFN RQRKAF+NA+MR+G+PP D  NSHW+VR+LR KS++  RAY++LF+RHLCEP +D  + ++D VPREG+SRQHVLTRIG+M++VRKKVQEFE +NG+YS
Sbjct:  339 GYETDHQDYCEVCQQGGEIILCDTCPRAYHLVCLDPELEKAPEGKWSCPHCEKEGIQWEPKDDD-------------EEEEEGGCEEEEDDHMEFCRVCKDGGELLCCDACPSSYHLHCLNPPLPEIPNGEWLCPRCTCPPLKGKVQRILHWRWTEPPA---PFVVGLPGPEVEPGMPPPRPLEGIPEREFFVKWAGLSYWHCSWVKELQLELYHTVMYRNYQRKNDMDEPPPFDYGSGDEDGKSEKRKNKDPLY--AKMEERFYRYGIKPEWMMVHRILNHSFDKKGDIHYLIKWKDLPYDQCTWE-ID-EIDIPYYDNLKQAYWGHRELMLGEDARLPKRLVKKGKKLKDDKQEKPPDTPIVDPTVKFDKQPWYIDATGGTLHPYQLEGLNWLRFSWAQGTDTILADEMGLGKTVQTIVFLYSLYKEGHSKGPYLVSAPLSTIINWEREFEMWAPDFYVVTYTGDKESRSVIRENEFSFEDNAIRGGKKVFRMKKEVQIKFHVLLTSYELITIDQAILGSIEWACLVVDEAHRLKNNQSKFFRVLNSYKIDYKLLLTGTPLQNNLEELFHLLNFLTPERFNNLEGFLEEFADISKEDQIKKLHDLLGPHMLRRLKADVFKNMPAKTELIVRVELSQMQKKYYKFILTRNFEALNSKGGGNQVSLLNIMMDLKKCCNHPYLFPVAAVEAPVLPNGSYDGSSLVKSSGKLMLLQKMLKKLRDEGHRVLIFSQMTKMLDLLEDFLEYEGYKYERIDGGITGGLRQEAIDRFNAPGAQQFCFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQNKKVMIYRFVTRASVEERITQVAKRKMMLTHLVVRPGLGSKSG-SMTKQELDDILKFGTEELFKDDVEGDNKDVEDSSVIHYDDAAISKLLDRNQDATDDTELQNMNEYLSSFKVAQYVVRE--------EDGVEEVEREVIKQE-ENVDPDYWEKLLRHHYEQQQEDLARNLGKGKRIRKQVNYNDASQEDQEWQDELSDNQSEYSIGSEDEDEDFEERPEGQSGRRQSRRQLKSDRDKPLPPLLARVGGNIEVLGFNARQRKAFLNAIMRWGMPPQDAFNSHWLVRDLRGKSEKEFRAYVSLFMRHLCEPGADGAETFADGVPREGLSRQHVLTRIGVMSLVRKKVQEFEHVNGKYS 1490          

HSP 2 Score: 251.136 bits (640), Expect = 3.545e-66
Identity = 129/203 (63.55%), Postives = 159/203 (78.33%), Query Frame = -1
Query:  272 KFMFNIADGGFTELHTIWQNEQRALVE-GHEQDIWHRKHDYWLLAGVVAHGYGRWQDIHNDVRFAIVNEPFRNEQQKPNYLEIKNRFLARRFKLLEQALTIEEQLRRAAQLNLTYAPNDQVQNLNRRFTELECLATSQQNVYTEAVQGNKTLVPVLHRVLTQLEDLLSDMKQDXXXXXXXXXXXXXXSQRLNLTQTNLIQKLT 877
            KFMFNIADGGFTELHT+WQNE+RA V  G   +IWHR+HDYWLLAG+V HGY RWQDI ND R+ I+NEPF++E  K NYLE+KN+FLARRFKLLEQAL IEEQLRRAA LN+T  PN     LN R  E+ECLA S Q++  E++ GNK    VLH+VL QLE+LLSDMK DV RLP+ L+R+ PV+ RL +++ +++ +LT
Sbjct: 1663 KFMFNIADGGFTELHTLWQNEERAAVSSGKIYEIWHRRHDYWLLAGIVTHGYARWQDIQNDPRYMILNEPFKSEIHKGNYLEMKNKFLARRFKLLEQALVIEEQLRRAAYLNMTQDPNHPAMALNARLAEVECLAESHQHLSKESLAGNKPANAVLHKVLNQLEELLSDMKADVTRLPSMLSRIPPVAARLQMSERSILSRLT 1865          
BLAST of chromodomain helicase DNA-binding protein 4 vs. Ensembl Mouse
Match: Chd4 (chromodomain helicase DNA binding protein 4 [Source:MGI Symbol;Acc:MGI:1344380])

HSP 1 Score: 1442.56 bits (3733), Expect = 0.000e+0
Identity = 710/1180 (60.17%), Postives = 891/1180 (75.51%), Query Frame = -1
Query: 1136 MSGYDTDHQDYCEVCQQGGEIMLCDTCPRAFHLVCLDPELEEAPEGSWSCPHCEKEGVVAASRSTTPATGGDMSQNPQNIRKSAQPNEEEKDEHQEFCNECKDGGDLICCAKCPVSYHPECLYPPLSEIPEGPWLCPRCGCGPLKAKVHKILTWRWMEPPKGKDELDHTHKSTEVEKNPTGGHGRQRAPMREFFVKFRDLSYWNCEWLTELQLDVHHPILLRNYFKKNDMDEPPAPEDGSTYKGRAREKVADPH--NLEERFYKWSVRPEWMQIHRIIDHMTHRNNSIWYLIKWRDLAYDECTWEQLDGEYEVIDMKHLVEEYHIMRKLFTGDIYKKKFKNSSXXXXXXXXXXXXXXPTTDLKKRMSKQPDYIEETGGKLHQYQLEGLNWLRFSFGNVVDTILADEMGLGKTIQTITFLYSLYKEGHSKGPFLVAAPLSTVINWEREFEFWAPDFYVVTYVGDKDSRAVVREHEFSYEEGAMRTSKHACRMRQGTRTKFHVLLTSYELISIDQALLGSISWEVLVVDEAHRLKNNQSKFFRILSSYKINYKLLLTGTPLQNNLEELFHLLHFMTPEKFNDMQGFLDEFADISKEEQVKRLHEILGEHLLRRLKADVLTDMPSKGEFIVRVELSPMQAKFYKYILTRNFDALSVKGGGSQISLINIVMDLKKCCNHPYLFPSGSDEAPKLRNGAYEGLALIKASGKLELLYKMLPKLKTGGHRVLIFSQMTRLLDILEDFMDYMGYKFERIDGAVTGQQRQDSIDRFNAPDSVSFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQSNKVMIYRFVTRNTVEERVTQVAKKKMMLTHLVVRPGLGGKGGASMSKKELDEILKFGTEDLFKEK--------DENEDDHKIVYDDGAIDRLIDRSQQGIEEKE-DMMTDYLSSFKVAHYSKREVSVNXXXXXXXXXETRGEIIKQDLDPADPTYWEKLLRHHYEQDQEDLSKSLGKGKRIRKQVNYSATQQEDDNWNDAVGDSDHESGSINKEEDDEEYDE-SRGEIIGTRRSKRERDGTKMPPLLVKVNGQLEVLGFNVRQRKAFINAVMRYGLPPMDFINSHWMVRELRCKSDRVMRAYINLFLRHLCEPESDNTDCYSDQVPREGVSRQHVLTRIGIMAVVRKKVQEFEKINGQYS 4639
            + GY+TDHQDYCEVCQQGGEI+LCDTCPRA+H+VCLDP++E+APEG WSCPHCEKEG+   ++        D S+  + + +     EEE D H EFC  CKDGG+L+CC  CP SYH  CL PPL EIP G WLCPRC C  LK KV KIL W+W +            +  + + N       +  P R+FFVK++ +SYW+C W++ELQL++H  ++ RNY +KNDMDEPP+ + G   +   + K  DP    +EERFY++ ++PEWM IHRI++H   +   + YLIKWRDL YD+ +WE  D E +  D+    + Y   R+L  G+  + +        ++   + PPE PT D   +  +QP+Y++ TGG LH YQ+EGLNWLRFS+    DTILADEMGLGKT+QT  FLYSLYKEGHSKGPFLV+APLST+INWEREFE WAPD YVVTYVGDKDSRA++RE+EFS+E+ A+R  K A RM++    KFHVLLTSYELI+ID A+LGSI W  L+VDEAHRLKNNQSKFFR+L+ Y + +KLLLTGTPLQNNLEELFHLL+F+TPE+F++++GFL+EFADI+KE+Q+K+LH++LG H+LRRLKADV  +MPSK E IVRVELSPMQ K+YKYILTRNF+AL+ +GGG+Q+SL+N+VMDLKKCCNHPYLFP  + EAPK+ NG Y+G ALI+ASGKL LL KML  LK GGHRVLIFSQMT++LD+LEDF+++ GYK+ERIDG +TG  RQ++IDRFNAP +  F FLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQ+ KVMIYRFVTR +VEER+TQVAKKKMMLTHLVVRPGLG K G SMSK+ELD+ILKFGTE+LFK++         E ED   I YDD AI+RL+DR+Q   E+ E   M +YLSSFKVA Y  RE  +       ++EE   EIIKQ+ +  DP YWEKLLRHHYEQ QEDL+++LGKGKRIRKQVNY+   QED +W D   D+  +  S+  EE DE++DE S      +R+  R      +PPLL +V G +EVLGFN RQRKAF+NA+MRYG+PP D   + W+VR+LR KS++  +AY++LF+RHLCEP +D  + ++D VPREG+SRQHVLTRIG+M+++RKKVQEFE +NG++S
Sbjct:  355 VDGYETDHQDYCEVCQQGGEIILCDTCPRAYHMVCLDPDMEKAPEGKWSCPHCEKEGIQWEAKE-------DNSEGEEILEEVGGDPEEEDDHHMEFCRVCKDGGELLCCDTCPSSYHIHCLNPPLPEIPNGEWLCPRCTCPALKGKVQKILIWKWGQ----PPSPTPVPRPPDADPNTPSPKPLEGRPERQFFVKWQGMSYWHCSWVSELQLELHCQVMFRNYQRKNDMDEPPSGDFGGDEEKSRKRKNKDPKFAEMEERFYRYGIKPEWMMIHRILNHSVDKKGHVHYLIKWRDLPYDQASWESEDVEIQDYDL--FKQSYWNHRELMRGE--EGRPGKKLKKVKLRKLERPPETPTVDPTVKYERQPEYLDATGGTLHPYQMEGLNWLRFSWAQGTDTILADEMGLGKTVQTAVFLYSLYKEGHSKGPFLVSAPLSTIINWEREFEMWAPDMYVVTYVGDKDSRAIIRENEFSFEDNAIRGGKKASRMKKEASVKFHVLLTSYELITIDMAILGSIDWACLIVDEAHRLKNNQSKFFRVLNGYSLQHKLLLTGTPLQNNLEELFHLLNFLTPERFHNLEGFLEEFADIAKEDQIKKLHDMLGPHMLRRLKADVFKNMPSKTELIVRVELSPMQKKYYKYILTRNFEALNARGGGNQVSLLNVVMDLKKCCNHPYLFPVAAMEAPKMPNGMYDGSALIRASGKLLLLQKMLKNLKEGGHRVLIFSQMTKMLDLLEDFLEHEGYKYERIDGGITGNMRQEAIDRFNAPGAQQFCFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQNKKVMIYRFVTRASVEERITQVAKKKMMLTHLVVRPGLGSKTG-SMSKQELDDILKFGTEELFKDEATDGGGDNKEGEDSSVIHYDDKAIERLLDRNQDETEDTELQGMNEYLSSFKVAQYVVREEEMG------EEEEVEREIIKQE-ESVDPDYWEKLLRHHYEQQQEDLARNLGKGKRIRKQVNYNDGSQEDRDWQDDQSDNQSDY-SVASEEGDEDFDERSEAPRRPSRKGLRNDKDKPLPPLLARVGGNIEVLGFNARQRKAFLNAIMRYGMPPQDAFTTQWLVRDLRGKSEKEFKAYVSLFMRHLCEPGADGAETFADGVPREGLSRQHVLTRIGVMSLIRKKVQEFEHVNGRWS 1510          

HSP 2 Score: 244.973 bits (624), Expect = 2.594e-64
Identity = 125/203 (61.58%), Postives = 159/203 (78.33%), Query Frame = -1
Query:  272 KFMFNIADGGFTELHTIWQNEQRAL-VEGHEQDIWHRKHDYWLLAGVVAHGYGRWQDIHNDVRFAIVNEPFRNEQQKPNYLEIKNRFLARRFKLLEQALTIEEQLRRAAQLNLTYAPNDQVQNLNRRFTELECLATSQQNVYTEAVQGNKTLVPVLHRVLTQLEDLLSDMKQDXXXXXXXXXXXXXXSQRLNLTQTNLIQKLT 877
            +FMFNIADGGFTELH++WQNE+RA  V     +IWHR+HDYWLLAG++ HGY RWQDI ND R+AI+NEPF+ E  + N+LEIKN+FLARRFKLLEQAL IEEQLRRAA LN++  P+     LN RF E+ECLA S Q++  E++ GNK    VLH+VL QLE+LLSDMK DV RLPA++AR+ PV+ RL +++ N++ +L 
Sbjct: 1698 RFMFNIADGGFTELHSLWQNEERAATVTKKTYEIWHRRHDYWLLAGIINHGYARWQDIQNDPRYAILNEPFKGEMNRGNFLEIKNKFLARRFKLLEQALVIEEQLRRAAYLNMSEDPSHPSMALNTRFAEVECLAESHQHLSKESMAGNKPANAVLHKVLKQLEELLSDMKADVTRLPATIARIPPVAVRLQMSERNILSRLA 1900          
BLAST of chromodomain helicase DNA-binding protein 4 vs. Ensembl Mouse
Match: Chd4 (chromodomain helicase DNA binding protein 4 [Source:MGI Symbol;Acc:MGI:1344380])

HSP 1 Score: 1442.17 bits (3732), Expect = 0.000e+0
Identity = 710/1180 (60.17%), Postives = 891/1180 (75.51%), Query Frame = -1
Query: 1136 MSGYDTDHQDYCEVCQQGGEIMLCDTCPRAFHLVCLDPELEEAPEGSWSCPHCEKEGVVAASRSTTPATGGDMSQNPQNIRKSAQPNEEEKDEHQEFCNECKDGGDLICCAKCPVSYHPECLYPPLSEIPEGPWLCPRCGCGPLKAKVHKILTWRWMEPPKGKDELDHTHKSTEVEKNPTGGHGRQRAPMREFFVKFRDLSYWNCEWLTELQLDVHHPILLRNYFKKNDMDEPPAPEDGSTYKGRAREKVADPH--NLEERFYKWSVRPEWMQIHRIIDHMTHRNNSIWYLIKWRDLAYDECTWEQLDGEYEVIDMKHLVEEYHIMRKLFTGDIYKKKFKNSSXXXXXXXXXXXXXXPTTDLKKRMSKQPDYIEETGGKLHQYQLEGLNWLRFSFGNVVDTILADEMGLGKTIQTITFLYSLYKEGHSKGPFLVAAPLSTVINWEREFEFWAPDFYVVTYVGDKDSRAVVREHEFSYEEGAMRTSKHACRMRQGTRTKFHVLLTSYELISIDQALLGSISWEVLVVDEAHRLKNNQSKFFRILSSYKINYKLLLTGTPLQNNLEELFHLLHFMTPEKFNDMQGFLDEFADISKEEQVKRLHEILGEHLLRRLKADVLTDMPSKGEFIVRVELSPMQAKFYKYILTRNFDALSVKGGGSQISLINIVMDLKKCCNHPYLFPSGSDEAPKLRNGAYEGLALIKASGKLELLYKMLPKLKTGGHRVLIFSQMTRLLDILEDFMDYMGYKFERIDGAVTGQQRQDSIDRFNAPDSVSFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQSNKVMIYRFVTRNTVEERVTQVAKKKMMLTHLVVRPGLGGKGGASMSKKELDEILKFGTEDLFKEK--------DENEDDHKIVYDDGAIDRLIDRSQQGIEEKE-DMMTDYLSSFKVAHYSKREVSVNXXXXXXXXXETRGEIIKQDLDPADPTYWEKLLRHHYEQDQEDLSKSLGKGKRIRKQVNYSATQQEDDNWNDAVGDSDHESGSINKEEDDEEYDE-SRGEIIGTRRSKRERDGTKMPPLLVKVNGQLEVLGFNVRQRKAFINAVMRYGLPPMDFINSHWMVRELRCKSDRVMRAYINLFLRHLCEPESDNTDCYSDQVPREGVSRQHVLTRIGIMAVVRKKVQEFEKINGQYS 4639
            + GY+TDHQDYCEVCQQGGEI+LCDTCPRA+H+VCLDP++E+APEG WSCPHCEKEG+   ++        D S+  + + +     EEE D H EFC  CKDGG+L+CC  CP SYH  CL PPL EIP G WLCPRC C  LK KV KIL W+W +            +  + + N       +  P R+FFVK++ +SYW+C W++ELQL++H  ++ RNY +KNDMDEPP+ + G   +   + K  DP    +EERFY++ ++PEWM IHRI++H   +   + YLIKWRDL YD+ +WE  D E +  D+    + Y   R+L  G+  + +        ++   + PPE PT D   +  +QP+Y++ TGG LH YQ+EGLNWLRFS+    DTILADEMGLGKT+QT  FLYSLYKEGHSKGPFLV+APLST+INWEREFE WAPD YVVTYVGDKDSRA++RE+EFS+E+ A+R  K A RM++    KFHVLLTSYELI+ID A+LGSI W  L+VDEAHRLKNNQSKFFR+L+ Y + +KLLLTGTPLQNNLEELFHLL+F+TPE+F++++GFL+EFADI+KE+Q+K+LH++LG H+LRRLKADV  +MPSK E IVRVELSPMQ K+YKYILTRNF+AL+ +GGG+Q+SL+N+VMDLKKCCNHPYLFP  + EAPK+ NG Y+G ALI+ASGKL LL KML  LK GGHRVLIFSQMT++LD+LEDF+++ GYK+ERIDG +TG  RQ++IDRFNAP +  F FLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQ+ KVMIYRFVTR +VEER+TQVAKKKMMLTHLVVRPGLG K G SMSK+ELD+ILKFGTE+LFK++         E ED   I YDD AI+RL+DR+Q   E+ E   M +YLSSFKVA Y  RE  +       ++EE   EIIKQ+ +  DP YWEKLLRHHYEQ QEDL+++LGKGKRIRKQVNY+   QED +W D   D+  +  S+  EE DE++DE S      +R+  R      +PPLL +V G +EVLGFN RQRKAF+NA+MRYG+PP D   + W+VR+LR KS++  +AY++LF+RHLCEP +D  + ++D VPREG+SRQHVLTRIG+M+++RKKVQEFE +NG++S
Sbjct:  362 VDGYETDHQDYCEVCQQGGEIILCDTCPRAYHMVCLDPDMEKAPEGKWSCPHCEKEGIQWEAKE-------DNSEGEEILEEVGGDPEEEDDHHMEFCRVCKDGGELLCCDTCPSSYHIHCLNPPLPEIPNGEWLCPRCTCPALKGKVQKILIWKWGQ----PPSPTPVPRPPDADPNTPSPKPLEGRPERQFFVKWQGMSYWHCSWVSELQLELHCQVMFRNYQRKNDMDEPPSGDFGGDEEKSRKRKNKDPKFAEMEERFYRYGIKPEWMMIHRILNHSVDKKGHVHYLIKWRDLPYDQASWESEDVEIQDYDL--FKQSYWNHRELMRGE--EGRPGKKLKKVKLRKLERPPETPTVDPTVKYERQPEYLDATGGTLHPYQMEGLNWLRFSWAQGTDTILADEMGLGKTVQTAVFLYSLYKEGHSKGPFLVSAPLSTIINWEREFEMWAPDMYVVTYVGDKDSRAIIRENEFSFEDNAIRGGKKASRMKKEASVKFHVLLTSYELITIDMAILGSIDWACLIVDEAHRLKNNQSKFFRVLNGYSLQHKLLLTGTPLQNNLEELFHLLNFLTPERFHNLEGFLEEFADIAKEDQIKKLHDMLGPHMLRRLKADVFKNMPSKTELIVRVELSPMQKKYYKYILTRNFEALNARGGGNQVSLLNVVMDLKKCCNHPYLFPVAAMEAPKMPNGMYDGSALIRASGKLLLLQKMLKNLKEGGHRVLIFSQMTKMLDLLEDFLEHEGYKYERIDGGITGNMRQEAIDRFNAPGAQQFCFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQNKKVMIYRFVTRASVEERITQVAKKKMMLTHLVVRPGLGSKTG-SMSKQELDDILKFGTEELFKDEATDGGGDNKEGEDSSVIHYDDKAIERLLDRNQDETEDTELQGMNEYLSSFKVAQYVVREEEMG------EEEEVEREIIKQE-ESVDPDYWEKLLRHHYEQQQEDLARNLGKGKRIRKQVNYNDGSQEDRDWQDDQSDNQSDY-SVASEEGDEDFDERSEAPRRPSRKGLRNDKDKPLPPLLARVGGNIEVLGFNARQRKAFLNAIMRYGMPPQDAFTTQWLVRDLRGKSEKEFKAYVSLFMRHLCEPGADGAETFADGVPREGLSRQHVLTRIGVMSLIRKKVQEFEHVNGRWS 1517          

HSP 2 Score: 244.973 bits (624), Expect = 2.630e-64
Identity = 125/203 (61.58%), Postives = 159/203 (78.33%), Query Frame = -1
Query:  272 KFMFNIADGGFTELHTIWQNEQRAL-VEGHEQDIWHRKHDYWLLAGVVAHGYGRWQDIHNDVRFAIVNEPFRNEQQKPNYLEIKNRFLARRFKLLEQALTIEEQLRRAAQLNLTYAPNDQVQNLNRRFTELECLATSQQNVYTEAVQGNKTLVPVLHRVLTQLEDLLSDMKQDXXXXXXXXXXXXXXSQRLNLTQTNLIQKLT 877
            +FMFNIADGGFTELH++WQNE+RA  V     +IWHR+HDYWLLAG++ HGY RWQDI ND R+AI+NEPF+ E  + N+LEIKN+FLARRFKLLEQAL IEEQLRRAA LN++  P+     LN RF E+ECLA S Q++  E++ GNK    VLH+VL QLE+LLSDMK DV RLPA++AR+ PV+ RL +++ N++ +L 
Sbjct: 1705 RFMFNIADGGFTELHSLWQNEERAATVTKKTYEIWHRRHDYWLLAGIINHGYARWQDIQNDPRYAILNEPFKGEMNRGNFLEIKNKFLARRFKLLEQALVIEEQLRRAAYLNMSEDPSHPSMALNTRFAEVECLAESHQHLSKESMAGNKPANAVLHKVLKQLEELLSDMKADVTRLPATIARIPPVAVRLQMSERNILSRLA 1907          
BLAST of chromodomain helicase DNA-binding protein 4 vs. Ensembl Mouse
Match: Chd5 (chromodomain helicase DNA binding protein 5 [Source:MGI Symbol;Acc:MGI:3036258])

HSP 1 Score: 1439.86 bits (3726), Expect = 0.000e+0
Identity = 724/1219 (59.39%), Postives = 891/1219 (73.09%), Query Frame = -1
Query: 1136 GYDTDHQDYCEVCQQGGEIMLCDTCPRAFHLVCLDPELEEAPEGSWSCPHCEKEGVVAASRSTTPATGGDMSQNPQNIRKSAQPNEEEKDEHQEFCNECKDGGDLICCAKCPVSYHPECLYPPLSEIPEGPWLCPRCGCGPLKAKVHKILTWRWMEPPKGKDELDHTHKSTEVEKNPTGGHGRQRAPMREFFVKFRDLSYWNCEWLTELQLDVHHPILLRNYFKKNDMDEPP------APEDGSTYKGRAREKVADPHNLEERFYKWSVRPEWMQIHRIIDHMTHRNNSIWYLIKWRDLAYDECTWEQLDGEYEVIDMKHLVEEYHIMRKLFTGDIYKKKFKNSSXXXXXXXXXXXXXXPT--TDLKKRMSKQPDYIEETGGKLHQYQLEGLNWLRFSFGNVVDTILADEMGLGKTIQTITFLYSLYKEGHSKGPFLVAAPLSTVINWEREFEFWAPDFYVVTYVGDKDSRAVVREHEFSYEEGAMRTSKHACRMRQGTRTKFHVLLTSYELISIDQALLGSISWEVLVVDEAHRLKNNQSKFFRILSSYKINYKLLLTGTPLQNNLEELFHLLHFMTPEKFNDMQGFLDEFADISKEEQVKRLHEILGEHLLRRLKADVLTDMPSKGEFIVRVELSPMQAKFYKYILTRNFDALSVKGGGSQISLINIVMDLKKCCNHPYLFPSGSDEAPKLRNGAYEGLALIKASGKLELLYKMLPKLKTGGHRVLIFSQMTRLLDILEDFMDYMGYKFERIDGAVTGQQRQDSIDRFNAPDSVSFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQSNKVMIYRFVTRNTVEERVTQVAKKKMMLTHLVVRPGLGGKGGASMSKKELDEILKFGTEDLFKEKDEN------------------------------------------EDDHKIVYDDGAIDRLIDRSQQGIEEKE-DMMTDYLSSFKVAHYSKREVSVNXXXXXXXXXETRGEIIKQDLDPADPTYWEKLLRHHYEQDQEDLSKSLGKGKRIRKQVNYSATQQEDDNWNDAVGD--SDHESGSINKEEDDEEYDESRGEIIGTRRSKRERDGTKMPPLLVKVNGQLEVLGFNVRQRKAFINAVMRYGLPPMDFINSHWMVRELRCKSDRVMRAYINLFLRHLCEPESDNTDCYSDQVPREGVSRQHVLTRIGIMAVVRKKVQEFEKINGQYS 4633
            GY+TDHQDYCEVCQQGGEI+LCDTCPRA+HLVCLDPELE+APEG WSCPHCEKEG+    +                  +     EEE+D+H EFC  CKDGG+L+CC  CP SYH  CL PPL EIP G WLCPRC C PLK KV +IL WRW EPP             EVE         +  P REFFVK+  LSYW+C W+ ELQL+++H ++ RNY +KNDMDEPP        EDG + K + ++ +     +EERFY++ ++PEWM +HRI++H   +   I YLIKW+DL YD+CTWE +D E ++    +L + Y   R+L  G+  +   +     K++   K      T   D   +  KQP YI+ TGG LH YQLEGLNWLRFS+    DTILADEMGLGKT+QTI FLYSLYKEGHSKGP+LV+APLST+INWEREFE WAPDFYVVTY GDK+SR+V+RE+EFS+E+ A+R  K   RM++  + KFHVLLTSYELI+IDQA+LGSI W  LVVDEAHRLKNNQSKFFR+L+SYKI+YKLLLTGTPLQNNLEELFHLL+F+TPE+FN+++GFL+EFADISKE+Q+K+LH++LG H+LRRLKADV  +MP+K E IVRVELS MQ K+YK+ILTRNF+AL+ KGGG+Q+SL+NI+MDLKKCCNHPYLFP  + EAP L NG+Y+G +L+K+SGKL LL KML KL+  GHRVLIFSQMT++LD+LEDF++Y GYK+ERIDG +TG  RQ++IDRFNAP +  F FLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQ+ KVMIYRFVTR +VEER+TQVAK+KMMLTHLVVRPGLG K G SM+K+ELD+ILKFGTE+LFK+  E                                           ED   I YDD AI +L+DR+Q   ++ E   M +YLSSFKVA Y  RE        +D  EE   E+IKQ+ +  DP YWEKLLRHHYEQ QEDL+++LGKGKRIRKQVNY+   QED  W D + D  S++  GS +++ED EE  E +     +RR  +      +PPLL +V G +EVLGFN RQRKAF+NA+MR+G+PP D  NSHW+VR+LR KS++  RAY++LF+RHLCEP +D  + ++D VPREG+SRQHVLTRIG+M++VRKKVQEFE +NG+YS
Sbjct:  339 GYETDHQDYCEVCQQGGEIILCDTCPRAYHLVCLDPELEKAPEGKWSCPHCEKEGIQWEPKDDD-------------EEEEEGGCEEEEDDHMEFCRVCKDGGELLCCDACPSSYHLHCLNPPLPEIPNGEWLCPRCTCPPLKGKVQRILHWRWTEPPA---PFVVGLPGPEVEPGMPPPRPLEGIPEREFFVKWAGLSYWHCSWVKELQLELYHTVMYRNYQRKNDMDEPPPFDYGSGDEDGKSEKRKNKDPLY--AKMEERFYRYGIKPEWMMVHRILNHSFDKKGDIHYLIKWKDLPYDQCTWE-ID-EIDIPYYDNLKQAYWGHRELMLGEDARLPKRLVKKGKKLKDDKQEKPPDTPIVDPTVKFDKQPWYIDATGGTLHPYQLEGLNWLRFSWAQGTDTILADEMGLGKTVQTIVFLYSLYKEGHSKGPYLVSAPLSTIINWEREFEMWAPDFYVVTYTGDKESRSVIRENEFSFEDNAIRGGKKVFRMKKEVQIKFHVLLTSYELITIDQAILGSIEWACLVVDEAHRLKNNQSKFFRVLNSYKIDYKLLLTGTPLQNNLEELFHLLNFLTPERFNNLEGFLEEFADISKEDQIKKLHDLLGPHMLRRLKADVFKNMPAKTELIVRVELSQMQKKYYKFILTRNFEALNSKGGGNQVSLLNIMMDLKKCCNHPYLFPVAAVEAPVLPNGSYDGSSLVKSSGKLMLLQKMLKKLRDEGHRVLIFSQMTKMLDLLEDFLEYEGYKYERIDGGITGGLRQEAIDRFNAPGAQQFCFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQNKKVMIYRFVTRASVEERITQVAKRKMMLTHLVVRPGLGSKSG-SMTKQELDDILKFGTEELFKDDVEGMMSQGQRPTTPIPDIQSTKGGSLTAGAKKKHGSTPPGDNKDVEDSSVIHYDDAAISKLLDRNQDATDDTELQNMNEYLSSFKVAQYVVRE--------EDGVEEVEREVIKQEEN-VDPDYWEKLLRHHYEQQQEDLARNLGKGKRIRKQVNYNDASQEDQEWQDELSDNQSEYSIGSEDEDEDFEERPEGQSGRRQSRRQLKSDRDKPLPPLLARVGGNIEVLGFNARQRKAFLNAIMRWGMPPQDAFNSHWLVRDLRGKSEKEFRAYVSLFMRHLCEPGADGAETFADGVPREGLSRQHVLTRIGVMSLVRKKVQEFEHVNGKYS 1527          

HSP 2 Score: 251.906 bits (642), Expect = 2.624e-66
Identity = 129/203 (63.55%), Postives = 159/203 (78.33%), Query Frame = -1
Query:  272 KFMFNIADGGFTELHTIWQNEQRALVE-GHEQDIWHRKHDYWLLAGVVAHGYGRWQDIHNDVRFAIVNEPFRNEQQKPNYLEIKNRFLARRFKLLEQALTIEEQLRRAAQLNLTYAPNDQVQNLNRRFTELECLATSQQNVYTEAVQGNKTLVPVLHRVLTQLEDLLSDMKQDXXXXXXXXXXXXXXSQRLNLTQTNLIQKLT 877
            KFMFNIADGGFTELHT+WQNE+RA V  G   +IWHR+HDYWLLAG+V HGY RWQDI ND R+ I+NEPF++E  K NYLE+KN+FLARRFKLLEQAL IEEQLRRAA LN+T  PN     LN R  E+ECLA S Q++  E++ GNK    VLH+VL QLE+LLSDMK DV RLP+ L+R+ PV+ RL +++ +++ +LT
Sbjct: 1700 KFMFNIADGGFTELHTLWQNEERAAVSSGKIYEIWHRRHDYWLLAGIVTHGYARWQDIQNDPRYMILNEPFKSEIHKGNYLEMKNKFLARRFKLLEQALVIEEQLRRAAYLNMTQDPNHPAMALNARLAEVECLAESHQHLSKESLAGNKPANAVLHKVLNQLEELLSDMKADVTRLPSMLSRIPPVAARLQMSERSILSRLT 1902          

HSP 3 Score: 52.7582 bits (125), Expect = 8.793e-6
Identity = 23/65 (35.38%), Postives = 37/65 (56.92%), Query Frame = -3
Query: 5280 LCEEMGIANVEVSYRMDDFENWTIQRLFDQYMRPKLEEKNPHATSDDIQRVLDAKWKEFALLNPY 5474
            L  E G+ +V+  +  DD+   T  + F Q++RP + +KNP      +  VL AKW+EF+  NP+
Sbjct:  140 LMAEWGLDDVDYLFSEDDYHTLTNYKAFSQFLRPLIAKKNPKIPMSKMMTVLGAKWREFSANNPF 204          
BLAST of chromodomain helicase DNA-binding protein 4 vs. Ensembl Mouse
Match: Chd5 (chromodomain helicase DNA binding protein 5 [Source:MGI Symbol;Acc:MGI:3036258])

HSP 1 Score: 1439.48 bits (3725), Expect = 0.000e+0
Identity = 724/1219 (59.39%), Postives = 891/1219 (73.09%), Query Frame = -1
Query: 1136 GYDTDHQDYCEVCQQGGEIMLCDTCPRAFHLVCLDPELEEAPEGSWSCPHCEKEGVVAASRSTTPATGGDMSQNPQNIRKSAQPNEEEKDEHQEFCNECKDGGDLICCAKCPVSYHPECLYPPLSEIPEGPWLCPRCGCGPLKAKVHKILTWRWMEPPKGKDELDHTHKSTEVEKNPTGGHGRQRAPMREFFVKFRDLSYWNCEWLTELQLDVHHPILLRNYFKKNDMDEPP------APEDGSTYKGRAREKVADPHNLEERFYKWSVRPEWMQIHRIIDHMTHRNNSIWYLIKWRDLAYDECTWEQLDGEYEVIDMKHLVEEYHIMRKLFTGDIYKKKFKNSSXXXXXXXXXXXXXXPT--TDLKKRMSKQPDYIEETGGKLHQYQLEGLNWLRFSFGNVVDTILADEMGLGKTIQTITFLYSLYKEGHSKGPFLVAAPLSTVINWEREFEFWAPDFYVVTYVGDKDSRAVVREHEFSYEEGAMRTSKHACRMRQGTRTKFHVLLTSYELISIDQALLGSISWEVLVVDEAHRLKNNQSKFFRILSSYKINYKLLLTGTPLQNNLEELFHLLHFMTPEKFNDMQGFLDEFADISKEEQVKRLHEILGEHLLRRLKADVLTDMPSKGEFIVRVELSPMQAKFYKYILTRNFDALSVKGGGSQISLINIVMDLKKCCNHPYLFPSGSDEAPKLRNGAYEGLALIKASGKLELLYKMLPKLKTGGHRVLIFSQMTRLLDILEDFMDYMGYKFERIDGAVTGQQRQDSIDRFNAPDSVSFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQSNKVMIYRFVTRNTVEERVTQVAKKKMMLTHLVVRPGLGGKGGASMSKKELDEILKFGTEDLFKEKDEN------------------------------------------EDDHKIVYDDGAIDRLIDRSQQGIEEKE-DMMTDYLSSFKVAHYSKREVSVNXXXXXXXXXETRGEIIKQDLDPADPTYWEKLLRHHYEQDQEDLSKSLGKGKRIRKQVNYSATQQEDDNWNDAVGD--SDHESGSINKEEDDEEYDESRGEIIGTRRSKRERDGTKMPPLLVKVNGQLEVLGFNVRQRKAFINAVMRYGLPPMDFINSHWMVRELRCKSDRVMRAYINLFLRHLCEPESDNTDCYSDQVPREGVSRQHVLTRIGIMAVVRKKVQEFEKINGQYS 4633
            GY+TDHQDYCEVCQQGGEI+LCDTCPRA+HLVCLDPELE+APEG WSCPHCEKEG+    +                  +     EEE+D+H EFC  CKDGG+L+CC  CP SYH  CL PPL EIP G WLCPRC C PLK KV +IL WRW EPP             EVE         +  P REFFVK+  LSYW+C W+ ELQL+++H ++ RNY +KNDMDEPP        EDG + K + ++ +     +EERFY++ ++PEWM +HRI++H   +   I YLIKW+DL YD+CTWE +D E ++    +L + Y   R+L  G+  +   +     K++   K      T   D   +  KQP YI+ TGG LH YQLEGLNWLRFS+    DTILADEMGLGKT+QTI FLYSLYKEGHSKGP+LV+APLST+INWEREFE WAPDFYVVTY GDK+SR+V+RE+EFS+E+ A+R  K   RM++  + KFHVLLTSYELI+IDQA+LGSI W  LVVDEAHRLKNNQSKFFR+L+SYKI+YKLLLTGTPLQNNLEELFHLL+F+TPE+FN+++GFL+EFADISKE+Q+K+LH++LG H+LRRLKADV  +MP+K E IVRVELS MQ K+YK+ILTRNF+AL+ KGGG+Q+SL+NI+MDLKKCCNHPYLFP  + EAP L NG+Y+G +L+K+SGKL LL KML KL+  GHRVLIFSQMT++LD+LEDF++Y GYK+ERIDG +TG  RQ++IDRFNAP +  F FLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQ+ KVMIYRFVTR +VEER+TQVAK+KMMLTHLVVRPGLG K G SM+K+ELD+ILKFGTE+LFK+  E                                           ED   I YDD AI +L+DR+Q   ++ E   M +YLSSFKVA Y  RE        +D  EE   E+IKQ+ +  DP YWEKLLRHHYEQ QEDL+++LGKGKRIRKQVNY+   QED  W D + D  S++  GS +++ED EE  E +     +RR  +      +PPLL +V G +EVLGFN RQRKAF+NA+MR+G+PP D  NSHW+VR+LR KS++  RAY++LF+RHLCEP +D  + ++D VPREG+SRQHVLTRIG+M++VRKKVQEFE +NG+YS
Sbjct:  339 GYETDHQDYCEVCQQGGEIILCDTCPRAYHLVCLDPELEKAPEGKWSCPHCEKEGIQWEPKDDD-------------EEEEEGGCEEEEDDHMEFCRVCKDGGELLCCDACPSSYHLHCLNPPLPEIPNGEWLCPRCTCPPLKGKVQRILHWRWTEPPA---PFVVGLPGPEVEPGMPPPRPLEGIPEREFFVKWAGLSYWHCSWVKELQLELYHTVMYRNYQRKNDMDEPPPFDYGSGDEDGKSEKRKNKDPLY--AKMEERFYRYGIKPEWMMVHRILNHSFDKKGDIHYLIKWKDLPYDQCTWE-ID-EIDIPYYDNLKQAYWGHRELMLGEDARLPKRLVKKGKKLKDDKQEKPPDTPIVDPTVKFDKQPWYIDATGGTLHPYQLEGLNWLRFSWAQGTDTILADEMGLGKTVQTIVFLYSLYKEGHSKGPYLVSAPLSTIINWEREFEMWAPDFYVVTYTGDKESRSVIRENEFSFEDNAIRGGKKVFRMKKEVQIKFHVLLTSYELITIDQAILGSIEWACLVVDEAHRLKNNQSKFFRVLNSYKIDYKLLLTGTPLQNNLEELFHLLNFLTPERFNNLEGFLEEFADISKEDQIKKLHDLLGPHMLRRLKADVFKNMPAKTELIVRVELSQMQKKYYKFILTRNFEALNSKGGGNQVSLLNIMMDLKKCCNHPYLFPVAAVEAPVLPNGSYDGSSLVKSSGKLMLLQKMLKKLRDEGHRVLIFSQMTKMLDLLEDFLEYEGYKYERIDGGITGGLRQEAIDRFNAPGAQQFCFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQNKKVMIYRFVTRASVEERITQVAKRKMMLTHLVVRPGLGSKSG-SMTKQELDDILKFGTEELFKDDVEGMMSQGQRPTTPIPDIQSTKGGSLTAGAKKKHGSTPPGDNKDVEDSSVIHYDDAAISKLLDRNQDATDDTELQNMNEYLSSFKVAQYVVRE--------EDGVEEVEREVIKQEEN-VDPDYWEKLLRHHYEQQQEDLARNLGKGKRIRKQVNYNDASQEDQEWQDELSDNQSEYSIGSEDEDEDFEERPEGQSGRRQSRRQLKSDRDKPLPPLLARVGGNIEVLGFNARQRKAFLNAIMRWGMPPQDAFNSHWLVRDLRGKSEKEFRAYVSLFMRHLCEPGADGAETFADGVPREGLSRQHVLTRIGVMSLVRKKVQEFEHVNGKYS 1527          

HSP 2 Score: 251.521 bits (641), Expect = 2.771e-66
Identity = 129/203 (63.55%), Postives = 159/203 (78.33%), Query Frame = -1
Query:  272 KFMFNIADGGFTELHTIWQNEQRALVE-GHEQDIWHRKHDYWLLAGVVAHGYGRWQDIHNDVRFAIVNEPFRNEQQKPNYLEIKNRFLARRFKLLEQALTIEEQLRRAAQLNLTYAPNDQVQNLNRRFTELECLATSQQNVYTEAVQGNKTLVPVLHRVLTQLEDLLSDMKQDXXXXXXXXXXXXXXSQRLNLTQTNLIQKLT 877
            KFMFNIADGGFTELHT+WQNE+RA V  G   +IWHR+HDYWLLAG+V HGY RWQDI ND R+ I+NEPF++E  K NYLE+KN+FLARRFKLLEQAL IEEQLRRAA LN+T  PN     LN R  E+ECLA S Q++  E++ GNK    VLH+VL QLE+LLSDMK DV RLP+ L+R+ PV+ RL +++ +++ +LT
Sbjct: 1700 KFMFNIADGGFTELHTLWQNEERAAVSSGKIYEIWHRRHDYWLLAGIVTHGYARWQDIQNDPRYMILNEPFKSEIHKGNYLEMKNKFLARRFKLLEQALVIEEQLRRAAYLNMTQDPNHPAMALNARLAEVECLAESHQHLSKESLAGNKPANAVLHKVLNQLEELLSDMKADVTRLPSMLSRIPPVAARLQMSERSILSRLT 1902          

HSP 3 Score: 52.7582 bits (125), Expect = 9.322e-6
Identity = 23/65 (35.38%), Postives = 37/65 (56.92%), Query Frame = -3
Query: 5280 LCEEMGIANVEVSYRMDDFENWTIQRLFDQYMRPKLEEKNPHATSDDIQRVLDAKWKEFALLNPY 5474
            L  E G+ +V+  +  DD+   T  + F Q++RP + +KNP      +  VL AKW+EF+  NP+
Sbjct:  140 LMAEWGLDDVDYLFSEDDYHTLTNYKAFSQFLRPLIAKKNPKIPMSKMMTVLGAKWREFSANNPF 204          
BLAST of chromodomain helicase DNA-binding protein 4 vs. UniProt/SwissProt
Match: sp|Q6PDQ2|CHD4_MOUSE (Chromodomain-helicase-DNA-binding protein 4 OS=Mus musculus OX=10090 GN=Chd4 PE=1 SV=1)

HSP 1 Score: 1442.56 bits (3733), Expect = 0.000e+0
Identity = 710/1180 (60.17%), Postives = 891/1180 (75.51%), Query Frame = -1
Query: 1136 MSGYDTDHQDYCEVCQQGGEIMLCDTCPRAFHLVCLDPELEEAPEGSWSCPHCEKEGVVAASRSTTPATGGDMSQNPQNIRKSAQPNEEEKDEHQEFCNECKDGGDLICCAKCPVSYHPECLYPPLSEIPEGPWLCPRCGCGPLKAKVHKILTWRWMEPPKGKDELDHTHKSTEVEKNPTGGHGRQRAPMREFFVKFRDLSYWNCEWLTELQLDVHHPILLRNYFKKNDMDEPPAPEDGSTYKGRAREKVADPH--NLEERFYKWSVRPEWMQIHRIIDHMTHRNNSIWYLIKWRDLAYDECTWEQLDGEYEVIDMKHLVEEYHIMRKLFTGDIYKKKFKNSSXXXXXXXXXXXXXXPTTDLKKRMSKQPDYIEETGGKLHQYQLEGLNWLRFSFGNVVDTILADEMGLGKTIQTITFLYSLYKEGHSKGPFLVAAPLSTVINWEREFEFWAPDFYVVTYVGDKDSRAVVREHEFSYEEGAMRTSKHACRMRQGTRTKFHVLLTSYELISIDQALLGSISWEVLVVDEAHRLKNNQSKFFRILSSYKINYKLLLTGTPLQNNLEELFHLLHFMTPEKFNDMQGFLDEFADISKEEQVKRLHEILGEHLLRRLKADVLTDMPSKGEFIVRVELSPMQAKFYKYILTRNFDALSVKGGGSQISLINIVMDLKKCCNHPYLFPSGSDEAPKLRNGAYEGLALIKASGKLELLYKMLPKLKTGGHRVLIFSQMTRLLDILEDFMDYMGYKFERIDGAVTGQQRQDSIDRFNAPDSVSFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQSNKVMIYRFVTRNTVEERVTQVAKKKMMLTHLVVRPGLGGKGGASMSKKELDEILKFGTEDLFKEK--------DENEDDHKIVYDDGAIDRLIDRSQQGIEEKE-DMMTDYLSSFKVAHYSKREVSVNXXXXXXXXXETRGEIIKQDLDPADPTYWEKLLRHHYEQDQEDLSKSLGKGKRIRKQVNYSATQQEDDNWNDAVGDSDHESGSINKEEDDEEYDE-SRGEIIGTRRSKRERDGTKMPPLLVKVNGQLEVLGFNVRQRKAFINAVMRYGLPPMDFINSHWMVRELRCKSDRVMRAYINLFLRHLCEPESDNTDCYSDQVPREGVSRQHVLTRIGIMAVVRKKVQEFEKINGQYS 4639
            + GY+TDHQDYCEVCQQGGEI+LCDTCPRA+H+VCLDP++E+APEG WSCPHCEKEG+   ++        D S+  + + +     EEE D H EFC  CKDGG+L+CC  CP SYH  CL PPL EIP G WLCPRC C  LK KV KIL W+W +            +  + + N       +  P R+FFVK++ +SYW+C W++ELQL++H  ++ RNY +KNDMDEPP+ + G   +   + K  DP    +EERFY++ ++PEWM IHRI++H   +   + YLIKWRDL YD+ +WE  D E +  D+    + Y   R+L  G+  + +        ++   + PPE PT D   +  +QP+Y++ TGG LH YQ+EGLNWLRFS+    DTILADEMGLGKT+QT  FLYSLYKEGHSKGPFLV+APLST+INWEREFE WAPD YVVTYVGDKDSRA++RE+EFS+E+ A+R  K A RM++    KFHVLLTSYELI+ID A+LGSI W  L+VDEAHRLKNNQSKFFR+L+ Y + +KLLLTGTPLQNNLEELFHLL+F+TPE+F++++GFL+EFADI+KE+Q+K+LH++LG H+LRRLKADV  +MPSK E IVRVELSPMQ K+YKYILTRNF+AL+ +GGG+Q+SL+N+VMDLKKCCNHPYLFP  + EAPK+ NG Y+G ALI+ASGKL LL KML  LK GGHRVLIFSQMT++LD+LEDF+++ GYK+ERIDG +TG  RQ++IDRFNAP +  F FLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQ+ KVMIYRFVTR +VEER+TQVAKKKMMLTHLVVRPGLG K G SMSK+ELD+ILKFGTE+LFK++         E ED   I YDD AI+RL+DR+Q   E+ E   M +YLSSFKVA Y  RE  +       ++EE   EIIKQ+ +  DP YWEKLLRHHYEQ QEDL+++LGKGKRIRKQVNY+   QED +W D   D+  +  S+  EE DE++DE S      +R+  R      +PPLL +V G +EVLGFN RQRKAF+NA+MRYG+PP D   + W+VR+LR KS++  +AY++LF+RHLCEP +D  + ++D VPREG+SRQHVLTRIG+M+++RKKVQEFE +NG++S
Sbjct:  355 VDGYETDHQDYCEVCQQGGEIILCDTCPRAYHMVCLDPDMEKAPEGKWSCPHCEKEGIQWEAKE-------DNSEGEEILEEVGGDPEEEDDHHMEFCRVCKDGGELLCCDTCPSSYHIHCLNPPLPEIPNGEWLCPRCTCPALKGKVQKILIWKWGQ----PPSPTPVPRPPDADPNTPSPKPLEGRPERQFFVKWQGMSYWHCSWVSELQLELHCQVMFRNYQRKNDMDEPPSGDFGGDEEKSRKRKNKDPKFAEMEERFYRYGIKPEWMMIHRILNHSVDKKGHVHYLIKWRDLPYDQASWESEDVEIQDYDL--FKQSYWNHRELMRGE--EGRPGKKLKKVKLRKLERPPETPTVDPTVKYERQPEYLDATGGTLHPYQMEGLNWLRFSWAQGTDTILADEMGLGKTVQTAVFLYSLYKEGHSKGPFLVSAPLSTIINWEREFEMWAPDMYVVTYVGDKDSRAIIRENEFSFEDNAIRGGKKASRMKKEASVKFHVLLTSYELITIDMAILGSIDWACLIVDEAHRLKNNQSKFFRVLNGYSLQHKLLLTGTPLQNNLEELFHLLNFLTPERFHNLEGFLEEFADIAKEDQIKKLHDMLGPHMLRRLKADVFKNMPSKTELIVRVELSPMQKKYYKYILTRNFEALNARGGGNQVSLLNVVMDLKKCCNHPYLFPVAAMEAPKMPNGMYDGSALIRASGKLLLLQKMLKNLKEGGHRVLIFSQMTKMLDLLEDFLEHEGYKYERIDGGITGNMRQEAIDRFNAPGAQQFCFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQNKKVMIYRFVTRASVEERITQVAKKKMMLTHLVVRPGLGSKTG-SMSKQELDDILKFGTEELFKDEATDGGGDNKEGEDSSVIHYDDKAIERLLDRNQDETEDTELQGMNEYLSSFKVAQYVVREEEMG------EEEEVEREIIKQE-ESVDPDYWEKLLRHHYEQQQEDLARNLGKGKRIRKQVNYNDGSQEDRDWQDDQSDNQSDY-SVASEEGDEDFDERSEAPRRPSRKGLRNDKDKPLPPLLARVGGNIEVLGFNARQRKAFLNAIMRYGMPPQDAFTTQWLVRDLRGKSEKEFKAYVSLFMRHLCEPGADGAETFADGVPREGLSRQHVLTRIGVMSLIRKKVQEFEHVNGRWS 1510          

HSP 2 Score: 244.973 bits (624), Expect = 1.815e-63
Identity = 125/203 (61.58%), Postives = 159/203 (78.33%), Query Frame = -1
Query:  272 KFMFNIADGGFTELHTIWQNEQRAL-VEGHEQDIWHRKHDYWLLAGVVAHGYGRWQDIHNDVRFAIVNEPFRNEQQKPNYLEIKNRFLARRFKLLEQALTIEEQLRRAAQLNLTYAPNDQVQNLNRRFTELECLATSQQNVYTEAVQGNKTLVPVLHRVLTQLEDLLSDMKQDXXXXXXXXXXXXXXSQRLNLTQTNLIQKLT 877
            +FMFNIADGGFTELH++WQNE+RA  V     +IWHR+HDYWLLAG++ HGY RWQDI ND R+AI+NEPF+ E  + N+LEIKN+FLARRFKLLEQAL IEEQLRRAA LN++  P+     LN RF E+ECLA S Q++  E++ GNK    VLH+VL QLE+LLSDMK DV RLPA++AR+ PV+ RL +++ N++ +L 
Sbjct: 1698 RFMFNIADGGFTELHSLWQNEERAATVTKKTYEIWHRRHDYWLLAGIINHGYARWQDIQNDPRYAILNEPFKGEMNRGNFLEIKNKFLARRFKLLEQALVIEEQLRRAAYLNMSEDPSHPSMALNTRFAEVECLAESHQHLSKESMAGNKPANAVLHKVLKQLEELLSDMKADVTRLPATIARIPPVAVRLQMSERNILSRLA 1900          
BLAST of chromodomain helicase DNA-binding protein 4 vs. UniProt/SwissProt
Match: sp|Q14839|CHD4_HUMAN (Chromodomain-helicase-DNA-binding protein 4 OS=Homo sapiens OX=9606 GN=CHD4 PE=1 SV=2)

HSP 1 Score: 1441.79 bits (3731), Expect = 0.000e+0
Identity = 710/1180 (60.17%), Postives = 891/1180 (75.51%), Query Frame = -1
Query: 1136 MSGYDTDHQDYCEVCQQGGEIMLCDTCPRAFHLVCLDPELEEAPEGSWSCPHCEKEGVVAASRSTTPATGGDMSQNPQNIRKSAQPNEEEKDEHQEFCNECKDGGDLICCAKCPVSYHPECLYPPLSEIPEGPWLCPRCGCGPLKAKVHKILTWRWMEPPKGKDELDHTHKSTEVEKNPTGGHGRQRAPMREFFVKFRDLSYWNCEWLTELQLDVHHPILLRNYFKKNDMDEPPAPEDGSTYKGRAREKVADPH--NLEERFYKWSVRPEWMQIHRIIDHMTHRNNSIWYLIKWRDLAYDECTWEQLDGEYEVIDMKHLVEEYHIMRKLFTGDIYKKKFKNSSXXXXXXXXXXXXXXPTTDLKKRMSKQPDYIEETGGKLHQYQLEGLNWLRFSFGNVVDTILADEMGLGKTIQTITFLYSLYKEGHSKGPFLVAAPLSTVINWEREFEFWAPDFYVVTYVGDKDSRAVVREHEFSYEEGAMRTSKHACRMRQGTRTKFHVLLTSYELISIDQALLGSISWEVLVVDEAHRLKNNQSKFFRILSSYKINYKLLLTGTPLQNNLEELFHLLHFMTPEKFNDMQGFLDEFADISKEEQVKRLHEILGEHLLRRLKADVLTDMPSKGEFIVRVELSPMQAKFYKYILTRNFDALSVKGGGSQISLINIVMDLKKCCNHPYLFPSGSDEAPKLRNGAYEGLALIKASGKLELLYKMLPKLKTGGHRVLIFSQMTRLLDILEDFMDYMGYKFERIDGAVTGQQRQDSIDRFNAPDSVSFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQSNKVMIYRFVTRNTVEERVTQVAKKKMMLTHLVVRPGLGGKGGASMSKKELDEILKFGTEDLFKEK--------DENEDDHKIVYDDGAIDRLIDRSQQGIEEKE-DMMTDYLSSFKVAHYSKREVSVNXXXXXXXXXETRGEIIKQDLDPADPTYWEKLLRHHYEQDQEDLSKSLGKGKRIRKQVNYSATQQEDDNWNDAVGDSDHESGSINKEEDDEEYDE-SRGEIIGTRRSKRERDGTKMPPLLVKVNGQLEVLGFNVRQRKAFINAVMRYGLPPMDFINSHWMVRELRCKSDRVMRAYINLFLRHLCEPESDNTDCYSDQVPREGVSRQHVLTRIGIMAVVRKKVQEFEKINGQYS 4639
            + GY+TDHQDYCEVCQQGGEI+LCDTCPRA+H+VCLDP++E+APEG WSCPHCEKEG+   ++        D S+  + + +     EEE D H EFC  CKDGG+L+CC  CP SYH  CL PPL EIP G WLCPRC C  LK KV KIL W+W +            +  + + N       +  P R+FFVK++ +SYW+C W++ELQL++H  ++ RNY +KNDMDEPP+ + G   +   + K  DP    +EERFY++ ++PEWM IHRI++H   +   + YLIKWRDL YD+ +WE  D E +  D+    + Y   R+L  G+  + +        ++   + PPE PT D   +  +QP+Y++ TGG LH YQ+EGLNWLRFS+    DTILADEMGLGKT+QT  FLYSLYKEGHSKGPFLV+APLST+INWEREFE WAPD YVVTYVGDKDSRA++RE+EFS+E+ A+R  K A RM++    KFHVLLTSYELI+ID A+LGSI W  L+VDEAHRLKNNQSKFFR+L+ Y + +KLLLTGTPLQNNLEELFHLL+F+TPE+F++++GFL+EFADI+KE+Q+K+LH++LG H+LRRLKADV  +MPSK E IVRVELSPMQ K+YKYILTRNF+AL+ +GGG+Q+SL+N+VMDLKKCCNHPYLFP  + EAPK+ NG Y+G ALI+ASGKL LL KML  LK GGHRVLIFSQMT++LD+LEDF+++ GYK+ERIDG +TG  RQ++IDRFNAP +  F FLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQ+ KVMIYRFVTR +VEER+TQVAKKKMMLTHLVVRPGLG K G SMSK+ELD+ILKFGTE+LFK++         E ED   I YDD AI+RL+DR+Q   E+ E   M +YLSSFKVA Y  RE  +       ++EE   EIIKQ+ +  DP YWEKLLRHHYEQ QEDL+++LGKGKRIRKQVNY+   QED +W D   D+  +  S+  EE DE++DE S      +R+  R      +PPLL +V G +EVLGFN RQRKAF+NA+MRYG+PP D   + W+VR+LR KS++  +AY++LF+RHLCEP +D  + ++D VPREG+SRQHVLTRIG+M+++RKKVQEFE +NG++S
Sbjct:  362 VDGYETDHQDYCEVCQQGGEIILCDTCPRAYHMVCLDPDMEKAPEGKWSCPHCEKEGIQWEAKE-------DNSEGEEILEEVGGDLEEEDDHHMEFCRVCKDGGELLCCDTCPSSYHIHCLNPPLPEIPNGEWLCPRCTCPALKGKVQKILIWKWGQ----PPSPTPVPRPPDADPNTPSPKPLEGRPERQFFVKWQGMSYWHCSWVSELQLELHCQVMFRNYQRKNDMDEPPSGDFGGDEEKSRKRKNKDPKFAEMEERFYRYGIKPEWMMIHRILNHSVDKKGHVHYLIKWRDLPYDQASWESEDVEIQDYDL--FKQSYWNHRELMRGE--EGRPGKKLKKVKLRKLERPPETPTVDPTVKYERQPEYLDATGGTLHPYQMEGLNWLRFSWAQGTDTILADEMGLGKTVQTAVFLYSLYKEGHSKGPFLVSAPLSTIINWEREFEMWAPDMYVVTYVGDKDSRAIIRENEFSFEDNAIRGGKKASRMKKEASVKFHVLLTSYELITIDMAILGSIDWACLIVDEAHRLKNNQSKFFRVLNGYSLQHKLLLTGTPLQNNLEELFHLLNFLTPERFHNLEGFLEEFADIAKEDQIKKLHDMLGPHMLRRLKADVFKNMPSKTELIVRVELSPMQKKYYKYILTRNFEALNARGGGNQVSLLNVVMDLKKCCNHPYLFPVAAMEAPKMPNGMYDGSALIRASGKLLLLQKMLKNLKEGGHRVLIFSQMTKMLDLLEDFLEHEGYKYERIDGGITGNMRQEAIDRFNAPGAQQFCFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQNKKVMIYRFVTRASVEERITQVAKKKMMLTHLVVRPGLGSKTG-SMSKQELDDILKFGTEELFKDEATDGGGDNKEGEDSSVIHYDDKAIERLLDRNQDETEDTELQGMNEYLSSFKVAQYVVREEEMG------EEEEVEREIIKQE-ESVDPDYWEKLLRHHYEQQQEDLARNLGKGKRIRKQVNYNDGSQEDRDWQDDQSDNQSDY-SVASEEGDEDFDERSEAPRRPSRKGLRNDKDKPLPPLLARVGGNIEVLGFNARQRKAFLNAIMRYGMPPQDAFTTQWLVRDLRGKSEKEFKAYVSLFMRHLCEPGADGAETFADGVPREGLSRQHVLTRIGVMSLIRKKVQEFEHVNGRWS 1517          

HSP 2 Score: 248.825 bits (634), Expect = 1.346e-64
Identity = 128/217 (58.99%), Postives = 165/217 (76.04%), Query Frame = -1
Query:  245 KIVINKFMFNIADGGFTELHTIWQNEQRAL-VEGHEQDIWHRKHDYWLLAGVVAHGYGRWQDIHNDVRFAIVNEPFRNEQQKPNYLEIKNRFLARRFKLLEQALTIEEQLRRAAQLNLTYAPNDQVQNLNRRFTELECLATSQQNVYTEAVQGNKTLVPVLHRVLTQLEDLLSDMKQDXXXXXXXXXXXXXXSQRLNLTQTNLIQKLTVQMQQTKPQ 892
            K +  +FMFNIADGGFTELH++WQNE+RA  V     +IWHR+HDYWLLAG++ HGY RWQDI ND R+AI+NEPF+ E  + N+LEIKN+FLARRFKLLEQAL IEEQLRRAA LN++  P+     LN RF E+ECLA S Q++  E++ GNK    VLH+VL QLE+LLSDMK DV RLPA++AR+ PV+ RL +++ N++ +L  +  +  PQ
Sbjct: 1690 KNIKQRFMFNIADGGFTELHSLWQNEERAATVTKKTYEIWHRRHDYWLLAGIINHGYARWQDIQNDPRYAILNEPFKGEMNRGNFLEIKNKFLARRFKLLEQALVIEEQLRRAAYLNMSEDPSHPSMALNTRFAEVECLAESHQHLSKESMAGNKPANAVLHKVLKQLEELLSDMKADVTRLPATIARIPPVAVRLQMSERNILSRLANRAPEPTPQ 1906          
BLAST of chromodomain helicase DNA-binding protein 4 vs. UniProt/SwissProt
Match: sp|Q8TDI0|CHD5_HUMAN (Chromodomain-helicase-DNA-binding protein 5 OS=Homo sapiens OX=9606 GN=CHD5 PE=1 SV=1)

HSP 1 Score: 1441.02 bits (3729), Expect = 0.000e+0
Identity = 724/1219 (59.39%), Postives = 891/1219 (73.09%), Query Frame = -1
Query: 1136 GYDTDHQDYCEVCQQGGEIMLCDTCPRAFHLVCLDPELEEAPEGSWSCPHCEKEGVVAASRSTTPATGGDMSQNPQNIRKSAQPNEEEKDEHQEFCNECKDGGDLICCAKCPVSYHPECLYPPLSEIPEGPWLCPRCGCGPLKAKVHKILTWRWMEPPKGKDELDHTHKSTEVEKNPTGGHGRQRAPMREFFVKFRDLSYWNCEWLTELQLDVHHPILLRNYFKKNDMDEPP------APEDGSTYKGRAREKVADPHNLEERFYKWSVRPEWMQIHRIIDHMTHRNNSIWYLIKWRDLAYDECTWEQLDGEYEVIDMKHLVEEYHIMRKLFTGDIYKKKFKNSSXXXXXXXXXXXXXXPT--TDLKKRMSKQPDYIEETGGKLHQYQLEGLNWLRFSFGNVVDTILADEMGLGKTIQTITFLYSLYKEGHSKGPFLVAAPLSTVINWEREFEFWAPDFYVVTYVGDKDSRAVVREHEFSYEEGAMRTSKHACRMRQGTRTKFHVLLTSYELISIDQALLGSISWEVLVVDEAHRLKNNQSKFFRILSSYKINYKLLLTGTPLQNNLEELFHLLHFMTPEKFNDMQGFLDEFADISKEEQVKRLHEILGEHLLRRLKADVLTDMPSKGEFIVRVELSPMQAKFYKYILTRNFDALSVKGGGSQISLINIVMDLKKCCNHPYLFPSGSDEAPKLRNGAYEGLALIKASGKLELLYKMLPKLKTGGHRVLIFSQMTRLLDILEDFMDYMGYKFERIDGAVTGQQRQDSIDRFNAPDSVSFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQSNKVMIYRFVTRNTVEERVTQVAKKKMMLTHLVVRPGLGGKGGASMSKKELDEILKFGTEDLFKEKDEN------------------------------------------EDDHKIVYDDGAIDRLIDRSQQGIEEKE-DMMTDYLSSFKVAHYSKREVSVNXXXXXXXXXETRGEIIKQDLDPADPTYWEKLLRHHYEQDQEDLSKSLGKGKRIRKQVNYSATQQEDDNWNDAVGD--SDHESGSINKEEDDEEYDESRGEIIGTRRSKRERDGTKMPPLLVKVNGQLEVLGFNVRQRKAFINAVMRYGLPPMDFINSHWMVRELRCKSDRVMRAYINLFLRHLCEPESDNTDCYSDQVPREGVSRQHVLTRIGIMAVVRKKVQEFEKINGQYS 4633
            GY+TDHQDYCEVCQQGGEI+LCDTCPRA+HLVCLDPELE+APEG WSCPHCEKEG+    +                  +     EEE+D+H EFC  CKDGG+L+CC  CP SYH  CL PPL EIP G WLCPRC C PLK KV +IL WRW EPP             +VE +       +  P REFFVK+  LSYW+C W+ ELQL+++H ++ RNY +KNDMDEPP        EDG + K + ++ +     +EERFY++ ++PEWM IHRI++H   +   + YLIKW+DL YD+CTWE  D +    D  +L + Y   R+L  G+  +   +     K++   K      T   D   +  KQP YI+ TGG LH YQLEGLNWLRFS+    DTILADEMGLGKT+QTI FLYSLYKEGHSKGP+LV+APLST+INWEREFE WAPDFYVVTY GDK+SR+V+RE+EFS+E+ A+R+ K   RM++  + KFHVLLTSYELI+IDQA+LGSI W  LVVDEAHRLKNNQSKFFR+L+SYKI+YKLLLTGTPLQNNLEELFHLL+F+TPE+FN+++GFL+EFADISKE+Q+K+LH++LG H+LRRLKADV  +MP+K E IVRVELS MQ K+YK+ILTRNF+AL+ KGGG+Q+SL+NI+MDLKKCCNHPYLFP  + EAP L NG+Y+G +L+K+SGKL LL KML KL+  GHRVLIFSQMT++LD+LEDF++Y GYK+ERIDG +TG  RQ++IDRFNAP +  F FLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQ+ KVMIYRFVTR +VEER+TQVAK+KMMLTHLVVRPGLG K G SM+K+ELD+ILKFGTE+LFK+  E                                           ED   I YDD AI +L+DR+Q   ++ E   M +YLSSFKVA Y  RE        +D  EE   EIIKQ+ +  DP YWEKLLRHHYEQ QEDL+++LGKGKRIRKQVNY+   QED  W D + D  S++  GS +++ED EE  E +     +RR  +      +PPLL +V G +EVLGFN RQRKAF+NA+MR+G+PP D  NSHW+VR+LR KS++  RAY++LF+RHLCEP +D  + ++D VPREG+SRQHVLTRIG+M++VRKKVQEFE +NG+YS
Sbjct:  337 GYETDHQDYCEVCQQGGEIILCDTCPRAYHLVCLDPELEKAPEGKWSCPHCEKEGIQWEPKDDD-------------DEEEEGGCEEEEDDHMEFCRVCKDGGELLCCDACPSSYHLHCLNPPLPEIPNGEWLCPRCTCPPLKGKVQRILHWRWTEPPA---PFMVGLPGPDVEPSLPPPKPLEGIPEREFFVKWAGLSYWHCSWVKELQLELYHTVMYRNYQRKNDMDEPPPFDYGSGDEDGKSEKRKNKDPLY--AKMEERFYRYGIKPEWMMIHRILNHSFDKKGDVHYLIKWKDLPYDQCTWEIDDIDIPYYD--NLKQAYWGHRELMLGEDTRLPKRLLKKGKKLRDDKQEKPPDTPIVDPTVKFDKQPWYIDSTGGTLHPYQLEGLNWLRFSWAQGTDTILADEMGLGKTVQTIVFLYSLYKEGHSKGPYLVSAPLSTIINWEREFEMWAPDFYVVTYTGDKESRSVIRENEFSFEDNAIRSGKKVFRMKKEVQIKFHVLLTSYELITIDQAILGSIEWACLVVDEAHRLKNNQSKFFRVLNSYKIDYKLLLTGTPLQNNLEELFHLLNFLTPERFNNLEGFLEEFADISKEDQIKKLHDLLGPHMLRRLKADVFKNMPAKTELIVRVELSQMQKKYYKFILTRNFEALNSKGGGNQVSLLNIMMDLKKCCNHPYLFPVAAVEAPVLPNGSYDGSSLVKSSGKLMLLQKMLKKLRDEGHRVLIFSQMTKMLDLLEDFLEYEGYKYERIDGGITGGLRQEAIDRFNAPGAQQFCFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQNKKVMIYRFVTRASVEERITQVAKRKMMLTHLVVRPGLGSKSG-SMTKQELDDILKFGTEELFKDDVEGMMSQGQRPVTPIPDVQSSKGGNLAASAKKKHGSTPPGDNKDVEDSSVIHYDDAAISKLLDRNQDATDDTELQNMNEYLSSFKVAQYVVRE--------EDGVEEVEREIIKQEEN-VDPDYWEKLLRHHYEQQQEDLARNLGKGKRIRKQVNYNDASQEDQEWQDELSDNQSEYSIGSEDEDEDFEERPEGQSGRRQSRRQLKSDRDKPLPPLLARVGGNIEVLGFNARQRKAFLNAIMRWGMPPQDAFNSHWLVRDLRGKSEKEFRAYVSLFMRHLCEPGADGAETFADGVPREGLSRQHVLTRIGVMSLVRKKVQEFEHVNGKYS 1525          

HSP 2 Score: 249.21 bits (635), Expect = 9.741e-65
Identity = 128/201 (63.68%), Postives = 157/201 (78.11%), Query Frame = -1
Query:  272 MFNIADGGFTELHTIWQNEQRALVE-GHEQDIWHRKHDYWLLAGVVAHGYGRWQDIHNDVRFAIVNEPFRNEQQKPNYLEIKNRFLARRFKLLEQALTIEEQLRRAAQLNLTYAPNDQVQNLNRRFTELECLATSQQNVYTEAVQGNKTLVPVLHRVLTQLEDLLSDMKQDXXXXXXXXXXXXXXSQRLNLTQTNLIQKLT 871
            MFNIADGGFTELHT+WQNE+RA V  G   DIWHR+HDYWLLAG+V HGY RWQDI ND R+ I+NEPF++E  K NYLE+KN+FLARRFKLLEQAL IEEQLRRAA LN+T  PN     LN R  E+ECLA S Q++  E++ GNK    VLH+VL QLE+LLSDMK DV RLP+ L+R+ PV+ RL +++ +++ +LT
Sbjct: 1704 MFNIADGGFTELHTLWQNEERAAVSSGKIYDIWHRRHDYWLLAGIVTHGYARWQDIQNDPRYMILNEPFKSEVHKGNYLEMKNKFLARRFKLLEQALVIEEQLRRAAYLNMTQDPNHPAMALNARLAEVECLAESHQHLSKESLAGNKPANAVLHKVLNQLEELLSDMKADVTRLPSMLSRIPPVAARLQMSERSILSRLT 1904          
BLAST of chromodomain helicase DNA-binding protein 4 vs. UniProt/SwissProt
Match: sp|A2A8L1|CHD5_MOUSE (Chromodomain-helicase-DNA-binding protein 5 OS=Mus musculus OX=10090 GN=Chd5 PE=1 SV=1)

HSP 1 Score: 1439.48 bits (3725), Expect = 0.000e+0
Identity = 724/1219 (59.39%), Postives = 891/1219 (73.09%), Query Frame = -1
Query: 1136 GYDTDHQDYCEVCQQGGEIMLCDTCPRAFHLVCLDPELEEAPEGSWSCPHCEKEGVVAASRSTTPATGGDMSQNPQNIRKSAQPNEEEKDEHQEFCNECKDGGDLICCAKCPVSYHPECLYPPLSEIPEGPWLCPRCGCGPLKAKVHKILTWRWMEPPKGKDELDHTHKSTEVEKNPTGGHGRQRAPMREFFVKFRDLSYWNCEWLTELQLDVHHPILLRNYFKKNDMDEPP------APEDGSTYKGRAREKVADPHNLEERFYKWSVRPEWMQIHRIIDHMTHRNNSIWYLIKWRDLAYDECTWEQLDGEYEVIDMKHLVEEYHIMRKLFTGDIYKKKFKNSSXXXXXXXXXXXXXXPT--TDLKKRMSKQPDYIEETGGKLHQYQLEGLNWLRFSFGNVVDTILADEMGLGKTIQTITFLYSLYKEGHSKGPFLVAAPLSTVINWEREFEFWAPDFYVVTYVGDKDSRAVVREHEFSYEEGAMRTSKHACRMRQGTRTKFHVLLTSYELISIDQALLGSISWEVLVVDEAHRLKNNQSKFFRILSSYKINYKLLLTGTPLQNNLEELFHLLHFMTPEKFNDMQGFLDEFADISKEEQVKRLHEILGEHLLRRLKADVLTDMPSKGEFIVRVELSPMQAKFYKYILTRNFDALSVKGGGSQISLINIVMDLKKCCNHPYLFPSGSDEAPKLRNGAYEGLALIKASGKLELLYKMLPKLKTGGHRVLIFSQMTRLLDILEDFMDYMGYKFERIDGAVTGQQRQDSIDRFNAPDSVSFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQSNKVMIYRFVTRNTVEERVTQVAKKKMMLTHLVVRPGLGGKGGASMSKKELDEILKFGTEDLFKEKDEN------------------------------------------EDDHKIVYDDGAIDRLIDRSQQGIEEKE-DMMTDYLSSFKVAHYSKREVSVNXXXXXXXXXETRGEIIKQDLDPADPTYWEKLLRHHYEQDQEDLSKSLGKGKRIRKQVNYSATQQEDDNWNDAVGD--SDHESGSINKEEDDEEYDESRGEIIGTRRSKRERDGTKMPPLLVKVNGQLEVLGFNVRQRKAFINAVMRYGLPPMDFINSHWMVRELRCKSDRVMRAYINLFLRHLCEPESDNTDCYSDQVPREGVSRQHVLTRIGIMAVVRKKVQEFEKINGQYS 4633
            GY+TDHQDYCEVCQQGGEI+LCDTCPRA+HLVCLDPELE+APEG WSCPHCEKEG+    +                  +     EEE+D+H EFC  CKDGG+L+CC  CP SYH  CL PPL EIP G WLCPRC C PLK KV +IL WRW EPP             EVE         +  P REFFVK+  LSYW+C W+ ELQL+++H ++ RNY +KNDMDEPP        EDG + K + ++ +     +EERFY++ ++PEWM +HRI++H   +   I YLIKW+DL YD+CTWE +D E ++    +L + Y   R+L  G+  +   +     K++   K      T   D   +  KQP YI+ TGG LH YQLEGLNWLRFS+    DTILADEMGLGKT+QTI FLYSLYKEGHSKGP+LV+APLST+INWEREFE WAPDFYVVTY GDK+SR+V+RE+EFS+E+ A+R  K   RM++  + KFHVLLTSYELI+IDQA+LGSI W  LVVDEAHRLKNNQSKFFR+L+SYKI+YKLLLTGTPLQNNLEELFHLL+F+TPE+FN+++GFL+EFADISKE+Q+K+LH++LG H+LRRLKADV  +MP+K E IVRVELS MQ K+YK+ILTRNF+AL+ KGGG+Q+SL+NI+MDLKKCCNHPYLFP  + EAP L NG+Y+G +L+K+SGKL LL KML KL+  GHRVLIFSQMT++LD+LEDF++Y GYK+ERIDG +TG  RQ++IDRFNAP +  F FLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQ+ KVMIYRFVTR +VEER+TQVAK+KMMLTHLVVRPGLG K G SM+K+ELD+ILKFGTE+LFK+  E                                           ED   I YDD AI +L+DR+Q   ++ E   M +YLSSFKVA Y  RE        +D  EE   E+IKQ+ +  DP YWEKLLRHHYEQ QEDL+++LGKGKRIRKQVNY+   QED  W D + D  S++  GS +++ED EE  E +     +RR  +      +PPLL +V G +EVLGFN RQRKAF+NA+MR+G+PP D  NSHW+VR+LR KS++  RAY++LF+RHLCEP +D  + ++D VPREG+SRQHVLTRIG+M++VRKKVQEFE +NG+YS
Sbjct:  339 GYETDHQDYCEVCQQGGEIILCDTCPRAYHLVCLDPELEKAPEGKWSCPHCEKEGIQWEPKDDD-------------EEEEEGGCEEEEDDHMEFCRVCKDGGELLCCDACPSSYHLHCLNPPLPEIPNGEWLCPRCTCPPLKGKVQRILHWRWTEPPA---PFVVGLPGPEVEPGMPPPRPLEGIPEREFFVKWAGLSYWHCSWVKELQLELYHTVMYRNYQRKNDMDEPPPFDYGSGDEDGKSEKRKNKDPLY--AKMEERFYRYGIKPEWMMVHRILNHSFDKKGDIHYLIKWKDLPYDQCTWE-ID-EIDIPYYDNLKQAYWGHRELMLGEDARLPKRLVKKGKKLKDDKQEKPPDTPIVDPTVKFDKQPWYIDATGGTLHPYQLEGLNWLRFSWAQGTDTILADEMGLGKTVQTIVFLYSLYKEGHSKGPYLVSAPLSTIINWEREFEMWAPDFYVVTYTGDKESRSVIRENEFSFEDNAIRGGKKVFRMKKEVQIKFHVLLTSYELITIDQAILGSIEWACLVVDEAHRLKNNQSKFFRVLNSYKIDYKLLLTGTPLQNNLEELFHLLNFLTPERFNNLEGFLEEFADISKEDQIKKLHDLLGPHMLRRLKADVFKNMPAKTELIVRVELSQMQKKYYKFILTRNFEALNSKGGGNQVSLLNIMMDLKKCCNHPYLFPVAAVEAPVLPNGSYDGSSLVKSSGKLMLLQKMLKKLRDEGHRVLIFSQMTKMLDLLEDFLEYEGYKYERIDGGITGGLRQEAIDRFNAPGAQQFCFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQNKKVMIYRFVTRASVEERITQVAKRKMMLTHLVVRPGLGSKSG-SMTKQELDDILKFGTEELFKDDVEGMMSQGQRPTTPIPDIQSTKGGSLTAGAKKKHGSTPPGDNKDVEDSSVIHYDDAAISKLLDRNQDATDDTELQNMNEYLSSFKVAQYVVRE--------EDGVEEVEREVIKQEEN-VDPDYWEKLLRHHYEQQQEDLARNLGKGKRIRKQVNYNDASQEDQEWQDELSDNQSEYSIGSEDEDEDFEERPEGQSGRRQSRRQLKSDRDKPLPPLLARVGGNIEVLGFNARQRKAFLNAIMRWGMPPQDAFNSHWLVRDLRGKSEKEFRAYVSLFMRHLCEPGADGAETFADGVPREGLSRQHVLTRIGVMSLVRKKVQEFEHVNGKYS 1527          

HSP 2 Score: 251.521 bits (641), Expect = 1.939e-65
Identity = 129/203 (63.55%), Postives = 159/203 (78.33%), Query Frame = -1
Query:  272 KFMFNIADGGFTELHTIWQNEQRALVE-GHEQDIWHRKHDYWLLAGVVAHGYGRWQDIHNDVRFAIVNEPFRNEQQKPNYLEIKNRFLARRFKLLEQALTIEEQLRRAAQLNLTYAPNDQVQNLNRRFTELECLATSQQNVYTEAVQGNKTLVPVLHRVLTQLEDLLSDMKQDXXXXXXXXXXXXXXSQRLNLTQTNLIQKLT 877
            KFMFNIADGGFTELHT+WQNE+RA V  G   +IWHR+HDYWLLAG+V HGY RWQDI ND R+ I+NEPF++E  K NYLE+KN+FLARRFKLLEQAL IEEQLRRAA LN+T  PN     LN R  E+ECLA S Q++  E++ GNK    VLH+VL QLE+LLSDMK DV RLP+ L+R+ PV+ RL +++ +++ +LT
Sbjct: 1700 KFMFNIADGGFTELHTLWQNEERAAVSSGKIYEIWHRRHDYWLLAGIVTHGYARWQDIQNDPRYMILNEPFKSEIHKGNYLEMKNKFLARRFKLLEQALVIEEQLRRAAYLNMTQDPNHPAMALNARLAEVECLAESHQHLSKESLAGNKPANAVLHKVLNQLEELLSDMKADVTRLPSMLSRIPPVAARLQMSERSILSRLT 1902          
BLAST of chromodomain helicase DNA-binding protein 4 vs. UniProt/SwissProt
Match: sp|D3ZD32|CHD5_RAT (Chromodomain-helicase-DNA-binding protein 5 OS=Rattus norvegicus OX=10116 GN=Chd5 PE=1 SV=1)

HSP 1 Score: 1439.09 bits (3724), Expect = 0.000e+0
Identity = 723/1219 (59.31%), Postives = 891/1219 (73.09%), Query Frame = -1
Query: 1136 GYDTDHQDYCEVCQQGGEIMLCDTCPRAFHLVCLDPELEEAPEGSWSCPHCEKEGVVAASRSTTPATGGDMSQNPQNIRKSAQPNEEEKDEHQEFCNECKDGGDLICCAKCPVSYHPECLYPPLSEIPEGPWLCPRCGCGPLKAKVHKILTWRWMEPPKGKDELDHTHKSTEVEKNPTGGHGRQRAPMREFFVKFRDLSYWNCEWLTELQLDVHHPILLRNYFKKNDMDEPP------APEDGSTYKGRAREKVADPHNLEERFYKWSVRPEWMQIHRIIDHMTHRNNSIWYLIKWRDLAYDECTWEQLDGEYEVIDMKHLVEEYHIMRKLFTGDIYKKKFKNSSXXXXXXXXXXXXXXPT--TDLKKRMSKQPDYIEETGGKLHQYQLEGLNWLRFSFGNVVDTILADEMGLGKTIQTITFLYSLYKEGHSKGPFLVAAPLSTVINWEREFEFWAPDFYVVTYVGDKDSRAVVREHEFSYEEGAMRTSKHACRMRQGTRTKFHVLLTSYELISIDQALLGSISWEVLVVDEAHRLKNNQSKFFRILSSYKINYKLLLTGTPLQNNLEELFHLLHFMTPEKFNDMQGFLDEFADISKEEQVKRLHEILGEHLLRRLKADVLTDMPSKGEFIVRVELSPMQAKFYKYILTRNFDALSVKGGGSQISLINIVMDLKKCCNHPYLFPSGSDEAPKLRNGAYEGLALIKASGKLELLYKMLPKLKTGGHRVLIFSQMTRLLDILEDFMDYMGYKFERIDGAVTGQQRQDSIDRFNAPDSVSFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQSNKVMIYRFVTRNTVEERVTQVAKKKMMLTHLVVRPGLGGKGGASMSKKELDEILKFGTEDLFKEKDEN------------------------------------------EDDHKIVYDDGAIDRLIDRSQQGIEEKE-DMMTDYLSSFKVAHYSKREVSVNXXXXXXXXXETRGEIIKQDLDPADPTYWEKLLRHHYEQDQEDLSKSLGKGKRIRKQVNYSATQQEDDNWNDAVGD--SDHESGSINKEEDDEEYDESRGEIIGTRRSKRERDGTKMPPLLVKVNGQLEVLGFNVRQRKAFINAVMRYGLPPMDFINSHWMVRELRCKSDRVMRAYINLFLRHLCEPESDNTDCYSDQVPREGVSRQHVLTRIGIMAVVRKKVQEFEKINGQYS 4633
            GY+TDHQDYCEVCQQGGEI+LCDTCPRA+HLVCLDPELE+APEG WSCPHCEKEG+    +                  +     EEE+D+H EFC  CKDGG+L+CC  CP SYH  CL PPL EIP G WLCPRC C PLK KV +IL WRW EPP             EVE         +  P REFFVK+  LSYW+C W+ ELQL+++H ++ RNY +KNDMDEPP        EDG + K + ++ +     +EERFY++ ++PEWM +HRI++H   +   + YLIKW+DL YD+CTWE +D E ++    +L + Y   R+L  G+  +   +     K++   K      T   D   +  KQP YI+ TGG LH YQLEGLNWLRFS+    DTILADEMGLGKT+QTI FLYSLYKEGHSKGP+LV+APLST+INWEREFE WAPDFYVVTY GDK+SR+V+RE+EFS+E+ A+R  K   RM++  + KFHVLLTSYELI+IDQA+LGSI W  LVVDEAHRLKNNQSKFFR+L+SYKI+YKLLLTGTPLQNNLEELFHLL+F+TPE+FN+++GFL+EFADISKE+Q+K+LH++LG H+LRRLKADV  +MP+K E IVRVELS MQ K+YK+ILTRNF+AL+ KGGG+Q+SL+NI+MDLKKCCNHPYLFP  + EAP L NG+Y+G +L+K+SGKL LL KML KL+  GHRVLIFSQMT++LD+LEDF++Y GYK+ERIDG +TG  RQ++IDRFNAP +  F FLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQ+ KVMIYRFVTR +VEER+TQVAK+KMMLTHLVVRPGLG K G SM+K+ELD+ILKFGTE+LFK+  E                                           ED   I YDD AI +L+DR+Q   ++ E   M +YLSSFKVA Y  RE        +D  EE   E+IKQ+ +  DP YWEKLLRHHYEQ QEDL+++LGKGKRIRKQVNY+   QED  W D + D  S++  GS +++ED EE  E +     +RR  +      +PPLL +V G +EVLGFN RQRKAF+NA+MR+G+PP D  NSHW+VR+LR KS++  RAY++LF+RHLCEP +D  + ++D VPREG+SRQHVLTRIG+M++VRKKVQEFE +NG+YS
Sbjct:  335 GYETDHQDYCEVCQQGGEIILCDTCPRAYHLVCLDPELEKAPEGKWSCPHCEKEGIQWEPKDDD-------------EEEEEGGCEEEEDDHMEFCRVCKDGGELLCCDACPSSYHLHCLNPPLPEIPNGEWLCPRCTCPPLKGKVQRILHWRWTEPPA---PFMVGLPGPEVEPGMPPPRPLEGIPEREFFVKWAGLSYWHCSWVKELQLELYHTVMYRNYQRKNDMDEPPPFDYGSGDEDGKSEKRKNKDPLY--AKMEERFYRYGIKPEWMMVHRILNHSFDKKGDVHYLIKWKDLPYDQCTWE-ID-EIDIPYYDNLKQTYWGHRELMLGEDARLPKRLVKKGKKLKDDKQEKPPDTPIVDPTVKFDKQPWYIDSTGGTLHPYQLEGLNWLRFSWAQGTDTILADEMGLGKTVQTIVFLYSLYKEGHSKGPYLVSAPLSTIINWEREFEMWAPDFYVVTYTGDKESRSVIRENEFSFEDNAIRGGKKVFRMKKEVQIKFHVLLTSYELITIDQAILGSIEWACLVVDEAHRLKNNQSKFFRVLNSYKIDYKLLLTGTPLQNNLEELFHLLNFLTPERFNNLEGFLEEFADISKEDQIKKLHDLLGPHMLRRLKADVFKNMPAKTELIVRVELSQMQKKYYKFILTRNFEALNSKGGGNQVSLLNIMMDLKKCCNHPYLFPVAAVEAPMLPNGSYDGSSLVKSSGKLMLLQKMLKKLRDEGHRVLIFSQMTKMLDLLEDFLEYEGYKYERIDGGITGGLRQEAIDRFNAPGAQQFCFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQNKKVMIYRFVTRASVEERITQVAKRKMMLTHLVVRPGLGSKSG-SMTKQELDDILKFGTEELFKDDVEGMMSQGQRPTTPIPDVQSTKGGSLAAGAKKKHGGTPPGDNKDVEDSSVIHYDDAAISKLLDRNQDATDDTELQNMNEYLSSFKVAQYVVRE--------EDGVEEVEREVIKQEEN-VDPDYWEKLLRHHYEQQQEDLARNLGKGKRIRKQVNYNDASQEDQEWQDELSDNQSEYSIGSEDEDEDFEERPEGQSGRRQSRRQLKSDRDKPLPPLLARVGGNIEVLGFNARQRKAFLNAIMRWGMPPQDAFNSHWLVRDLRGKSEKEFRAYVSLFMRHLCEPGADGAETFADGVPREGLSRQHVLTRIGVMSLVRKKVQEFEHVNGKYS 1523          

HSP 2 Score: 251.906 bits (642), Expect = 1.571e-65
Identity = 129/203 (63.55%), Postives = 159/203 (78.33%), Query Frame = -1
Query:  272 KFMFNIADGGFTELHTIWQNEQRALVE-GHEQDIWHRKHDYWLLAGVVAHGYGRWQDIHNDVRFAIVNEPFRNEQQKPNYLEIKNRFLARRFKLLEQALTIEEQLRRAAQLNLTYAPNDQVQNLNRRFTELECLATSQQNVYTEAVQGNKTLVPVLHRVLTQLEDLLSDMKQDXXXXXXXXXXXXXXSQRLNLTQTNLIQKLT 877
            KFMFNIADGGFTELHT+WQNE+RA V  G   +IWHR+HDYWLLAG+V HGY RWQDI ND R+ I+NEPF++E  K NYLE+KN+FLARRFKLLEQAL IEEQLRRAA LN+T  PN     LN R  E+ECLA S Q++  E++ GNK    VLH+VL QLE+LLSDMK DV RLP+ L+R+ PV+ RL +++ +++ +LT
Sbjct: 1696 KFMFNIADGGFTELHTLWQNEERAAVSSGKIYEIWHRRHDYWLLAGIVTHGYARWQDIQNDPRYMILNEPFKSEVHKGNYLEMKNKFLARRFKLLEQALVIEEQLRRAAYLNMTQDPNHPAMALNARLAEVECLAESHQHLSKESLAGNKPANAVLHKVLNQLEELLSDMKADVTRLPSMLSRIPPVAARLQMSERSILSRLT 1898          
BLAST of chromodomain helicase DNA-binding protein 4 vs. TrEMBL
Match: D5LXF2 (Chromodomain helicase DNA-binding protein 4 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 3024.57 bits (7840), Expect = 0.000e+0
Identity = 1586/1586 (100.00%), Postives = 1586/1586 (100.00%), Query Frame = -1
Query:  104 LVVGSNDTSDEEFERXXXXXXXXXXXXXERLRQRKLVTKGKRSHPEDPIVLDQEQEEANKKKTLHHRTTSKYPLMSGYDTDHQDYCEVCQQGGEIMLCDTCPRAFHLVCLDPELEEAPEGSWSCPHCEKEGVVAASRSTTPATGGDMSQNPQNIRKSAQPNEEEKDEHQEFCNECKDGGDLICCAKCPVSYHPECLYPPLSEIPEGPWLCPRCGCGPLKAKVHKILTWRWMEPPKGKDELDHTHKSTEVEKNPTGGHGRQRAPMREFFVKFRDLSYWNCEWLTELQLDVHHPILLRNYFKKNDMDEPPAPEDGSTYKGRAREKVADPHNLEERFYKWSVRPEWMQIHRIIDHMTHRNNSIWYLIKWRDLAYDECTWEQLDGEYEVIDMKHLVEEYHIMRKLFTGDIYKKKFKNSSXXXXXXXXXXXXXXPTTDLKKRMSKQPDYIEETGGKLHQYQLEGLNWLRFSFGNVVDTILADEMGLGKTIQTITFLYSLYKEGHSKGPFLVAAPLSTVINWEREFEFWAPDFYVVTYVGDKDSRAVVREHEFSYEEGAMRTSKHACRMRQGTRTKFHVLLTSYELISIDQALLGSISWEVLVVDEAHRLKNNQSKFFRILSSYKINYKLLLTGTPLQNNLEELFHLLHFMTPEKFNDMQGFLDEFADISKEEQVKRLHEILGEHLLRRLKADVLTDMPSKGEFIVRVELSPMQAKFYKYILTRNFDALSVKGGGSQISLINIVMDLKKCCNHPYLFPSGSDEAPKLRNGAYEGLALIKASGKLELLYKMLPKLKTGGHRVLIFSQMTRLLDILEDFMDYMGYKFERIDGAVTGQQRQDSIDRFNAPDSVSFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQSNKVMIYRFVTRNTVEERVTQVAKKKMMLTHLVVRPGLGGKGGASMSKKELDEILKFGTEDLFKEKDENEDDHKIVYDDGAIDRLIDRSQQGIEEKEDMMTDYLSSFKVAHYSKREVSVNXXXXXXXXXETRGEIIKQDLDPADPTYWEKLLRHHYEQDQEDLSKSLGKGKRIRKQVNYSATQQEDDNWNDAVGDSDHESGSINKEEDDEEYDESRGEIIGTRRSKRERDGTKMPPLLVKVNGQLEVLGFNVRQRKAFINAVMRYGLPPMDFINSHWMVRELRCKSDRVMRAYINLFLRHLCEPESDNTDCYSDQVPREGVSRQHVLTRIGIMAVVRKKVQEFEKINGQYSXXXXXXXXXXXXXXXXXXXXXXKLEPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGVEXXXXXXXQDAVMSEADECNKIVINKFMFNIADGGFTELHTIWQNEQRALVEGHEQDIWHRKHDYWLLAGVVAHGYGRWQDIHNDVRFAIVNEPFRNEQQKPNYLEIKNRFLARRFKLLEQALTIEEQLRRAAQLNLTYAPNDQVQNLNRRFTELECLATSQQNVYTEAVQGNKTLVPVLHRVLTQLEDLLSDMKQDXXXXXXXXXXXXXXSQRLNLTQTNLIQKLTVQMQQTKPQPPAICESDLPEIPNNGTSSIDQSINKVLDLKSNEAPVPAVISMVELK 4861
            LVVGSNDTSDEEFERQLQEADIAAAQEEERLRQRKLVTKGKRSHPEDPIVLDQEQEEANKKKTLHHRTTSKYPLMSGYDTDHQDYCEVCQQGGEIMLCDTCPRAFHLVCLDPELEEAPEGSWSCPHCEKEGVVAASRSTTPATGGDMSQNPQNIRKSAQPNEEEKDEHQEFCNECKDGGDLICCAKCPVSYHPECLYPPLSEIPEGPWLCPRCGCGPLKAKVHKILTWRWMEPPKGKDELDHTHKSTEVEKNPTGGHGRQRAPMREFFVKFRDLSYWNCEWLTELQLDVHHPILLRNYFKKNDMDEPPAPEDGSTYKGRAREKVADPHNLEERFYKWSVRPEWMQIHRIIDHMTHRNNSIWYLIKWRDLAYDECTWEQLDGEYEVIDMKHLVEEYHIMRKLFTGDIYKKKFKNSSIPKEIILKKIPPEHPTTDLKKRMSKQPDYIEETGGKLHQYQLEGLNWLRFSFGNVVDTILADEMGLGKTIQTITFLYSLYKEGHSKGPFLVAAPLSTVINWEREFEFWAPDFYVVTYVGDKDSRAVVREHEFSYEEGAMRTSKHACRMRQGTRTKFHVLLTSYELISIDQALLGSISWEVLVVDEAHRLKNNQSKFFRILSSYKINYKLLLTGTPLQNNLEELFHLLHFMTPEKFNDMQGFLDEFADISKEEQVKRLHEILGEHLLRRLKADVLTDMPSKGEFIVRVELSPMQAKFYKYILTRNFDALSVKGGGSQISLINIVMDLKKCCNHPYLFPSGSDEAPKLRNGAYEGLALIKASGKLELLYKMLPKLKTGGHRVLIFSQMTRLLDILEDFMDYMGYKFERIDGAVTGQQRQDSIDRFNAPDSVSFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQSNKVMIYRFVTRNTVEERVTQVAKKKMMLTHLVVRPGLGGKGGASMSKKELDEILKFGTEDLFKEKDENEDDHKIVYDDGAIDRLIDRSQQGIEEKEDMMTDYLSSFKVAHYSKREVSVNEDDEDDDDEETRGEIIKQDLDPADPTYWEKLLRHHYEQDQEDLSKSLGKGKRIRKQVNYSATQQEDDNWNDAVGDSDHESGSINKEEDDEEYDESRGEIIGTRRSKRERDGTKMPPLLVKVNGQLEVLGFNVRQRKAFINAVMRYGLPPMDFINSHWMVRELRCKSDRVMRAYINLFLRHLCEPESDNTDCYSDQVPREGVSRQHVLTRIGIMAVVRKKVQEFEKINGQYSMPEYAPKEEMEEPMKVEMEAEPKLEPTAITTITSIGTVTAIAAATATAEPIITTPIAVAGVEQQQQQQQQDAVMSEADECNKIVINKFMFNIADGGFTELHTIWQNEQRALVEGHEQDIWHRKHDYWLLAGVVAHGYGRWQDIHNDVRFAIVNEPFRNEQQKPNYLEIKNRFLARRFKLLEQALTIEEQLRRAAQLNLTYAPNDQVQNLNRRFTELECLATSQQNVYTEAVQGNKTLVPVLHRVLTQLEDLLSDMKQDVARLPASLARLAPVSQRLNLTQTNLIQKLTVQMQQTKPQPPAICESDLPEIPNNGTSSIDQSINKVLDLKSNEAPVPAVISMVELK
Sbjct:  283 LVVGSNDTSDEEFERQLQEADIAAAQEEERLRQRKLVTKGKRSHPEDPIVLDQEQEEANKKKTLHHRTTSKYPLMSGYDTDHQDYCEVCQQGGEIMLCDTCPRAFHLVCLDPELEEAPEGSWSCPHCEKEGVVAASRSTTPATGGDMSQNPQNIRKSAQPNEEEKDEHQEFCNECKDGGDLICCAKCPVSYHPECLYPPLSEIPEGPWLCPRCGCGPLKAKVHKILTWRWMEPPKGKDELDHTHKSTEVEKNPTGGHGRQRAPMREFFVKFRDLSYWNCEWLTELQLDVHHPILLRNYFKKNDMDEPPAPEDGSTYKGRAREKVADPHNLEERFYKWSVRPEWMQIHRIIDHMTHRNNSIWYLIKWRDLAYDECTWEQLDGEYEVIDMKHLVEEYHIMRKLFTGDIYKKKFKNSSIPKEIILKKIPPEHPTTDLKKRMSKQPDYIEETGGKLHQYQLEGLNWLRFSFGNVVDTILADEMGLGKTIQTITFLYSLYKEGHSKGPFLVAAPLSTVINWEREFEFWAPDFYVVTYVGDKDSRAVVREHEFSYEEGAMRTSKHACRMRQGTRTKFHVLLTSYELISIDQALLGSISWEVLVVDEAHRLKNNQSKFFRILSSYKINYKLLLTGTPLQNNLEELFHLLHFMTPEKFNDMQGFLDEFADISKEEQVKRLHEILGEHLLRRLKADVLTDMPSKGEFIVRVELSPMQAKFYKYILTRNFDALSVKGGGSQISLINIVMDLKKCCNHPYLFPSGSDEAPKLRNGAYEGLALIKASGKLELLYKMLPKLKTGGHRVLIFSQMTRLLDILEDFMDYMGYKFERIDGAVTGQQRQDSIDRFNAPDSVSFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQSNKVMIYRFVTRNTVEERVTQVAKKKMMLTHLVVRPGLGGKGGASMSKKELDEILKFGTEDLFKEKDENEDDHKIVYDDGAIDRLIDRSQQGIEEKEDMMTDYLSSFKVAHYSKREVSVNEDDEDDDDEETRGEIIKQDLDPADPTYWEKLLRHHYEQDQEDLSKSLGKGKRIRKQVNYSATQQEDDNWNDAVGDSDHESGSINKEEDDEEYDESRGEIIGTRRSKRERDGTKMPPLLVKVNGQLEVLGFNVRQRKAFINAVMRYGLPPMDFINSHWMVRELRCKSDRVMRAYINLFLRHLCEPESDNTDCYSDQVPREGVSRQHVLTRIGIMAVVRKKVQEFEKINGQYSMPEYAPKEEMEEPMKVEMEAEPKLEPTAITTITSIGTVTAIAAATATAEPIITTPIAVAGVEQQQQQQQQDAVMSEADECNKIVINKFMFNIADGGFTELHTIWQNEQRALVEGHEQDIWHRKHDYWLLAGVVAHGYGRWQDIHNDVRFAIVNEPFRNEQQKPNYLEIKNRFLARRFKLLEQALTIEEQLRRAAQLNLTYAPNDQVQNLNRRFTELECLATSQQNVYTEAVQGNKTLVPVLHRVLTQLEDLLSDMKQDVARLPASLARLAPVSQRLNLTQTNLIQKLTVQMQQTKPQPPAICESDLPEIPNNGTSSIDQSINKVLDLKSNEAPVPAVISMVELK 1868          

HSP 2 Score: 330.102 bits (845), Expect = 4.771e-87
Identity = 249/251 (99.20%), Postives = 250/251 (99.60%), Query Frame = -3
Query: 4956 MDDIYDVSNGSEINEEFXXXXXXXXXXXXXXXXXXXXXXXKRGRVKRKKESDDEFITEPPSKRRSSRAIKHKEKTVEGLCEEMGIANVEVSYRMDDFENWTIQRLFDQYMRPKLEEKNPHATSDDIQRVLDAKWKEFALLNPYIPKXXXXXXXXXXXXXXDAESDSIEKMITAEIXXXXXXXXXXXXXXXXXXXXXXXXXXXSKPGKGKEKVEVDISMEVSAGEDEIPTVDIPIESDQEPVASPSSSSNLI 5708
            MDDIYDVSNGSEINEEFDDISIDVKKSKKRKSKSD KESKKRGRVKRKKESDDEFITEPPSKRRSSRA+KHKEKTVEGLCEEMGIANVEVSYRMDDFENWTIQRLFDQYMRPKLEEKNPHATSDDIQRVLDAKWKEFALLNPYIPKTEDENDENGEETLEDAESDSIEKMITAEISKKARGGKSRGRGRGRGRRTTVTPRGRSKPGKGKEKVEVDISMEVSAGEDEIPTVDIPIESDQEPVASPSSSSNLI
Sbjct:    1 MDDIYDVSNGSEINEEFDDISIDVKKSKKRKSKSDXKESKKRGRVKRKKESDDEFITEPPSKRRSSRAVKHKEKTVEGLCEEMGIANVEVSYRMDDFENWTIQRLFDQYMRPKLEEKNPHATSDDIQRVLDAKWKEFALLNPYIPKTEDENDENGEETLEDAESDSIEKMITAEISKKARGGKSRGRGRGRGRRTTVTPRGRSKPGKGKEKVEVDISMEVSAGEDEIPTVDIPIESDQEPVASPSSSSNLI 251          
BLAST of chromodomain helicase DNA-binding protein 4 vs. TrEMBL
Match: A0A087W0W9 (Chromodomain helicase DNA binding protein 4 OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000199100 PE=4 SV=1)

HSP 1 Score: 1645.17 bits (4259), Expect = 0.000e+0
Identity = 861/1343 (64.11%), Postives = 1009/1343 (75.13%), Query Frame = -1
Query: 1136 VVGSNDTSDEEFERXXXXXXXXXXXXXERLRQRKLVTKGKRSHPEDPI---------VLDQEQEEANKKKTLHHRTTSKYPLMSG-------YDTDHQDYCEVCQQGGEIMLCDTCPRAFHLVCLDPELEEAPEGSWSCPHCEKEGVVAASRSTT-PATGGD-----MSQNPQNI-RKSAQPN----EEEKDEHQEFCNECKDGGDLICCAKCPVSYHPECLYPPLSEIPEGPWLCPRCGCGPLKAKVHKILTWRWMEPPKG--------------KDELDHTHKST----------EVEK-NPTGGHG-------RQRAPMREFFVKFRDLSYWNCEWLTELQLDVHHPILLRNYFKKNDMDEPPAPEDGSTYKGRAREKVADPHNLEERFYKWSVRPEWMQIHRIIDHMTHRNNSIWYLIKWRDLAYDECTWEQLDGEYEVIDMKHLVEEYHIMRKLFTGDIY-----KKK---------------FKNSSXXXXXXXXXXXXXXPTTDLKKRMSKQPDYIEETGGKLHQYQLEGLNWLRFSFGNVVDTILADEMGLGKTIQTITFLYSLYKEGHSKGPFLVAAPLSTVINWEREFEFWAPDFYVVTYVGDKDSRAVVREHEFSYEEGAMRTSKHACRMRQGTRTKFHVLLTSYELISIDQALLGSISWEVLVVDEAHRLKNNQSKFFRILSSYKINYKLLLTGTPLQNNLEELFHLLHFMTPEKFNDMQGFLDEFADISKEEQVKRLHEILGEHLLRRLKADVLTDMPSKGEFIVRVELSPMQAKFYKYILTRNFDALSVKGGGSQISLINIVMDLKKCCNHPYLFPSGSDEAPKLRNGAYEGLALIKASGKLELLYKMLPKLKTGGHRVLIFSQMTRLLDILEDFMDYMGYKFERIDGAVTGQQRQDSIDRFNAPDSVSFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQSNKVMIYRFVTRNTVEERVTQVAKKKMMLTHLVVRPGLGGKGGASMSKKELDEILKFGTEDLFKEKDENE-DDHKIVYDDGAIDRLIDRSQQGIEEKEDMMTDYLSSFKVAHYSKREVSVNXXXXXXXXXETRGEIIKQDLDPADPTYWEKLLRHHYEQDQEDLSKSLGKGKRIRKQVNYSATQQED-DNWNDAVGDSDHESGSINKEEDDEEYDE---SRGEIIGTR--RSKRERDGTKMPPLLVKVNGQLEVLGFNVRQRKAFINAVMRYGLPP-------------MDFINSHWMVRELRCKSDRVMRAYINLFLRHLCEPES---DNTDCYSDQVPREGVSRQHVLTRIGIMAVVRKKVQEFEKINGQYS 4858
            +VG N TSDEEFERQL+EA+    +E++R +Q++ +   + +               V       A     +     ++ PLM G       Y+TDHQDYC+VCQQGG IMLCDTCPRA+HLVCLDPELEE PEG WSCPHCEK+G+  A RST  PA  GD      S+ P ++ RK+A       E E+DEHQE+C+EC+DGGDLICC  CP SYH  CL PPLS+IPEG WLCPRCGC PLKA+V KIL WRW EPPK               ++E+D T   T          EVE+ +  G H         +R P REFFVKF ++SYW CEW+TELQL+V H ++LR + KK DM+EPP PEDGS+Y+GRAREK  DP NLEERFYKW VRPEW+Q  RIID    R    W+L+KWRDL YDECTWE +    EV + +  VEE+ +MR LF G+       KKK                   +     +LKKIPPE P TDL+K+++KQP+Y++ETGG+LH YQLEGLNWLRFS+GN VDTILADEMGLGKTIQTI FLYSLYK+GHS+GPFLVAAPLST+INWEREFE WAPDFYVVTYVGDKDSR V+REHEF++EEG +R      +MR G + +FHVLLTSYELISIDQALL SI WEVLVVDEAHRLKNNQSKFFR+LS+YKI YKLLLTGTPLQNNLEELFHLLHFM+P KF DMQGFLDEFADISKE+QVK+LHE+LG+HLLRRLKADVL +MPSKGEFIVRVELSPMQ KFYK+ILT+NFDALS + GG+Q SLIN++MDLKKCCNHPYLFPS +++AP+L NGA+EGLAL KA GKLELL  ML KLK GGHRVLIFSQMT++LD+LEDF++  GYKFERIDG VTGQQRQD+IDRFNA DS SFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQ+NKVMIYRFVTR TVEERVTQVAKKKMMLTHLVVRPGLGGKG + MSKKELD+ILKFGTEDLFK +D +  D+H IVYDD A+DRL+DRSQQG+EEK+  M DYLSSFKVAHY KRE+  + D E+  DE++  E+IKQ+ D  DP YWEKLLRHH+EQ QED +K LGKGKR RK VNY A QQED + WND    SDH+S    K+EDD+EYDE     GE +G++  R  R     KMPPLL +VNGQ+EVLGFN+RQR+AF+N+V+RYGLPP                 ++ W  R+L+ K +RV RAY+ LF+RHLCEPES   +N   YSD  PR+G+S Q +L+RIGIMA+VRKKVQEFE+ING YS
Sbjct:  290 LVGDN-TSDEEFERQLEEAEAFQEEEQKRRKQQRSLNARRAAAAARVSATAATGQMHVSTSAPNLAASSSGVKRSIITRVPLMGGNRQAEDGYETDHQDYCDVCQQGGNIMLCDTCPRAYHLVCLDPELEEVPEGVWSCPHCEKQGITVAHRSTADPAAAGDEGASTASEGPVHVSRKAATAGGVEEEGERDEHQEYCSECRDGGDLICCENCPASYHLGCLDPPLSQIPEGVWLCPRCGCKPLKARVSKILFWRWREPPKTAISVMEDVEKIEVDREEMDGTVPPTPATALDPQIGEVEQASCVGPHAVTAPHPPARRKPTREFFVKFHEMSYWACEWVTELQLEVFHSLMLRVFSKKYDMEEPPLPEDGSSYRGRAREKAPDPQNLEERFYKWGVRPEWLQPQRIIDSRVTRQKE-WFLVKWRDLPYDECTWEDV-AITEVPEFERFVEEFRLMRGLFKGETSSVTTGKKKGSSSSTATATAAAIASAKKTSISASLLKKIPPEKPITDLRKQLTKQPEYMDETGGELHPYQLEGLNWLRFSYGNKVDTILADEMGLGKTIQTIAFLYSLYKDGHSRGPFLVAAPLSTIINWEREFELWAPDFYVVTYVGDKDSRTVIREHEFTFEEGGVRGGSRVVKMRSGAQVRFHVLLTSYELISIDQALLSSIDWEVLVVDEAHRLKNNQSKFFRMLSTYKIAYKLLLTGTPLQNNLEELFHLLHFMSPAKFYDMQGFLDEFADISKEDQVKKLHEMLGKHLLRRLKADVLKNMPSKGEFIVRVELSPMQKKFYKFILTKNFDALSCRSGGAQPSLINVMMDLKKCCNHPYLFPSAAEDAPRLPNGAFEGLALRKACGKLELLSAMLQKLKAGGHRVLIFSQMTKMLDLLEDFLEAEGYKFERIDGNVTGQQRQDAIDRFNAIDSTSFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQANKVMIYRFVTRATVEERVTQVAKKKMMLTHLVVRPGLGGKGASQMSKKELDDILKFGTEDLFKHEDNDATDEHCIVYDDAALDRLLDRSQQGMEEKQMEMNDYLSSFKVAHYEKREIQ-DGDSEEPGDEDSNVEVIKQESDTNDPAYWEKLLRHHFEQAQEDQAKLLGKGKRHRKPVNYWANQQEDEEEWNDNA--SDHDSNFSTKDEDDDEYDEKAGGSGEGMGSQIGRRVRREREGKMPPLLSRVNGQIEVLGFNIRQRRAFVNSVLRYGLPPPPSSFSVAGVPVASATASTAWHSRDLKGKPERVFRAYVALFMRHLCEPESMNQENNATYSDGTPRDGISHQPILSRIGIMALVRKKVQEFEQINGLYS 1626          

HSP 2 Score: 290.426 bits (742), Expect = 8.521e-75
Identity = 147/204 (72.06%), Postives = 167/204 (81.86%), Query Frame = -1
Query:  272 NKFMFNIADGGFTELHTIWQNEQRALVEGHEQ-DIWHRKHDYWLLAGVVAHGYGRWQDIHNDVRFAIVNEPFRNEQQKPNYLEIKNRFLARRFKLLEQALTIEEQLRRAAQLNLTYAPNDQVQNLNRRFTELECLATSQQNVYTEAVQGNKTLVPVLHRVLTQLEDLLSDMKQDXXXXXXXXXXXXXXSQRLNLTQTNLIQKLT 880
            + FMFNIADGGFTELHTIW NEQRAL E  E  +IWHRKHDYWLLAGVV HGYGRWQDIHND RFA+VNEPFR +Q KPNYLE+KNRFLARRFKLLEQAL IEEQLRRAA  N+   P D VQ+LNRRF ELECLA +QQ VY EA+ GNK+LV ++HR LT +ED L++MKQDV+RL   + R+ PVS RLNL+ T L+ KLT
Sbjct: 1799 SSFMFNIADGGFTELHTIWLNEQRALEENTEGYEIWHRKHDYWLLAGVVQHGYGRWQDIHNDPRFALVNEPFRADQGKPNYLEMKNRFLARRFKLLEQALIIEEQLRRAAHQNIVCDPKDTVQSLNRRFNELECLAVAQQQVYAEALAGNKSLVQLIHRALTMMEDYLAEMKQDVSRLLTLVPRMPPVSDRLNLSHTGLLTKLT 2002          

HSP 3 Score: 123.25 bits (308), Expect = 7.186e-24
Identity = 52/86 (60.47%), Postives = 73/86 (84.88%), Query Frame = -3
Query: 5271 SKRRSSRAIKHKEKTVEGLCEEMGIANVEVSYRMDDFENWTIQRLFDQYMRPKLEEKNPHATSDDIQRVLDAKWKEFALLNPYIPK 5528
            +KRR++RA+K  EKT+E LCEE+G+ +VE++Y  DDFENWT+Q+LF+QY++P + EKNPH   + I ++LDAKWKEFA++NPYIPK
Sbjct:   47 TKRRTARAVK--EKTLEQLCEELGVEDVELTYSTDDFENWTVQKLFNQYVQPLIVEKNPHVPKEHIVQILDAKWKEFAIMNPYIPK 130          
BLAST of chromodomain helicase DNA-binding protein 4 vs. TrEMBL
Match: W6UI63 (Chromodomain-helicase-DNA-binding protein OS=Echinococcus granulosus OX=6210 GN=EGR_04023 PE=4 SV=1)

HSP 1 Score: 1632.08 bits (4225), Expect = 0.000e+0
Identity = 858/1351 (63.51%), Postives = 1005/1351 (74.39%), Query Frame = -1
Query: 1136 VVGSNDTSDEEFERXXXXXXXXXXXXXERLRQRKLVTKGKRSHPEDPI---------VLDQEQEEANKKKTLHHRTTSKYPLMSG-------YDTDHQDYCEVCQQGGEIMLCDTCPRAFHLVCLDPELEEAPEGSWSCPHCEKEGVVAASRSTT-PATGGD-----MSQNPQNI-RKSAQPN----EEEKDEHQEFCNECKDGGDLICCAKCPVSYHPECLYPPLSEIPEGPWLCPRCGCGPLKAKVHKILTWRWMEPPKG--------------KDELDHTHKSTEVEK-NPTGGHGRQ-----------------RAPMREFFVKFRDLSYWNCEWLTELQLDVHHPILLRNYFKKNDMDEPPAPEDGSTYKGRAREKVADPHNLEERFYKWSVRPEWMQIHRIIDHMTHRNNSIWYLIKWRDLAYDECTWEQLDGEYEVIDMKHLVEEYHIMRKLFTGDIY-----KKK---------------FKNSSXXXXXXXXXXXXXXPTTDLKKRMSKQPDYIEETGGKLHQYQLEGLNWLRFSFGNVVDTILADEMGLGKTIQTITFLYSLYKEGHSKGPFLVAAPLSTVINWEREFEFWAPDFYVVTYVGDKDSRAVVREHEFSYEEGAMRTSKHACRMRQGTRTKFHVLLTSYELISIDQALLGSISWEVLVVDEAHRLKNNQSKFFRILSSYKINYKLLLTGTPLQNNLEELFHLLHFMTPEKFNDMQGFLDEFADISKEEQVKRLHEILGEHLLRRLKADVLTDMPSKGEFIVRVELSPMQAKFYKYILTRNFDALSVKGGGSQISLINIVMDLKKCCNHPYLFPSGSDEAPKLRNGAYEGLALIKASGKLELLYKMLPKLKTGGHRVLIFSQMTRLLDILEDFMDYMGYKFERIDGAVTGQQRQDSIDRFNAPDSVSFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQSNK--------VMIYRFVTRNTVEERVTQVAKKKMMLTHLVVRPGLGGKGGASMSKKELDEILKFGTEDLFKEKDENE-DDHKIVYDDGAIDRLIDRSQQGIEEKEDMMTDYLSSFKVAHYSKREVSVNXXXXXXXXXETRGEIIKQDLDPADPTYWEKLLRHHYEQDQEDLSKSLGKGKRIRKQVNYSATQQED-DNWNDAVGDSDHESGSINKEEDDEEYDE---SRGEIIGTR--RSKRERDGTKMPPLLVKVNGQLEVLGFNVRQRKAFINAVMRYGLPP-------------MDFINSHWMVRELRCKSDRVMRAYINLFLRHLCEPES---DNTDCYSDQVPREGVSRQHVLTRIGIMAVVRKKVQEFEKINGQYS 4858
            +VG N TSDEEFERQL+EA+    +E++R +Q++ +   + +               V       A     +     ++ PLM G       Y+TDHQDYC+VCQQGG IMLCDTCPRA+HLVCLDPELEE PEG WSCPHCEK+G+  A RST  PA  GD      S+ P ++ RK+A       E E+DEHQE+C+EC+DGGDLICC  CP SYH  CL PPLS+IPEG WLCPRCGC PLKA+V KIL WRW EPPK               ++ +D T   T+    +P  G   Q                 R P REFFVKF ++SYW CEW+TELQL+V H ++LR + KK DM+EPP PEDGS+Y+GRAREK  DP NLEERFYKW VRPEW+Q  RIID    R    W+L+KWRDL YDECTWE +    EV + +  VEE+ +MR LF G+       KKK                   +     +LKKIPPE P TDL+K+++KQP+Y++ETGG+LH YQLEGLNWLRFS+GN VDTILADEMGLGKTIQTI FLYSLYK+GHS+GPFLVAAPLST+INWEREFE WAPDFYVVTYVGDKDSR V+REHEF++EEG +R      +MR G + +FHVLLTSYELISIDQALL SI WEVLVVDEAHRLKNNQSKFFR+LS+YKI YKLLLTGTPLQNNLEELFHLLHFM+P KF DMQGFLDEFADISKE+QVK+LHE+LG+HLLRRLKADVL +MPSKGEFIVRVELSPMQ KFYK+ILT+NFDALS + GG+Q SLIN++MDLKKCCNHPYLFPS +++AP+L NGA+EGLAL KA GKLELL  ML KLK GGHRVLIFSQMT++LD+LEDF++  GYKFERIDG VTGQQRQD+IDRFNA DS SFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQ+NK        VMIYRFVTR TVEERVTQVAKKKMMLTHLVVRPGLGGKG + MSKKELD+ILKFGTEDLFK +D +  D+H IVYDD A+DRL+DRSQQG+EEK+  M DYLSSFKVAHY KRE+  + D E+  DE++  E+IKQ+ D  DP YWEKLLRHH+EQ QED +K LGKGKR RK VNY A QQED + WND    SDH+S    K+EDD+EYDE     GE +G++  R  R     KMPPLL +VNGQ+EVLGFN+RQR+AF+N+V+RYGLPP                 ++ W  R+L+ K +RV RAY+ LF+RHLCEPES   +N   YSD  PR+G+S Q +L+RIGIMA+VRKKVQEFE+ING YS
Sbjct:  795 LVGDN-TSDEEFERQLEEAEAFQEEEQKRRKQQRSLNARRAAAAARVSATAATGQMHVSASAPNLAASASGVKRSIIARVPLMGGNRQAEDGYETDHQDYCDVCQQGGNIMLCDTCPRAYHLVCLDPELEEVPEGVWSCPHCEKQGITVAHRSTADPAAAGDEDASTASEGPVHVSRKAATAGGAEEEGERDEHQEYCSECRDGGDLICCENCPASYHLGCLDPPLSQIPEGVWLCPRCGCKPLKARVSKILFWRWREPPKTAISVMEDVEKIEVDREGMDGTVPPTQATALDPQTGEVEQVSCVGALAVTAPHPPARRKPTREFFVKFHEMSYWACEWVTELQLEVFHSLMLRVFSKKYDMEEPPLPEDGSSYRGRAREKAPDPQNLEERFYKWGVRPEWLQPQRIIDSRMTRQKE-WFLVKWRDLPYDECTWEDV-ATTEVPEFERFVEEFRLMRGLFKGETSFVTTGKKKGSSSSTATATAAAIASAKKTSISASLLKKIPPEKPITDLRKQLTKQPEYMDETGGELHPYQLEGLNWLRFSYGNKVDTILADEMGLGKTIQTIAFLYSLYKDGHSRGPFLVAAPLSTIINWEREFELWAPDFYVVTYVGDKDSRTVIREHEFTFEEGGVRGGSRVVKMRSGAQVRFHVLLTSYELISIDQALLSSIDWEVLVVDEAHRLKNNQSKFFRMLSTYKIAYKLLLTGTPLQNNLEELFHLLHFMSPAKFYDMQGFLDEFADISKEDQVKKLHEMLGKHLLRRLKADVLKNMPSKGEFIVRVELSPMQKKFYKFILTKNFDALSCRSGGAQPSLINVMMDLKKCCNHPYLFPSAAEDAPRLPNGAFEGLALRKACGKLELLSAMLQKLKAGGHRVLIFSQMTKMLDLLEDFLEAEGYKFERIDGNVTGQQRQDAIDRFNAIDSTSFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQANKAIWIEVAEVMIYRFVTRATVEERVTQVAKKKMMLTHLVVRPGLGGKGASQMSKKELDDILKFGTEDLFKHEDNDATDEHCIVYDDAALDRLLDRSQQGMEEKQMEMNDYLSSFKVAHYEKREIQ-DGDSEEPGDEDSNVEVIKQESDTNDPAYWEKLLRHHFEQAQEDQAKLLGKGKRHRKPVNYWANQQEDEEEWND--NTSDHDSNFSTKDEDDDEYDEKAGGNGEGMGSQIGRRVRREREGKMPPLLSRVNGQIEVLGFNIRQRRAFVNSVLRYGLPPPPSSFSMAGVPVASATASTAWHSRDLKGKPERVFRAYVALFMRHLCEPESMNQENNATYSDGTPRDGISHQPILSRIGIMALVRKKVQEFEQINGLYS 2139          

HSP 2 Score: 290.041 bits (741), Expect = 1.824e-74
Identity = 147/204 (72.06%), Postives = 167/204 (81.86%), Query Frame = -1
Query:  272 NKFMFNIADGGFTELHTIWQNEQRALVEGHEQ-DIWHRKHDYWLLAGVVAHGYGRWQDIHNDVRFAIVNEPFRNEQQKPNYLEIKNRFLARRFKLLEQALTIEEQLRRAAQLNLTYAPNDQVQNLNRRFTELECLATSQQNVYTEAVQGNKTLVPVLHRVLTQLEDLLSDMKQDXXXXXXXXXXXXXXSQRLNLTQTNLIQKLT 880
            + FMFNIADGGFTELHTIW NEQRAL E  E  +IWHRKHDYWLLAGVV HGYGRWQDIHND RFA+VNEPFR +Q KPNYLE+KNRFLARRFKLLEQAL IEEQLRRAA  N+   P D VQ+LNRRF ELECLA +QQ VY EA+ GNK+LV ++HR LT +ED L++MKQDV+RL   + R+ PVS RLNL+ T L+ KLT
Sbjct: 2312 SSFMFNIADGGFTELHTIWLNEQRALEENTEGYEIWHRKHDYWLLAGVVQHGYGRWQDIHNDPRFALVNEPFRADQGKPNYLEMKNRFLARRFKLLEQALIIEEQLRRAAHQNIVCDPKDTVQSLNRRFNELECLAVAQQQVYAEALAGNKSLVQLIHRALTMMEDYLAEMKQDVSRLLTLVPRMPPVSDRLNLSHTGLLTKLT 2515          

HSP 3 Score: 121.324 bits (303), Expect = 2.845e-23
Identity = 51/86 (59.30%), Postives = 72/86 (83.72%), Query Frame = -3
Query: 5271 SKRRSSRAIKHKEKTVEGLCEEMGIANVEVSYRMDDFENWTIQRLFDQYMRPKLEEKNPHATSDDIQRVLDAKWKEFALLNPYIPK 5528
            +KRR++R +K  EKT+E LCEE+G+ +VE++Y  DDFENWT+Q+LF+QY++P + EKNPH   + I ++LDAKWKEFA++NPYIPK
Sbjct:  568 TKRRTARVVK--EKTLEQLCEELGVEDVELTYSTDDFENWTVQKLFNQYVQPLIVEKNPHVPKEHIVQILDAKWKEFAIMNPYIPK 651          
BLAST of chromodomain helicase DNA-binding protein 4 vs. TrEMBL
Match: A0A564YNJ9 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS8193 PE=4 SV=1)

HSP 1 Score: 1609.35 bits (4166), Expect = 0.000e+0
Identity = 835/1315 (63.50%), Postives = 992/1315 (75.44%), Query Frame = -1
Query: 1136 RGRKKDRLVVGSNDTSDEEFERXXXXXXXXXXXXXERLRQ-----RKLVTKGKRSHPEDPIVLDQEQE-EANKKKTLHHRTTSKYPLMSG-------YDTDHQDYCEVCQQGGEIMLCDTCPRAFHLVCLDPELEEAPEGSWSCPHCEKEGVVAASRSTTPATGGDM----SQNPQNI-RKSAQPNEE-EKDEHQEFCNECKDGGDLICCAKCPVSYHPECLYPPLSEIPEGPWLCPRCGCGPLKAKVHKILTWRW----MEPPKGKDELDHTHKSTEVEK-------------NPTGGHGRQRAPMREFFVKFRDLSYWNCEWLTELQLDVHHPILLRNYFKKNDMDEPPAPEDGSTYKGRAREKVADPHNLEERFYKWSVRPEWMQIHRIIDHMTHRNNSIWYLIKWRDLAYDECTWEQLDGEYEVIDMKHLVEEYHIMRKLFTGDIY-----KKKFKNS--------------SXXXXXXXXXXXXXXPTTDLKKRMSKQPDYIEETGGKLHQYQLEGLNWLRFSFGNVVDTILADEMGLGKTIQTITFLYSLYKEGHSKGPFLVAAPLSTVINWEREFEFWAPDFYVVTYVGDKDSRAVVREHEFSYEEGAMRTSKHACRMRQGTRTKFHVLLTSYELISIDQALLGSISWEVLVVDEAHRLKNNQSKFFRILSSYKINYKLLLTGTPLQNNLEELFHLLHFMTPEKFNDMQGFLDEFADISKEEQVKRLHEILGEHLLRRLKADVLTDMPSKGEFIVRVELSPMQAKFYKYILTRNFDALSVKGGGSQISLINIVMDLKKCCNHPYLFPSGSDEAPKLRNGAYEGLALIKASGKLELLYKMLPKLKTGGHRVLIFSQMTRLLDILEDFMDYMGYKFERIDGAVTGQQRQDSIDRFNAPDSVSFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQSNKVMIYRFVTRNTVEERVTQVAKKKMMLTHLVVRPGLGGKGGASMSKKELDEILKFGTEDLFKEKDEN-EDDHKIVYDDGAIDRLIDRSQQGIEEKEDMMTDYLSSFKVAHYSKREVSVNXXXXXXXXXETRGEIIKQDLDPADPTYWEKLLRHHYEQDQEDLSKSLGKGKRIRKQVNYSATQQ-EDDNWNDAVGDSDHESGSINKEEDDEEYDESRG-EIIGTRRSKRERDGTKMPPLLVKVNGQLEVLGFNVRQRKAFINAVMRYGLPP-----MDFINSHWMVRELRCKSDRVMRAYINLFLRHLCEPES---DNTDCYSDQVPREGVSRQHVLTRIGIMAVVRKKVQEFEKINGQYS 4882
            RG ++D    G  DTSDEEFERQLQEA+    +E++R RQ     R+  TK   S  E   +              +     ++ PLM G       Y+TDHQD+C+VCQQGGEI+LCDTCPRAFHLVCLDPEL+E P+G WSCP C K+G+ AA+  T      D+    S+ P ++ RK     EE E+DEHQEFC  C+DGG+LICC +CP SYH +CL PPL +IPE PWLCPRCGC   K KV KIL WRW    ++PP+ ++ +  + +  +VE+              P     RQ    RE+FVKF ++SYW CEW TELQ+DV+H ++LR YFKK DMDEPP PEDG++Y+GRAR+K +D  NLEERFYKW VRPEW+Q  RIID  T R    W+L+KWRDL Y ECTWE      EV D +H V+E+ +MR LF G+       KKK K S              S     +LKKIPPE PTTDL+K++ KQP+Y++ETG  LH YQLEGLNWLRFS+GN VDTILADEMGLGKTIQTI FLYSLYK+GHS+GPFLVAAPLST+INWEREF+ WAPDFYVV YVGDK+SR V+REHEF++EEG +R    A RMR G + +FHVLLTSYE+ISIDQALL SI WEVLVVDEAHRLKNNQSKFFR+L++YKI YKLLLTGTPLQNNLEELFHLLHFM+P KFNDMQGFLDEFADISKE+QVK+LHE+LG+HLLRRLKADVL +MPSKGEFIVRVELSP+Q KFYK+ILT+NFDALS +GGG+Q SLIN++MDLKKCCNHPYLF + S++AP+L NGA+E  AL KA GKLELL  ML KLK GGHRVLIFSQMT++LD+LEDFM+  GYK+ERIDG VTGQ RQD+IDRFNA DS SFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQ+NKVMIYRFVTR TVEERVTQVAKKKMMLTHLVVRPGLGGKGG+ MSKKELD+ILKFGTEDLFK +D +  D+H IVYDD A+DRL+DRSQQG+EEK+  M DYLSSFKVAHY KRE+  + D +  D+++   E+IKQ+LD  DP YWEKLLRHH+EQ QED +K LGKGKR RK VNY   QQ E+D+WND    SDH+S    ++E+D+EYD+  G +     R  R     KMPP+L +VNGQ+EVLGFN RQRKAF+N+V+R+GLPP        + + W  R+LR K ++V RAY+  FLRHLCEP+S   DN   Y D  PR+G+  Q +LTRIGIM++VRKKVQEFE++NG YS
Sbjct:  231 RGSRRDGSRAGGGDTSDEEFERQLQEAEALQEEEQKRRRQQRMNSRRAATKAGASGGESSSIHISASAPNLVHGGGIKRSVIARVPLMGGNRQVEDGYETDHQDFCDVCQQGGEIVLCDTCPRAFHLVCLDPELDEPPKGDWSCPQCVKQGITAAAHRTIGGDADDLASTASEGPVHVTRKPDIEGEEFERDEHQEFCTVCRDGGELICCERCPASYHIQCLDPPLPKIPEDPWLCPRCGCKKPKGKVAKILFWRWKDPTVKPPEQEEAIVISEEGDKVEEREGGEKSTVVVHSQPAAASQRQAKRTREYFVKFAEMSYWACEWTTELQMDVYHNLMLRLYFKKFDMDEPPQPEDGTSYRGRARQKNSDVLNLEERFYKWGVRPEWLQPQRIIDSRTTRGKE-WFLVKWRDLPYVECTWED-PTNTEVPDFEHYVDEFRLMRGLFKGEAVTSTSSKKKGKESAQSSSSSGMSAAKRSSFNANLLKKIPPEKPTTDLRKQLPKQPEYLDETGLMLHPYQLEGLNWLRFSYGNKVDTILADEMGLGKTIQTIAFLYSLYKDGHSRGPFLVAAPLSTIINWEREFQLWAPDFYVVAYVGDKESRTVIREHEFTFEEGGVRGGSRAVRMRSGAQVRFHVLLTSYEMISIDQALLSSIDWEVLVVDEAHRLKNNQSKFFRMLTTYKIAYKLLLTGTPLQNNLEELFHLLHFMSPAKFNDMQGFLDEFADISKEDQVKKLHEMLGKHLLRRLKADVLKNMPSKGEFIVRVELSPLQKKFYKFILTKNFDALSCRGGGAQPSLINVMMDLKKCCNHPYLFSAASEDAPRLPNGAFESSALRKACGKLELLSAMLKKLKAGGHRVLIFSQMTKMLDLLEDFMEGEGYKYERIDGNVTGQLRQDAIDRFNASDSTSFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQANKVMIYRFVTRATVEERVTQVAKKKMMLTHLVVRPGLGGKGGSQMSKKELDDILKFGTEDLFKHEDNDASDEHCIVYDDAALDRLLDRSQQGMEEKQMEMNDYLSSFKVAHYEKREIQ-DGDSDAGDEDDPNVEVIKQELDTNDPAYWEKLLRHHFEQAQEDQAKMLGKGKRHRKPVNYWTNQQEEEDDWND--NGSDHDSNFSTRDEEDDEYDDKIGADGSQIGRRLRREREGKMPPILSRVNGQIEVLGFNFRQRKAFVNSVLRFGLPPPPGASKTGLGAAWHSRDLRGKPEKVFRAYVAHFLRHLCEPDSMNQDNNPNYPDGTPRDGILHQPILTRIGIMSLVRKKVQEFEQVNGLYS 1540          

HSP 2 Score: 273.863 bits (699), Expect = 1.006e-69
Identity = 138/210 (65.71%), Postives = 165/210 (78.57%), Query Frame = -1
Query:  251 KFMFNIADGGFTELHTIWQNEQRALVEGHEQ-DIWHRKHDYWLLAGVVAHGYGRWQDIHNDVRFAIVNEPFRNEQQKPNYLEIKNRFLARRFKLLEQALTIEEQLRRAAQLNLTYAPNDQVQNLNRRFTELECLATSQQNVYTEAVQGNKTLVPVLHRVLTQLEDLLSDMKQDXXXXXXXXXXXXXXSQRLNLTQTNLIQKLTVQMQQTK 877
            +FMFNIADGGFT+LHTIW NE+RAL+E     +IW+RKHDYWLLAGV  HGY RWQDIHND RFA+VNEPF  +Q KPNYLE+KNRFLARRFKLLEQAL IEEQLRRAA  N+   P D VQ+LNRRF ELECLA +QQ V+ EA+ GN++ + ++HR LT +ED L++MKQDV RL   + R+ PVS+RLNL+   LI KLT Q+   K
Sbjct: 1682 RFMFNIADGGFTDLHTIWLNEERALMENRGGVEIWNRKHDYWLLAGVCQHGYSRWQDIHNDPRFALVNEPFSIDQGKPNYLEMKNRFLARRFKLLEQALIIEEQLRRAAHQNIVCDPKDAVQSLNRRFNELECLAFAQQKVFAEALSGNRSQIQLIHRALTMMEDYLAEMKQDVTRLLTIVPRMQPVSERLNLSHAGLITKLTQQLTAAK 1891          

HSP 3 Score: 120.939 bits (302), Expect = 3.622e-23
Identity = 58/101 (57.43%), Postives = 75/101 (74.26%), Query Frame = -3
Query: 5271 KRKKESDDEFITEPPSKRRSSRAIKHKEKTVEGLCEEMGIANVEVSYRMDDFENWTIQRLFDQYMRPKLEEKNPHATSDDIQRVLDAKWKEFALLNPYIPK 5573
            +R  E DD   + P  KRR SR +K  EKT+E LCEE  I +VE++Y  DDFENWT+Q+LF+QY+ P + EKNP+A  D I ++LDAKWKEFA++NPYIPK
Sbjct:    3 RRNAEGDDSSSSAP--KRRGSRNVK--EKTLEQLCEEFRIEDVEITYSTDDFENWTVQKLFNQYVEPLIVEKNPNAPKDHIVQILDAKWKEFAIMNPYIPK 99          
BLAST of chromodomain helicase DNA-binding protein 4 vs. TrEMBL
Match: A0A3P7WDC4 (Uncharacterized protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS11940 PE=4 SV=1)

HSP 1 Score: 1595.48 bits (4130), Expect = 0.000e+0
Identity = 819/1309 (62.57%), Postives = 978/1309 (74.71%), Query Frame = -1
Query: 1136 VGSNDTSDEEFERXXXXXXXXXXXXXERLRQRKLVTK------GKRSHPEDPIVLDQEQEEANKKKTLHHRTTSKYPLMSG-------YDTDHQDYCEVCQQGGEIMLCDTCPRAFHLVCLDPELEEAPEGSWSCPHCEKEGVVAASRSTTPATGGDM----SQNPQNI-RKSAQPNEE-EKDEHQEFCNECKDGGDLICCAKCPVSYHPECLYPPLSEIPEGPWLCPRCGCGPLKAKVHKILTWRWMEPP-------------KGKDELDHTH-----KSTEVEKNPTGGHGRQRAP--MREFFVKFRDLSYWNCEWLTELQLDVHHPILLRNYFKKNDMDEPPAPEDGSTYKGRAREKVADPHNLEERFYKWSVRPEWMQIHRIIDHMTHRNNSIWYLIKWRDLAYDECTWEQLDGEYEVIDMKHLVEEYHIMRKLFTGDIY-----KKKFKNSSXXXXXXXXXXXXXXP--------------TTDLKKRMSKQPDYIEETGGKLHQYQLEGLNWLRFSFGNVVDTILADEMGLGKTIQTITFLYSLYKEGHSKGPFLVAAPLSTVINWEREFEFWAPDFYVVTYVGDKDSRAVVREHEFSYEEGAMRTSKHACRMRQGTRTKFHVLLTSYELISIDQALLGSISWEVLVVDEAHRLKNNQSKFFRILSSYKINYKLLLTGTPLQNNLEELFHLLHFMTPEKFNDMQGFLDEFADISKEEQVKRLHEILGEHLLRRLKADVLTDMPSKGEFIVRVELSPMQAKFYKYILTRNFDALSVKGGGSQISLINIVMDLKKCCNHPYLFPSGSDEAPKLRNGAYEGLALIKASGKLELLYKMLPKLKTGGHRVLIFSQMTRLLDILEDFMDYMGYKFERIDGAVTGQQRQDSIDRFNAPDSVSFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQSNKVMIYRFVTRNTVEERVTQVAKKKMMLTHLVVRPGLGGKGGASMSKKELDEILKFGTEDLFKEKDEN-EDDHKIVYDDGAIDRLIDRSQQGIEEKEDMMTDYLSSFKVAHYSKREVSVNXXXXXXXXXETRGEIIKQDLDPADPTYWEKLLRHHYEQDQEDLSKSLGKGKRIRKQVNYSATQQ-EDDNWNDAVGDSDHESGSINKEEDDEEYDESRG-EIIGTRRSKRERDGTKMPPLLVKVNGQLEVLGFNVRQRKAFINAVMRYGLPP-----MDFINSHWMVRELRCKSDRVMRAYINLFLRHLCEPES---DNTDCYSDQVPREGVSRQHVLTRIGIMAVVRKKVQEFEKINGQYS 4855
             G  DTSDEEFERQLQEA+    +E++R RQ+++ ++      G        I +            +     ++ PLM G       Y+TDHQD+C+VCQQGGEI+LCDTCPRAFHLVCLDPEL+E P+G WSCP C K+GV AAS  T    G D+    S+ P ++ RK     EE E+DEHQEFC  C+DGG+LICC +CP SYH +CL PPL +IPE PWLCPRCGC   K KV KIL WRW EP              +  D+++  H      ++ V  +P      QR P   RE+FVKF ++SYW CEW+TELQ+DV+H ++LR YFKK DMDEPP PEDG++++GRAR K +   NLEERFYK+ VRPEW+Q  RIID  T R    W+L+KWRDL Y ECTWE      EV D +  V+E+ +MR LF G+       KKK K+S+     +                        TDL+K++ KQP+Y++ETG  LH YQLEGLNWLRFS+GN VDTILADEMGLGKTIQTI FLYSLYK+GHS+GPFLVAAPLST+INWEREF+ WAPDFYVV YVGDK+SR V+REHEF++EEG +R    A RMR G + +FHVLLTSYE+ISIDQALL SI WEVLVVDEAHRLKNNQSKFFR+L++YKI YKLLLTGTPLQNNLEELFHLLHFM+P KFNDMQGFLDEFADISKE+QVK+LHE+LG+HLLRRLKADVL +MPSKGEFIVRVELSP+Q KFYK+ILT+NFDALS +GGG+Q SLIN++MDLKKCCNHPYLF + S++AP+L NGA+E  AL KA GKLELL  ML KLK GGHRVLIFSQMT++LD+LEDFM+  GYK+ERIDG VTGQ RQD+IDRFNA +S SFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQ+NKVMIYRFVTR TVEERVTQVAKKKMMLTHLVVRPGLGGKGG+ MSKKELD+ILKFGTEDLFK +D +  D+H IVYDD A+DRL+DRSQQG+EEK+  M DYLSSFKVAHY KR +  + D +  D+++   E+IKQ+LD  DP YWEKLLRHH+EQ QED +K LGKGKR RK VNY   QQ E+D+WND    SDH+S    ++E+D+EYD+  G +     R  R     KMPP+L +VNGQ+EVLGFN RQRKAF+N+V+R+GLPP      + + + W  R+LR K ++V RAY+  FLRHLCEP+S   DN   Y D  PR+G+  Q +LTRIGIM++VRKKVQEFE+ING YS
Sbjct:  141 AGGGDTSDEEFERQLQEAEALQEEEQKRRRQQRINSRRATSKAGASGGEASTIHVSASAPNLVHGVGIKRSVIARVPLMGGNRQYEDGYETDHQDFCDVCQQGGEIVLCDTCPRAFHLVCLDPELDEPPKGDWSCPQCVKQGVTAASHRTQGGDGDDLISTASEGPVHVSRKPEIEGEEFERDEHQEFCTVCRDGGELICCERCPASYHIQCLDPPLPKIPEDPWLCPRCGCKKPKGKVAKILFWRWKEPSVKLTNPEEPIVISEESDKIEKQHGQVGDDTSTVVVHPQPAPAPQRQPKRTREYFVKFAEMSYWACEWVTELQMDVYHNLMLRLYFKKFDMDEPPQPEDGASHRGRARLKGSSALNLEERFYKFGVRPEWLQPQRIIDSRTTRGKE-WFLVKWRDLPYVECTWED-PATTEVPDFERYVDEFRLMRGLFKGEAVTSTSGKKKGKDSAQALSSVGMSASKRSSFNANLLSKIPPEKPATDLRKQLPKQPEYLDETGLMLHPYQLEGLNWLRFSYGNKVDTILADEMGLGKTIQTIAFLYSLYKDGHSRGPFLVAAPLSTIINWEREFQLWAPDFYVVAYVGDKESRTVIREHEFTFEEGGVRGGSRAVRMRSGAQVRFHVLLTSYEMISIDQALLSSIDWEVLVVDEAHRLKNNQSKFFRMLTTYKIAYKLLLTGTPLQNNLEELFHLLHFMSPAKFNDMQGFLDEFADISKEDQVKKLHEMLGKHLLRRLKADVLKNMPSKGEFIVRVELSPLQKKFYKFILTKNFDALSCRGGGAQPSLINVMMDLKKCCNHPYLFSAASEDAPRLPNGAFESSALRKACGKLELLSAMLKKLKVGGHRVLIFSQMTKMLDLLEDFMEGEGYKYERIDGNVTGQLRQDAIDRFNAVESTSFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQANKVMIYRFVTRATVEERVTQVAKKKMMLTHLVVRPGLGGKGGSQMSKKELDDILKFGTEDLFKHEDNDASDEHCIVYDDAALDRLLDRSQQGMEEKQMEMNDYLSSFKVAHYEKRGIQ-DGDSDAGDEDDPNVEVIKQELDTNDPAYWEKLLRHHFEQAQEDQAKLLGKGKRHRKPVNYWTNQQEEEDDWND--NGSDHDSNFSTRDEEDDEYDDKLGADGSQIGRRVRREREGKMPPILSRVNGQIEVLGFNFRQRKAFVNSVLRFGLPPPPGASKNCLEAAWHSRDLRGKPEKVFRAYVAHFLRHLCEPDSMNQDNNPNYPDGTPRDGILHQPILTRIGIMSLVRKKVQEFEQINGLYS 1444          

HSP 2 Score: 273.478 bits (698), Expect = 9.890e-70
Identity = 137/218 (62.84%), Postives = 168/218 (77.06%), Query Frame = -1
Query:  263 SEADECNKIVINKFMFNIADGGFTELHTIWQNEQRALVEGHEQ-DIWHRKHDYWLLAGVVAHGYGRWQDIHNDVRFAIVNEPFRNEQQKPNYLEIKNRFLARRFKLLEQALTIEEQLRRAAQLNLTYAPNDQVQNLNRRFTELECLATSQQNVYTEAVQGNKTLVPVLHRVLTQLEDLLSDMKQDXXXXXXXXXXXXXXSQRLNLTQTNLIQKLTVQM 913
            +E  +       KFMFNIADGGFT+LHTIW NE+RAL +     +IW+RKHDYWLLAGV  HGYGRWQDIHND RFA++NEPF  +Q KPNYLE+KNRFLARRFKLLEQAL IEEQLRRA+  N+   P D VQ+LNRRF ELECLA +QQ V+ EA+ GN++ + ++HR LT +ED L++MKQDV+RL   + R+ PVS+RLNL+   LI KLT Q+
Sbjct: 1575 AETSQITPPAPKKFMFNIADGGFTDLHTIWLNEERALTDNRGGVEIWNRKHDYWLLAGVCQHGYGRWQDIHNDPRFALINEPFSIDQGKPNYLEMKNRFLARRFKLLEQALIIEEQLRRASHQNIVCDPKDTVQSLNRRFNELECLAFAQQKVFAEALSGNRSQIQLIHRALTMMEDYLAEMKQDVSRLLTIVPRMQPVSERLNLSHAGLITKLTQQL 1792          
BLAST of chromodomain helicase DNA-binding protein 4 vs. Ensembl Cavefish
Match: chd4a (chromodomain helicase DNA binding protein 4a [Source:ZFIN;Acc:ZDB-GENE-041111-187])

HSP 1 Score: 1454.88 bits (3765), Expect = 0.000e+0
Identity = 723/1181 (61.22%), Postives = 893/1181 (75.61%), Query Frame = -1
Query: 1136 GYDTDHQDYCEVCQQGGEIMLCDTCPRAFHLVCLDPELEEAPEGSWSCPHCEKEGVVAASRSTTPATGGDMSQNPQNIRKSAQPNEEEKDEHQEFCNECKDGGDLICCAKCPVSYHPECLYPPLSEIPEGPWLCPRCGCGPLKAKVHKILTWRWMEPPKGKDELDHTHKSTEVEKNPTGGHGRQRAPMREFFVKFRDLSYWNCEWLTELQLDVHHPILLRNYFKKNDMDEPPAPE---DGSTYKGRAREKVADP--HNLEERFYKWSVRPEWMQIHRIIDHMTHRNNSIWYLIKWRDLAYDECTWEQLDGEYEVIDMKHLVEEYHIMRKLFTGDIYKKKFKNSSXXXXXXXXXXXXXXPTTDLKKRMSKQPDYIEETGGKLHQYQLEGLNWLRFSFGNVVDTILADEMGLGKTIQTITFLYSLYKEGHSKGPFLVAAPLSTVINWEREFEFWAPDFYVVTYVGDKDSRAVVREHEFSYEEGAMRTSKHACRMRQGTRTKFHVLLTSYELISIDQALLGSISWEVLVVDEAHRLKNNQSKFFRILSSYKINYKLLLTGTPLQNNLEELFHLLHFMTPEKFNDMQGFLDEFADISKEEQVKRLHEILGEHLLRRLKADVLTDMPSKGEFIVRVELSPMQAKFYKYILTRNFDALSVKGGGSQISLINIVMDLKKCCNHPYLFPSGSDEAPKLRNGAYEGLALIKASGKLELLYKMLPKLKTGGHRVLIFSQMTRLLDILEDFMDYMGYKFERIDGAVTGQQRQDSIDRFNAPDSVSFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQSNKVMIYRFVTRNTVEERVTQVAKKKMMLTHLVVRPGLGGKGGASMSKKELDEILKFGTEDLFKEKDEN----EDDHKIVYDDGAIDRLIDRSQQGIEEKE-DMMTDYLSSFKVAHYSKREVSVNXXXXXXXXXETRGEIIKQDLDPADPTYWEKLLRHHYEQDQEDLSKSLGKGKRIRKQVNYSATQQEDDNWND--AVGDSDHESGSINKEEDDEEYDESRGEIIG---TRRSKRERDGTKMPPLLVKVNGQLEVLGFNVRQRKAFINAVMRYGLPPMDFINSHWMVRELRCKSDRVMRAYINLFLRHLCEPESDNTDCYSDQVPREGVSRQHVLTRIGIMAVVRKKVQEFEKINGQYS 4633
            GY+TDHQDYCEVCQQGGEI+LCDTCPRA+H+VCLDP++E+APEG+WSCPHCEKEG+   +R              +   ++     EE D H EFC  CKDGG+L+CC  CP SYH  CL PPL EIP G W+CPRC C  LK K  KILTWRW +PP           + +   +P    GR   P REFFVK++++SYW+C W++ELQL++H  ++ RNY +KNDMDEPP  +   +G   K   R K  DP    +EE+FY++ ++ EWM IHRI++H   + N+  YLIKWRDLAYD+ TWE  D E    +   L  +Y   R+L  GD  K   K   +  +      PPE+P  D   +  +QP+Y++ TGG LH YQLEGLNWLRFS+    DTILADEMGLGKT+QT  FLYSLYKEGHSKGPFLV+APLST+INWEREFE WAPD YVVTYVGDKDSRAV+RE+EFS+E+ A+R  K A RM++    KFHVLLTSYELI+ID A+LGSI W  LVVDEAHRLKNNQSKFFR+L++Y + +KLLLTGTPLQNNLEELFHLL+F+TPE+F++++GFL+EFADI+KE+Q+K+LH++LG H+LRRLKADV   MPSK E IVRVELSPMQ K+YK+ILTRNF+AL+ +GGG+Q+SL+N+VMDLKKCCNHPYLFP  + EAPK+ NG Y+G AL K+SGKL LL+KML KLK GGHRVLIFSQMT++LD+LEDF++  GYK+ERIDG +TG  RQ++IDRFNAP ++ FVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQ+ KVMIYRFVT+ +VEER+TQVAKKKMMLTHLVVRPGLG K G SMSK+ELD+ILKFGTE+LFK++ E     ED   I YDD AIDRL+DR+Q   ++ E   M +YLSSFKVA Y  ++           +EE + EIIKQ+ +  DP YWEKLLRHHYEQ QEDL+++LGKGKRIRKQVNY+   QED +W D  + G SD+   S+  EE DE++DE R E       R+  R      +PPLL +V G +EVLGFN RQRKAF+NAVMRYG+PP D   + W+VR+LR KS++  +AY++LF+RHLCEP +D  + ++D VPREG+SRQHVLTRIG+M+++RKKVQEFE +NGQ+S
Sbjct:  292 GYETDHQDYCEVCQQGGEIILCDTCPRAYHMVCLDPDMEKAPEGTWSCPHCEKEGIQWEAREEASEG--------EEENEAPAGEAEEDDHHMEFCRVCKDGGELLCCDSCPSSYHIHCLNPPLPEIPNGEWICPRCTCPSLKGKPQKILTWRWGDPPPPTPVPRPPDLAADA-PDPAPLAGR---PEREFFVKWQNMSYWHCSWVSELQLELHCQVMFRNYQRKNDMDEPPPIDFGGEGDEDKSEKR-KNKDPIYAQMEEKFYRFGIKMEWMMIHRILNHSVDKKNNCHYLIKWRDLAYDQATWELEDMEIPEFEAYKL--QYWNHRELMMGDEGKPN-KRLKVKGKSKRLDRPPENPVVDPTIKFDRQPEYLDATGGTLHPYQLEGLNWLRFSWAQGTDTILADEMGLGKTVQTAVFLYSLYKEGHSKGPFLVSAPLSTIINWEREFEMWAPDMYVVTYVGDKDSRAVIRENEFSFEDNAIRGGKKASRMKKEASVKFHVLLTSYELITIDMAILGSIDWACLVVDEAHRLKNNQSKFFRVLNNYPLQHKLLLTGTPLQNNLEELFHLLNFLTPERFSNLEGFLEEFADIAKEDQIKKLHDMLGPHMLRRLKADVFKHMPSKTELIVRVELSPMQKKYYKFILTRNFEALNTRGGGNQVSLLNVVMDLKKCCNHPYLFPVAAMEAPKMPNGMYDGSALTKSSGKLLLLHKMLRKLKEGGHRVLIFSQMTKMLDLLEDFLENEGYKYERIDGGITGAMRQEAIDRFNAPGALQFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQNKKVMIYRFVTKASVEERITQVAKKKMMLTHLVVRPGLGSKTG-SMSKQELDDILKFGTEELFKDEGEGENKEEDSSVIHYDDKAIDRLLDRNQDATDDTELQSMNEYLSSFKVAQYVVKDEEDE-------EEEVQREIIKQE-ESVDPDYWEKLLRHHYEQQQEDLARNLGKGKRIRKQVNYNDGSQEDRDWQDDQSDGQSDY---SVASEEGDEDFDE-RAEANSRRPNRKGLRNDKDKPLPPLLARVGGNIEVLGFNARQRKAFLNAVMRYGMPPQDAFTTQWLVRDLRGKSEKEFKAYVSLFMRHLCEPGADGAETFADGVPREGLSRQHVLTRIGVMSLIRKKVQEFEHVNGQWS 1443          

HSP 2 Score: 253.447 bits (646), Expect = 5.339e-67
Identity = 132/228 (57.89%), Postives = 170/228 (74.56%), Query Frame = -1
Query:  245 DAVMSEADECNKIVINKFMFNIADGGFTELHTIWQNEQRAL-VEGHEQDIWHRKHDYWLLAGVVAHGYGRWQDIHNDVRFAIVNEPFRNEQQKPNYLEIKNRFLARRFKLLEQALTIEEQLRRAAQLNLTYAPNDQVQNLNRRFTELECLATSQQNVYTEAVQGNKTLVPVLHRVLTQLEDLLSDMKQDXXXXXXXXXXXXXXSQRLNLTQTNLIQKLTVQMQQTKPQ 925
            D   +   E  K    +FMFNIADGGFTELH++WQNE+RA  V     +IWHR+HDYWLLAG++ HGY RWQDI NDV+FAI+NEPF+ E  + N+LEIKN+FLARRFKLLEQAL IEEQLRRAA LN+T  P+     LN RF+E+ECLA S Q++  E++ GNK    VLH+VL QLE+LLSDMK DV RLPA++AR+ PV+ RL +++ N++ +L  +  +T+ Q
Sbjct: 1570 DGGAAGVSEEKKKAKTRFMFNIADGGFTELHSLWQNEERAATVTKKTNEIWHRRHDYWLLAGIIQHGYARWQDIQNDVKFAILNEPFKGEMNRGNFLEIKNKFLARRFKLLEQALVIEEQLRRAAYLNMTEDPSHPSMALNTRFSEVECLAESHQHLSKESMSGNKPANAVLHKVLKQLEELLSDMKADVTRLPATIARIPPVAVRLQMSERNILSRLASRGPETQSQ 1797          
BLAST of chromodomain helicase DNA-binding protein 4 vs. Ensembl Cavefish
Match: ENSAMXT00000010902.2 (pep primary_assembly:Astyanax_mexicanus-2.0:10:25098839:25126456:1 gene:ENSAMXG00000010614.2 transcript:ENSAMXT00000010902.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1422.14 bits (3680), Expect = 0.000e+0
Identity = 707/1178 (60.02%), Postives = 883/1178 (74.96%), Query Frame = -1
Query: 1136 GYDTDHQDYCEVCQQGGEIMLCDTCPRAFHLVCLDPELEEAPEGSWSCPHCEKEGVVAASRSTTPATGGDMSQNPQNIRKSAQPNEEEKDEHQEFCNECKDGGDLICCAKCPVSYHPECLYPPLSEIPEGPWLCPRCGCGPLKAKVHKILTWRWMEPPKGKDELDHTHKSTEVEKNPTGGHGRQRAPMREFFVKFRDLSYWNCEWLTELQLDVHHPILLRNYFKKNDMDEPPAPEDGST--YKGRAREKVADPH--NLEERFYKWSVRPEWMQIHRIIDHMTHRNNSIWYLIKWRDLAYDECTWEQLDGEYEVIDMKHLVEEYHIMRKLFTGDIYKKKFKNSSXXXXXXXXXXXXXXPTTDLKKRMSKQPDYIEETGGKLHQYQLEGLNWLRFSFGNVVDTILADEMGLGKTIQTITFLYSLYKEGHSKGPFLVAAPLSTVINWEREFEFWAPDFYVVTYVGDKDSRAVVREHEFSYEEGAMRTSKHACRMRQGTRTKFHVLLTSYELISIDQALLGSISWEVLVVDEAHRLKNNQSKFFRILSSYKINYKLLLTGTPLQNNLEELFHLLHFMTPEKFNDMQGFLDEFADISKEEQVKRLHEILGEHLLRRLKADVLTDMPSKGEFIVRVELSPMQAKFYKYILTRNFDALSVKGGGSQISLINIVMDLKKCCNHPYLFPSGSDEAPKLRNGAYEGLALIKASGKLELLYKMLPKLKTGGHRVLIFSQMTRLLDILEDFMDYMGYKFERIDGAVTGQQRQDSIDRFNAPDSVSFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQSNKVMIYRFVTRNTVEERVTQVAKKKMMLTHLVVRPGLGGKGGASMSKKELDEILKFGTEDLFKE----KDENEDDHKIVYDDGAIDRLIDRSQQGIEEKE-DMMTDYLSSFKVAHYSKREVSVNXXXXXXXXXETRGEIIKQDLDPADPTYWEKLLRHHYEQDQEDLSKSLGKGKRIRKQVNYSATQQEDDNWNDAVGDSDHESGSINKEEDDEEYDESRGEIIGTRRSK---RERDGTKMPPLLVKVNGQLEVLGFNVRQRKAFINAVMRYGLPPMDFINSHWMVRELRCKSDRVMRAYINLFLRHLCEPESDNTDCYSDQVPREGVSRQHVLTRIGIMAVVRKKVQEFEKINGQYS 4633
            GY+TDHQDYCEVCQQGGEI+LCDTCPRA+H+VCLDP++E+APEG+WSCPHCEKEG+   +R  +        +   + R+  +  EEE D H EFC  CKDGG+L+CC  CP SYH  CL PPL +IP G W+CPRC   PLK KV K+LTWRW E P             +         GR+    REFFVK+ ++SYW+C W+ ELQL+++  ++ RN+ +K DM+EPP  + G+        + K  DP    +++ F ++ V+ EW+ IHRI++H   + N++ YLIKWRDL YD+  WE  D   E+ D +   ++Y   R+L  GD  + +        ++   + PP +P  D   +  +QPDY++ TGG LH YQLEGLNWLRFS+    DTILADEMGLGKT+QT  FLYSLYKEGHSKGPFLV+APLST+INWEREFE WAPD YVVTYVGDKDSRAV+RE+EF++E  A+R  K A +M++    KFHVLLTSYELI+IDQA+LGSI W  LVVDEAHRLKNNQSKFFR+L++Y + +KLLLTGTPLQNNLEELFHLL+F+TPE+FN+++GFL+EFADI+KE+Q+K+LH++LG H+LRRLKADV   MPSK E IVRVELSPMQ K+YKYILTRNF+AL+ +GGG+Q+SL+N+VMDLKKCCNHPYLFP+ + EAPK+ NG YEG AL K+SGKL LL KML KLK GGHRVLIFSQMT++LD+LEDF++  GYK+ERIDG VTG  RQ++IDRFNAP +  FVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQ+ KVMIYRFVT+ +VEER+TQVAKKKMMLTHLVVRPGLG K G SMSK+ELD+ILKFGTE+LFK+    +++ ED   I YDD AI RL+DR+Q   E+ E   M +YLSSFKVA Y  ++    ED +         EIIKQ+ +  DP YWEKLLRHHYEQ QEDL++ LGKGKR RK VNY+   QE+ +W D   D+  +  S+  EE DE++DE R E    R S+   R      +PPLL +V G +EVLGFN RQRKAF+NAVMRYG+PP D   + W+VR+LR KS++  +AY++LF+RHLCEP +D  + ++D VPREG+SRQHVLTRIG+M+++RKKVQEFE +NGQ+S
Sbjct:  263 GYETDHQDYCEVCQQGGEIILCDTCPRAYHMVCLDPDMEKAPEGTWSCPHCEKEGIQWEAREESSEG----EEENDDARRDDEGMEEEDDHHMEFCRVCKDGGELLCCDTCPSSYHLHCLNPPLPDIPNGEWICPRCRSLPLKGKVQKVLTWRWGEAPPPMPVPRPPDLPADAPDP-PPMIGRKE---REFFVKWCNMSYWHCSWVQELQLELNCQVMFRNFQRKTDMEEPPILDFGAEGDEDKSIKRKSKDPFYARMDDEFGRYGVKLEWLLIHRILNHSVDKKNNVHYLIKWRDLPYDQSCWESED--MEIPDYETYKQQYWNHRELMIGD--EGRPGKKLKKVKVRKIEKPPTNPVVDPTIKFDRQPDYLDSTGGTLHPYQLEGLNWLRFSWAQGTDTILADEMGLGKTVQTAVFLYSLYKEGHSKGPFLVSAPLSTIINWEREFEMWAPDMYVVTYVGDKDSRAVIRENEFTFEGNAIRGGKKASKMKKEAAVKFHVLLTSYELITIDQAILGSIDWACLVVDEAHRLKNNQSKFFRVLNNYPLQHKLLLTGTPLQNNLEELFHLLNFLTPERFNNLEGFLEEFADIAKEDQIKKLHDMLGPHMLRRLKADVFKHMPSKTELIVRVELSPMQKKYYKYILTRNFEALNTRGGGNQVSLLNVVMDLKKCCNHPYLFPTAATEAPKMPNGMYEGGALTKSSGKLMLLCKMLRKLKEGGHRVLIFSQMTKMLDLLEDFLENEGYKYERIDGGVTGVMRQEAIDRFNAPGAPQFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQNRKVMIYRFVTKASVEERITQVAKKKMMLTHLVVRPGLGSKAG-SMSKQELDDILKFGTEELFKDEIRGENKEEDSSVIHYDDQAISRLLDRNQDATEDTELQSMNEYLSSFKVAQYVVKDEDEEEDVDR--------EIIKQE-ESVDPDYWEKLLRHHYEQQQEDLARHLGKGKRPRKPVNYNDCSQEERDWQDDQSDNQSDY-SVASEEGDEDFDE-RSEANNRRPSRKGLRNDKDKPLPPLLARVGGNIEVLGFNARQRKAFLNAVMRYGMPPQDAFTTQWLVRDLRGKSEKEFKAYVSLFMRHLCEPGADGAETFADGVPREGLSRQHVLTRIGVMSLIRKKVQEFEHVNGQWS 1416          

HSP 2 Score: 246.514 bits (628), Expect = 7.385e-65
Identity = 129/227 (56.83%), Postives = 172/227 (75.77%), Query Frame = -1
Query:  239 SEADECNKIVINKFMFNIADGGFTELHTIWQNEQRAL-VEGHEQDIWHRKHDYWLLAGVVAHGYGRWQDIHNDVRFAIVNEPFRNEQQKPNYLEIKNRFLARRFKLLEQALTIEEQLRRAAQLNLTYAPNDQVQNLNRRFTELECLATSQQNVYTEAVQGNKTLVPVLHRVLTQLEDLLSDMKQDXXXXXXXXXXXXXXSQRLNLTQTNLIQKLTVQMQQ-TKPQPP 913
            ++ +E  K V  +FMFNIADGGFTELH++WQNE+RA  V     +IWHR+HDYWLLAG++ HGY RWQD+ ND R+AI+N+PF+ E  + N+LEIKN+FLARRFKLLEQAL IEEQLRRAA LN+T  P+     LN RF+E+ECLA S Q++  E++ GNK    VLH+VL QLE+LLSDMK DV RLPA++AR+ PV+ RL +++ +++ +L  +  + T+ Q P
Sbjct: 1547 ADNEEKKKAVKQRFMFNIADGGFTELHSLWQNEERAATVTKKTYEIWHRRHDYWLLAGIIQHGYARWQDVQNDPRYAILNQPFKGEMSRGNFLEIKNKFLARRFKLLEQALVIEEQLRRAAYLNMTEDPSHPSMALNTRFSEVECLAESHQHLSKESMSGNKPANAVLHKVLKQLEELLSDMKADVTRLPATIARIPPVAVRLQMSERSILSRLASRGPEVTQTQAP 1773          
BLAST of chromodomain helicase DNA-binding protein 4 vs. Ensembl Cavefish
Match: chd5 (chromodomain helicase DNA binding protein 5 [Source:ZFIN;Acc:ZDB-GENE-120314-2])

HSP 1 Score: 1401.73 bits (3627), Expect = 0.000e+0
Identity = 723/1178 (61.38%), Postives = 891/1178 (75.64%), Query Frame = -1
Query: 1136 YDTDHQDYCEVCQQGGEIMLCDTCPRAFHLVCLDPELEEAPEGSWSCPHCEKEGVVAASRSTTPATGGDMSQNPQNIRKSAQPNEEEKDEHQEFCNECKDGGDLICCAKCPVSYHPECLYPPLSEIPEGPWLCPRCGCGPLKAKVHKILTWRWMEPPKGKDE--LDHTHKSTEVEKNPTGGHGRQRAPMREFFVKFRDLSYWNCEWLTELQLDVHHPILLRNYFKKNDMDEPPAPEDGSTYK--GRAREKVADPH--NLEERFYKWSVRPEWMQIHRIIDHMTHRNNSIWYLIKWRDLAYDECTWEQLDGEYEVIDMKHLVEEYHIMRKLFTGDIYKKKF--KNSSXXXXXXXXXXXXXXPTTDLKKRMSKQPDYIEETGGKLHQYQLEGLNWLRFSFGNVVDTILADEMGLGKTIQTITFLYSLYKEGHSKGPFLVAAPLSTVINWEREFEFWAPDFYVVTYVGDKDSRAVVREHEFSYEEGAMRTSKHACRMRQGTRTKFHVLLTSYELISIDQALLGSISWEVLVVDEAHRLKNNQSKFFRILSSYKINYKLLLTGTPLQNNLEELFHLLHFMTPEKFNDMQGFLDEFADISKEEQVKRLHEILGEHLLRRLKADVLTDMPSKGEFIVRVELSPMQAKFYKYILTRNFDALSVKGGGSQISLINIVMDLKKCCNHPYLFPSGSDEAPKLRNGAYEGLALIKASGKLELLYKMLPKLKTGGHRVLIFSQMTRLLDILEDFMDYMGYKFERIDGAVTGQQRQDSIDRFNAPDSVSFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQSNKVMIYRFVTRNTVEERVTQVAKKKMMLTHLVVRPGLGGKGGASMSKKELDEILKFGTEDLFKEKDEN-EDDHKIVYDDGAIDRLIDRSQQGIEEKE-DMMTDYLSSFKVAHYSKREVSVNXXXXXXXXXETRGEIIKQDLDPADPTYWEKLLRHHYEQDQEDLSKSLGKGKRIRKQVNYSATQQEDDNWNDAVGDSDHESGSINKEEDDEEYDESRGEIIGTRRSKRERDGTK---MPPLLVKVNGQLEVLGFNVRQRKAFINAVMRYGLPPMDFINSHWMVRELRCKSDRVMRAYINLFLRHLCEPESDNTDCYSDQVPREGVSRQHVLTRIGIMAVVRKKVQEFEKINGQYS 4630
            Y+TDHQDYCEVCQQGGEI+LCDTCPRA+HLVCLDPELE+APEG WSCPHCEKEG+   ++                  +  +   EE+D+H EFC  CKDGG+L+CC  CP SYH  CL PPL EIP G WLCPRC C PLK KV +IL W W +PP   +        K+  + K P  G      P R  FVK+  LSYW+C W+ ELQL+++H ++ RNY +KNDMDEPP  + GS  +     + K  DP    +EERFY++ ++PEWM IHRI++H   ++  + YLIKWRDL YD+CTWE  D  ++V + +   + Y   R+   G+  +     K     +E+  K+ PPE P  D   +  +QP YI  TGG LH YQLEGLNWLRFS+    DTILADEMGLGKT+QTI FLYSLYKEGHSKGPFLV+APLST+INWEREFE WAPDFYVVTY GDKDSRAV+RE+EF++E+ A+++ +   RM++ T  KFHVLLTSYELI+IDQA+LGSI W  LVVDEAHRLKNNQSKFFRIL+ YKI YKLLLTGTPLQNNLEELFHLL+F+TPE+FN++ GFL+EFADISKE+Q+K+LH++LG H+LRRLKADV  +MP+K E IVRVELSPMQ K+YK+ILTRNF+AL+ KGGG+Q+SL+NI+MDLKKCCNHPYLFP  + EAP L NG+Y+G  L+K+SGKL LL KML KLK  GHRVLIFSQMT++LD+LEDF+++ GYK+ERIDG +TG  RQ++IDRFNAP +  F FLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQ+ KVMIYRFVTR +VEER+TQVAK+KMMLTHLVVRPGLG K G SMSK+ELD+ILKFGTE+LFK+  E  E+ + I YDD AI +L+DRSQ   E+ E   M +YLSSFKVA Y  +E        +D +EE + EIIKQ+ +  DP YWEKLLRHHYEQ QEDL+++LGKGKRIRKQVNY+ T QED   +           ++   ED++E  E R E  G R+S+R+    +   +PPLL +V G +EVLGFN RQRKAF+NA+MR+G+PP D  NSHW+VR+L+ KS++  RAY++LF+RHLCEP +D  + ++D VPREG+SRQHVLTRIG+M++VRKKVQEFE +NG+YS
Sbjct:  156 YETDHQDYCEVCQQGGEIILCDTCPRAYHLVCLDPELEKAPEGKWSCPHCEKEGIQWEAKDDD--------------EEEEEAGGEEEDDHMEFCRVCKDGGELLCCDTCPSSYHIHCLNPPLPEIPNGEWLCPRCMCPPLKGKVQRILHWMWGDPPLPPEAPPTQDGEKTDILAKPPLKGR-----PERLLFVKWAGLSYWHCSWVNELQLELYHTVMYRNYQRKNDMDEPPPYDYGSGEEELNNEKRKSKDPEYAAMEERFYRYGIKPEWMIIHRILNHSFDKDGDVHYLIKWRDLPYDQCTWEVDD--FDVPEYEPFKQAYWDHREQMLGEDLRPLVVRKGKRPKEEVKRKEAPPETPVVDPTIKFDQQPWYINATGGTLHPYQLEGLNWLRFSWAQGTDTILADEMGLGKTVQTIVFLYSLYKEGHSKGPFLVSAPLSTIINWEREFEMWAPDFYVVTYTGDKDSRAVIRENEFTFEDSAVKSGRKVFRMKKDTPVKFHVLLTSYELITIDQAILGSIGWACLVVDEAHRLKNNQSKFFRILNGYKIYYKLLLTGTPLQNNLEELFHLLNFLTPERFNNLDGFLEEFADISKEDQIKKLHDLLGPHMLRRLKADVFKNMPAKTELIVRVELSPMQKKYYKFILTRNFEALNSKGGGNQVSLLNIMMDLKKCCNHPYLFPVAAVEAPVLPNGSYDGNLLVKSSGKLTLLQKMLKKLKDEGHRVLIFSQMTKMLDLLEDFLEFEGYKYERIDGGITGGLRQEAIDRFNAPGAQQFCFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQNKKVMIYRFVTRASVEERITQVAKRKMMLTHLVVRPGLGSKTG-SMSKQELDDILKFGTEELFKDDVEAIEEGNVIHYDDNAISKLLDRSQDATEDTEIQNMNEYLSSFKVAQYVVQE--------EDREEEVQREIIKQE-ENVDPDYWEKLLRHHYEQQQEDLARNLGKGKRIRKQVNYNDTSQEDQGKHTNTHTHTLSLSTLWGSEDEDEDFEERPE--GRRQSRRQLKSDRDKPLPPLLARVGGNIEVLGFNARQRKAFLNAIMRWGMPPQDAFNSHWLVRDLKGKSEKEFRAYVSLFMRHLCEPGADGAETFADGVPREGLSRQHVLTRIGVMSLVRKKVQEFEHVNGKYS 1300          

HSP 2 Score: 250.751 bits (639), Expect = 3.476e-66
Identity = 134/218 (61.47%), Postives = 165/218 (75.69%), Query Frame = -1
Query:  272 EADECNK----IVINKFMFNIADGGFTELHTIWQNEQR-ALVEGHEQDIWHRKHDYWLLAGVVAHGYGRWQDIHNDVRFAIVNEPFRNEQQKPNYLEIKNRFLARRFKLLEQALTIEEQLRRAAQLNLTYAPNDQVQNLNRRFTELECLATSQQNVYTEAVQGNKTLVPVLHRVLTQLEDLLSDMKQDXXXXXXXXXXXXXXSQRLNLTQTNLIQKLT 910
            EADE +K     V  +FMFNIADGGFTELHT+WQNE+R A+  G   +IWHR+HDYWLLAG+V HGY RWQDI ND R+AI+NEPF+ E  K NYLE+KN+FLARRFKLLEQAL IEEQLRRAA LN+T         LN RF E+ECLA S Q++  E++ GNK    VLH+VL QLE+LLSDMK DV RLP+ L+R+ PVS RL +++ +++ +LT
Sbjct: 1410 EADESHKDDKNGVKTRFMFNIADGGFTELHTLWQNEERIAVSSGKMYEIWHRRHDYWLLAGIVTHGYARWQDIQNDPRYAILNEPFKTEMNKGNYLEMKNKFLARRFKLLEQALVIEEQLRRAAYLNMTQDAGHPAMALNTRFAEVECLAESHQHLSKESLAGNKPANAVLHKVLNQLEELLSDMKADVTRLPSMLSRIPPVSARLQMSERSILSRLT 1627          
BLAST of chromodomain helicase DNA-binding protein 4 vs. Ensembl Cavefish
Match: chd2 (chromodomain helicase DNA binding protein 2 [Source:NCBI gene;Acc:103032281])

HSP 1 Score: 524.628 bits (1350), Expect = 4.892e-154
Identity = 320/769 (41.61%), Postives = 446/769 (58.00%), Query Frame = -1
Query: 1850 EFFVKFRDLSYWNCEWLT---ELQLDVHHPILLRNYFKKNDMDEP----PAPEDGSTYKGRAREKVADPHNLEERFYKWSVRPEWMQIHRIIDHMTHR--NNSIWYLIKWRDLAYDECTWEQLDGEYEVIDMKHLVEEYHIMRKLFTGDIYKKKFKNSSXXXXXXXXXXXXXXPTTDLKKR-----MSKQPDYIEETGGKLHQYQLEGLNWLRFSFGNVVDTILADEMGLGKTIQTITFLYSLYKEGHSKGPFLVAAPLSTVINWEREFEFWAPDFYVVTYVGDKDSRAVVREHEFSYEEGAMRTSKHACRMRQGTRTKFHVLLTSYELISIDQALLGSISWEVLVVDEAHRLKNNQSKFFRILSSYKINYKLLLTGTPLQNNLEELFHLLHFMTPEKFNDMQGFLDEFADISKEEQVKRLHEILGEHLLRRLKADVLTDMPSKGEFIVRVELSPMQAKFYKYILTRNFDALSVKGGGSQISLINIVMDLKKCCNHPYLFPS---GSDEAPKLRNGAYEGLALIKASGKLELLYKMLPKLKTGGHRVLIFSQMTRLLDILEDFMDYMGYKFERIDGAVTGQQRQDSIDRFNAPDSVSFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQSNKVMIYRFVTRNTVEERVTQVAKKKMMLTHLVVR-----------PGLGGKGGASMSKKELDEILKFGTEDLFKEKDENEDDHKIVYDDGAIDRLID--RSQQGIEEKEDMMTDYLSSFKVAHYS 4066
            +F +K++  SY +  W +     Q  V     L N+ KKND         +PED   Y    ++++    N + +  +  +  +  +     D  +H+  +N   YL KW  L Y ECTWE  DG               ++ K F   +     +NSS        K+        LK+R     + KQP YI     +L  YQL+G+NWL  S+      ILADEMGLGKTIQTI+FL  L+ +    GPFL+  PLST+ +W+REF  WAPD  VV Y+GD  SR  +R++E+ ++              Q  R KF+ LLT+YE++  D+++LG+I+W  L VDEAHRLKN+ S  ++ L  ++ N++LL+TGTPLQN+L+EL+ LLHF+ P+KF   + F DE     ++   + LH++L   LLRR+K DV   +P+K E I+RV++S  Q +FYK+ILTRN+ ALS    GS    +NIVM+LKKCCNH +L      G  E P  R        L++ SGKL LL K+L +LK  G+RVL+FSQM R+LDIL D++    Y F+R+DG++ G+ R+ ++D FNA  S  F FLLSTRAGGLGINLA+ADTV+I+DSDWNP ND+QA +RAHRIGQ  +V IYR VT+ TVEE + + AKKKM+L HLV++            G G       +K+EL  ILKFG E+LFKE  E E+      D   I RL +   S QG    +++    LS FKVA+++
Sbjct:  279 QFLIKWKGWSYIHNTWESIDSLTQQKVKGMKKLENFKKKNDELNAWLRRASPEDLEYYN--CQQELTTDLNKQFQIVERVIATKTGKSQVPSDFPSHKTTSNEPEYLCKWMGLPYAECTWE--DGA--------------LISKKFQSCVDSFNSRNSSKTVPSKECKV--------LKQRPRFVALKKQPSYIGGENLELRDYQLDGVNWLAHSWCRCNSVILADEMGLGKTIQTISFLSYLFHQHQLYGPFLLVVPLSTLTSWQREFCTWAPDMNVVVYLGDVLSRKTIRDYEWIHQ--------------QSKRIKFNALLTTYEILLKDKSVLGNINWAFLGVDEAHRLKNDDSLLYKTLIDFRSNHRLLITGTPLQNSLKELWSLLHFLMPDKFESWEDFEDEHGK-GRDNGYQSLHKVLEPFLLRRVKKDVEKSLPAKVEQILRVDMSAQQKQFYKWILTRNYKALSKGTRGSSSGFLNIVMELKKCCNHGFLIKQPEDGDGETPLER-----LQILVRGSGKLVLLDKLLTRLKERGNRVLVFSQMVRMLDILADYLTIKHYPFQRLDGSIKGEIRKQALDHFNAEGSEDFCFLLSTRAGGLGINLASADTVVIFDSDWNPQNDLQAQARAHRIGQKKQVNIYRLVTKGTVEEEIIERAKKKMVLDHLVIQRMDTTGRTVLDNGSGNSNSNPFNKEELTAILKFGAEELFKEP-EGEESEPQEMDIDEILRLAETRESDQGSSATDEL----LSQFKVANFT 996          
BLAST of chromodomain helicase DNA-binding protein 4 vs. Ensembl Cavefish
Match: chd2 (chromodomain helicase DNA binding protein 2 [Source:NCBI gene;Acc:103032281])

HSP 1 Score: 524.628 bits (1350), Expect = 9.746e-154
Identity = 320/769 (41.61%), Postives = 446/769 (58.00%), Query Frame = -1
Query: 1850 EFFVKFRDLSYWNCEWLT---ELQLDVHHPILLRNYFKKNDMDEP----PAPEDGSTYKGRAREKVADPHNLEERFYKWSVRPEWMQIHRIIDHMTHR--NNSIWYLIKWRDLAYDECTWEQLDGEYEVIDMKHLVEEYHIMRKLFTGDIYKKKFKNSSXXXXXXXXXXXXXXPTTDLKKR-----MSKQPDYIEETGGKLHQYQLEGLNWLRFSFGNVVDTILADEMGLGKTIQTITFLYSLYKEGHSKGPFLVAAPLSTVINWEREFEFWAPDFYVVTYVGDKDSRAVVREHEFSYEEGAMRTSKHACRMRQGTRTKFHVLLTSYELISIDQALLGSISWEVLVVDEAHRLKNNQSKFFRILSSYKINYKLLLTGTPLQNNLEELFHLLHFMTPEKFNDMQGFLDEFADISKEEQVKRLHEILGEHLLRRLKADVLTDMPSKGEFIVRVELSPMQAKFYKYILTRNFDALSVKGGGSQISLINIVMDLKKCCNHPYLFPS---GSDEAPKLRNGAYEGLALIKASGKLELLYKMLPKLKTGGHRVLIFSQMTRLLDILEDFMDYMGYKFERIDGAVTGQQRQDSIDRFNAPDSVSFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQSNKVMIYRFVTRNTVEERVTQVAKKKMMLTHLVVR-----------PGLGGKGGASMSKKELDEILKFGTEDLFKEKDENEDDHKIVYDDGAIDRLID--RSQQGIEEKEDMMTDYLSSFKVAHYS 4066
            +F +K++  SY +  W +     Q  V     L N+ KKND         +PED   Y    ++++    N + +  +  +  +  +     D  +H+  +N   YL KW  L Y ECTWE  DG               ++ K F   +     +NSS        K+        LK+R     + KQP YI     +L  YQL+G+NWL  S+      ILADEMGLGKTIQTI+FL  L+ +    GPFL+  PLST+ +W+REF  WAPD  VV Y+GD  SR  +R++E+ ++              Q  R KF+ LLT+YE++  D+++LG+I+W  L VDEAHRLKN+ S  ++ L  ++ N++LL+TGTPLQN+L+EL+ LLHF+ P+KF   + F DE     ++   + LH++L   LLRR+K DV   +P+K E I+RV++S  Q +FYK+ILTRN+ ALS    GS    +NIVM+LKKCCNH +L      G  E P  R        L++ SGKL LL K+L +LK  G+RVL+FSQM R+LDIL D++    Y F+R+DG++ G+ R+ ++D FNA  S  F FLLSTRAGGLGINLA+ADTV+I+DSDWNP ND+QA +RAHRIGQ  +V IYR VT+ TVEE + + AKKKM+L HLV++            G G       +K+EL  ILKFG E+LFKE  E E+      D   I RL +   S QG    +++    LS FKVA+++
Sbjct:  319 QFLIKWKGWSYIHNTWESIDSLTQQKVKGMKKLENFKKKNDELNAWLRRASPEDLEYYN--CQQELTTDLNKQFQIVERVIATKTGKSQVPSDFPSHKTTSNEPEYLCKWMGLPYAECTWE--DGA--------------LISKKFQSCVDSFNSRNSSKTVPSKECKV--------LKQRPRFVALKKQPSYIGGENLELRDYQLDGVNWLAHSWCRCNSVILADEMGLGKTIQTISFLSYLFHQHQLYGPFLLVVPLSTLTSWQREFCTWAPDMNVVVYLGDVLSRKTIRDYEWIHQ--------------QSKRIKFNALLTTYEILLKDKSVLGNINWAFLGVDEAHRLKNDDSLLYKTLIDFRSNHRLLITGTPLQNSLKELWSLLHFLMPDKFESWEDFEDEHGK-GRDNGYQSLHKVLEPFLLRRVKKDVEKSLPAKVEQILRVDMSAQQKQFYKWILTRNYKALSKGTRGSSSGFLNIVMELKKCCNHGFLIKQPEDGDGETPLER-----LQILVRGSGKLVLLDKLLTRLKERGNRVLVFSQMVRMLDILADYLTIKHYPFQRLDGSIKGEIRKQALDHFNAEGSEDFCFLLSTRAGGLGINLASADTVVIFDSDWNPQNDLQAQARAHRIGQKKQVNIYRLVTKGTVEEEIIERAKKKMVLDHLVIQRMDTTGRTVLDNGSGNSNSNPFNKEELTAILKFGAEELFKEP-EGEESEPQEMDIDEILRLAETRESDQGSSATDEL----LSQFKVANFT 1036          
BLAST of chromodomain helicase DNA-binding protein 4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004254.1 (pep scaffold:Pmarinus_7.0:GL484668:1435:12215:1 gene:ENSPMAG00000003871.1 transcript:ENSPMAT00000004254.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 472.241 bits (1214), Expect = 1.081e-148
Identity = 261/549 (47.54%), Postives = 357/549 (65.03%), Query Frame = -1
Query: 1862 GNVVDTILADEMGLGKTIQTITFLYSLYKEGHSKGPFLVAAPLSTVINWEREFEFWAPDFYVVTYVGDKDSRAVVREHEFSYEEGAMRTSKHACRMRQGTRTKFHVLLTSYELISIDQALLGSISWEVLVVDEAHRLKNNQSKFFRILSSYKINYKLLLTGTPLQNNLEELFHLLHFMTPEKFNDMQGFLDEFADISKEEQVKRLHEILGEHLLRRLKADVLTDMPSKGEFIVRVELSPMQAKFYKYILTRNFDALSVKGGGSQISLINIVMDLKKCCNHPYLFPSGSDEAPKLRNGAYEGLALIKASGKLELLYKMLPKLKTGGHRVLIFSQMTRLLDILEDFMDYMGYKFERIDGAVTGQQRQDSIDRFNAPDSVSFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQSNKVMIYRFVTRNTVEERVTQVAKKKMMLTHLVV-----------RPGLGGKGGASMSKKELDEILKFGTEDLFKEKDENEDDHKIVYDDGAIDRLIDRSQQGIEEKEDMMT-----DYLSSFKV 3460
            GN V  ILADEMGLGKTIQTI+FL  ++      GPFL+  PLSTV +W+REF  WAP+  VV Y+GD  SR V+RE+E+ ++              Q  + KF+ L+T+YE++  D+ +LG+++W  L VDEAHRLKN+ S  ++ L  +K N +LL+TGTPLQN+L+EL+ LLHF+ P+KF+  + F D       +     LH+ L   LLRR+K DV   +P+K E I+RVE++P Q  +YK+ILTRNF ALS    GS    +NI+M+LKKCCNH YL     DE    ++ A +  +L+++SGKL LL K+L +L+  GHRVLIFSQM R+LDIL D++    + F+R+DG++  +QR+ ++D FNA  S  F FLLSTRAGGLGINLA+ADTV+I+DSDWNP ND+QA +RAHRIGQ  +V IYR VTR TVEE + + AKKKM+L HLV+           + G         +K+EL  ILKFG E+LFKE +  E + +   D   ID ++ R++    E +D +      + LS FKV
Sbjct:    3 GNSV--ILADEMGLGKTIQTISFLSYMFHSHQVYGPFLLVVPLSTVTSWQREFATWAPEMNVVVYLGDMSSRNVIREYEWIHQ--------------QTKKLKFNALVTTYEILLKDKTVLGAVNWAFLGVDEAHRLKNDDSLLYKSLIEFKTNVRLLITGTPLQNSLKELWSLLHFIMPDKFSAWEDF-DAVHGSGSDNGYVSLHKELEPFLLRRVKKDVERSLPAKVEQILRVEMTPQQKHYYKWILTRNFKALSKGTRGSTSGFLNIMMELKKCCNHCYLIKLPEDENVD-KHDALQ--SLVRSSGKLILLDKLLCRLRETGHRVLIFSQMVRMLDILADYLAMKHFPFQRLDGSIKNEQRKQALDHFNAEGSEDFCFLLSTRAGGLGINLASADTVVIFDSDWNPQNDLQAQARAHRIGQKKQVNIYRLVTRGTVEEDIIERAKKKMVLDHLVIQRMDTTGKTVLQKGSAPSSSTPFNKEELASILKFGAEELFKEGEAEEQESQQEMD---IDEILRRAE--TRENDDSLLPTAGEELLSQFKV 526          
BLAST of chromodomain helicase DNA-binding protein 4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006729.1 (pep scaffold:Pmarinus_7.0:GL476370:400098:484196:-1 gene:ENSPMAG00000006035.1 transcript:ENSPMAT00000006729.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 440.654 bits (1132), Expect = 5.979e-134
Identity = 295/815 (36.20%), Postives = 439/815 (53.87%), Query Frame = -1
Query: 1829 KILTWRWMEPPKGKDE--LDHTHKSTEVEKNPTGGHGRQRAPMREFFVKFRDLSYWNCEWLTELQLD----VHHPILLRNYFKKNDMDEPPAPEDGSTYKGRAREKVADPHNLEERFYKWSVRPEWMQIHRIIDHMTHRNNS------IWYLIKWRDLAYDECTWEQLDGEYEVIDMKHLVEEYHIMRKLFTGDIYKKKFKNSSXXXXXXXXXXXXXXPTTDLKKRMSKQPDYIEETGGKLHQYQLEGLNWLRFSFGNVVDTILADEMGLGKTIQTITFLYSLYKEGHSKGPFLVAAPLSTVINWEREFEFWAPDFYVVTYVGDKDSRAVVREHEFSYEEGAMRTSKHACRMRQGTRTKFHVLLTSYELISIDQALLGSISWEVLVVDEAHRLKNNQSKFFRILSSYKIN-YKLLLTGTPLQNNLEELFHLLHFMTPEKFNDMQGFLDEFADISKEEQVKRLHEILGEHLLRRLKADVLTDMPSKGEFIVRVELSPMQAKFYKYILTRNFDALSVKGGGSQI-SLINIVMDLKKCCNHPYLFPSGSDEAP----KLRNGA----YEGLALIKASGKLELLYKMLPKLKTGGHRVLIFSQMTRLLDILEDFMDYMGYKFERIDGAVTGQQRQDSIDRFNAPDSVSFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQSNKVMIYRFVTRNTVEERVTQVAKKKMMLTHLVVRPGLG----GKGGASMSKKELDEILKFGTEDLFKEKDENEDDHKIVYDDGAIDRLIDRSQQGIE-EKEDMMTDYLSSFKVAHYSKREVSVN 4192
            K LTW   E P  +D   +D       V+K    G G     + E++VK+++ SY +CEW +  QL+    +H  I  R + K+  M                        N+  +  + +  P+++++ RI+D ++H ++        +YL+KW  L Y++ TWE      E ID    ++E+  +R      + K+  +                       K++    +Y  + G +L +YQLEG+NWL F++ N  + ILADEMGLGKTIQ+I FL  +   G   GPFLV APLST+ NWEREF  W  D   V + G   SR +++++E    +   +     C   +   T    L    EL    + L   I     + + + R+   +     +L  Y +  +K+LLTGTPLQN +EELF LL+F+ P +F     FL EF  +  EEQV++L  IL   +LRRLK DV  ++  K E I+ VEL+ +Q K+Y+ IL RNF  L+   G + + +L+N +M+L+KCCNHPYL  +G++E      +  +GA    +   A+++A+GKL L+ K+LP+L+ GGH+VLIFSQM R LDILED++    Y +ERIDG V G  RQ +IDRF  PDS  FVFLL TRAGGLGINL  ADT II+DSDWNP ND+QA +R HRIGQS  V +YR +TRN+ E  +   A  K+ L   V++   G      G   MSKKE++++L+ G        DE ++  K   +D  ID+++ R    I  E E   + +  +  VA  ++ ++S++
Sbjct:   45 KCLTWGTNENPSEEDAAIVDKILAVKMVKKEVVSGQGL--IDVEEYYVKYKNYSYLHCEWASMQQLERDKRIHQKIK-RFWIKRAQM------------------------NIFAQLDEEAFNPDYVEVDRILD-VSHCSDPDTGEPVTYYLVKWCSLPYEDSTWEL----KEDIDQTR-IDEFEALRA--RKHVCKRAERPPPKAW-----------------KKLEDSREY--KNGNQLREYQLEGVNWLLFNWYNRQNCILADEMGLGKTIQSIAFLQDVALAG-VHGPFLVIAPLSTIANWEREFRTWT-DMNAVVFHGSVASRQMIQQYEMYTRDAQSKNIVGFCFYYEKVTTVHSHLKVLPEL---HKGLFSCI----YLSEHSTRVITRRVLLMHLLELYGVEEHKVLLTGTPLQNTVEELFSLLNFLEPARFPSESSFLQEFGQLKSEEQVQKLQAILKPMMLRRLKEDVEKNLAPKQETIIEVELTNIQKKYYRAILERNFSFLAKGAGQANLPNLMNTMMELRKCCNHPYLI-NGAEEKILSDFREAHGADVPDFYLQAMVQAAGKLVLIDKLLPRLREGGHKVLIFSQMVRCLDILEDYLVQKRYPYERIDGRVRGNMRQVAIDRFCKPDSDRFVFLLCTRAGGLGINLTAADTCIIFDSDWNPQNDLQAQARCHRIGQSKAVKVYRLITRNSYEREMFDKASLKLGLDRAVLQSMSGRENTTNGVQQMSKKEIEDLLRKGAYGAI--MDEEDEGSKFCEED--IDQILQRRTHTITIESEGKGSTFAKASFVASGNRTDISLD 791          
BLAST of chromodomain helicase DNA-binding protein 4 vs. Ensembl Sea Lamprey
Match: SMARCA5 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 5 [Source:HGNC Symbol;Acc:HGNC:11101])

HSP 1 Score: 433.335 bits (1113), Expect = 1.697e-133
Identity = 232/544 (42.65%), Postives = 329/544 (60.48%), Query Frame = -1
Query: 1946 RMSKQPDYIEETGGKLHQYQLEGLNWLRFSFGNVVDTILADEMGLGKTIQTITFLYSLYKEGHSKGPFLVAAPLSTVINWEREFEFWAPDFYVVTYVGDKDSRAVVREHEFSYEEGAMRTSKHACRMRQGTRTKFHVLLTSYELISIDQALLGSISWEVLVVDEAHRLKNNQSKFFRILSSYKINYKLLLTGTPLQNNLEELFHLLHFMTPEKFNDMQGFLDEFAD---ISKEEQVKRLHEILGEHLLRRLKADVLTDMPSKGEFIVRVELSPMQAKFYKYILTRNFDALSVKGGGSQISLINIVMDLKKCCNHPYLFPSGSDEAPKLRNGAYEGLALIKASGKLELLYKMLPKLKTGGHRVLIFSQMTRLLDILEDFMDYMGYKFERIDGAVTGQQRQDSIDRFNAPDSVSFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQSNKVMIYRFVTRNTVEERVTQVAKKKMMLTHLVVRPGLG---GKGGASMSKKELDEILKFGTEDLF--KEKDENEDDHKIVYDDGA 3553
            R  + P Y++   G +  YQ+ GLNWL   + N ++ ILADEMGLGKT+QTI+ L  +    +  GP +V  P ST+ NW  EFE W P    V  +GDKD R    +      E                   + V +TSYE+I  ++++    +W  LV+DEAHR+KN +SK   I+  +K   +LLLTGTPLQNNL EL+ LL+F+ P+ FN    F   F        ++ V+RLH +L   LLRR+KADV   +P K E  + + LS MQ ++Y  IL ++ D L+  G   ++ L+NI+M L+KCCNHPYLF  G++  P      +    ++  SGK+ +L K+LPKL   G RVLIFSQMTR++DILED+  + GY++ R+DG    + RQ SI  FNAPDS  FVF+LSTRAGGLGINLATAD VI+YDSDWNP  D+QA  RAHRIGQ   V ++RF+T +TVE+R+ + A+ K+ L  +V++ G G    +    + K E+ +++++G   +F  KE    ++D  ++ + GA
Sbjct:   99 RFEESPSYVK--CGTMRDYQVRGLNWLISLYENGINGILADEMGLGKTLQTISLLGYMKHYRNIPGPHMVLVPKSTLHNWMAEFERWVPSLRAVCLIGDKDHRVSASQPIVPPIE-------------------WDVCVTSYEMIIREKSVFKKFNWRYLVIDEAHRIKNEKSKLSEIVREFKTTNRLLLTGTPLQNNLHELWSLLNFLLPDVFNSADTFTSWFDTNNCFGDQQLVERLHMVLRPFLLRRIKADVEKSLPPKKECKIYIGLSKMQREWYTKILMKDIDILNSAGKMDKMRLLNILMQLRKCCNHPYLF-DGAEPGPPYTTDTH----IVINSGKMVVLDKLLPKLHEQGSRVLIFSQMTRMMDILEDYCMWRGYEYCRLDGQTPHEDRQVSIASFNAPDSSKFVFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAMDRAHRIGQKKVVRVFRFITESTVEDRIVERAEMKLRLDSIVIQQGPGRLVDQVANKLGKDEMLQMIRYGATQVFSSKESQITDEDIDVILERGA 616          
BLAST of chromodomain helicase DNA-binding protein 4 vs. Ensembl Sea Lamprey
Match: SMARCA5 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 5 [Source:HGNC Symbol;Acc:HGNC:11101])

HSP 1 Score: 444.506 bits (1142), Expect = 2.646e-133
Identity = 229/543 (42.17%), Postives = 335/543 (61.69%), Query Frame = -1
Query: 1964 TTDLKKRMSKQPDYIEETGGKLHQYQLEGLNWLRFSFGNVVDTILADEMGLGKTIQTITFLYSLYKEGHSKGPFLVAAPLSTVINWEREFEFWAPDFYVVTYVGDKDSRAVVREHEFSYEEGAMRTSKHACRMRQGTRTKFHVLLTSYELISIDQALLGSISWEVLVVDEAHRLKNNQSKFFRILSSYKINYKLLLTGTPLQNNLEELFHLLHFMTPEKFN---DMQGFLDEFADISKEEQVKRLHEILGEHLLRRLKADVLTDMPSKGEFIVRVELSPMQAKFYKYILTRNFDALSVKGGGSQISLINIVMDLKKCCNHPYLFPSGSDEAPKLRNGAYEGLALIKASGKLELLYKMLPKLKTGGHRVLIFSQMTRLLDILEDFMDYMGYKFERIDGAVTGQQRQDSIDRFNAPDSVSFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQSNKVMIYRFVTRNTVEERVTQVAKKKMMLTHLVVRPGLGGK----GGASMSKKELDEILKFGTEDLFKEKDENEDDHKI 3571
             T++  R  + P Y++  GG +  YQ+ GLNWL   + N ++ ILADEMGLGKT+QTI+ L  +    + +GP +V  P ST+ NW  EFE W P    V  +G+KD R    E+ +                   T+ ++ V +TSYE++  ++++    +W  LV+DEAHR+KN +SK   I+  +K   +LLLTGTPLQNNL EL+ LL+F+ P+ FN   D   + D    +  +E V+RLH +L   LLRR+KADV   +  K E  + + LS MQ ++Y  IL ++ D L+  G   ++ L+NI+M L+KCCNHPYLF  G++  P      +    L+  SGK+ +L K+LPKL+  G RVL+FSQMTR+LDILED+  + GY + R+DG    + RQ++I  +NAP+S  F+F+LSTRAGGLGINLATAD VI+YDSDWNP  D+QA  RAHRIGQ+ +V ++RF+T NTVEER+ + A+ K+ L  +V++    G+        + K E+ ++++ G   +F  +D    D +I
Sbjct:  118 ATNICTRFEESPTYVK--GGTMRDYQVRGLNWLISLYENGINGILADEMGLGKTLQTISLLGYMKHHRNIQGPHMVLVPKSTLHNWMNEFERWVPSLRAVCLIGNKDQRVATDENVY-------------------TKREWDVCVTSYEIVIREKSVFKKFNWRYLVIDEAHRIKNEKSKLSDIVREFKSTNRLLLTGTPLQNNLHELWSLLNFLLPDVFNSSEDFDSWFDTNNCLGDQELVERLHMVLRPFLLRRIKADVEKSLQPKKEVKIYIGLSKMQREWYTKILMKDIDILNSAGKMDKLRLLNILMQLRKCCNHPYLF-DGAEPGPPYTTDTH----LVNNSGKMVVLDKLLPKLQEQGSRVLLFSQMTRMLDILEDYCMWKGYGYCRLDGQTPHEDRQEAIAAYNAPNSSKFIFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAMDRAHRIGQTKRVRVFRFLTENTVEERIVERAEMKLRLDSIVIQQVCAGRLIDQQANKLGKDEMLQMIRHGATHVFASRDSEITDEEI 634          
BLAST of chromodomain helicase DNA-binding protein 4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006707.1 (pep scaffold:Pmarinus_7.0:GL476370:281119:459539:-1 gene:ENSPMAG00000006035.1 transcript:ENSPMAT00000006707.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 390.578 bits (1002), Expect = 1.603e-110
Identity = 248/631 (39.30%), Postives = 351/631 (55.63%), Query Frame = -1
Query: 1631 MGLGKTIQTITFLYSLYKEGHSKGPFLVAAPLSTVINWEREFEFWAPDFYVVTYVGDKDSRAVVREHEFSYEEGAMRTSKHACRMRQGTRTKFHVLLTSYELISIDQALLGSISW----------EVLVVDEAHRLKNNQSKFFRILSSYKIN-YKLLLTGTPLQNNLEELFHLLHFMTPEKFNDMQGFLDEFADISKEEQVKRLHEILGEHLLRRLKADVLTDMPSKGEFIVRVELSPMQAKFYKYILTRNFDALSVKGGGSQI-SLINIVMDLKKCCNHPYLFPSGSDEAP----KLRNGA----YEGLALIKASGKLELLYKMLPKLKTGGHRVLIFSQMTRLLDILEDFMDYMGYKFERIDGAVTGQQRQDSIDRFNAPDSVSFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQSNKVMIYRFVTRNTVEERVTQVAKKKMMLTHLVVRPGLG----GKGGASMSKKELDEILKFGTEDLFKEKDENEDDHKIVYDDGAIDRLIDRSQQGIE-EKEDMMTDYLSSFKVAHYSKREVSVNXXXXXXXXXETRGEIIKQDLDPADPTYWEKLLRHHYEQDQEDLSKSLGKGK------RIRKQV-NYSATQQED 3427
            MGLGKTIQ+I FL  +   G   GPFLV APLST+ NWEREF  W  D   V + G   SR +++++E    +             QG R +   ++ S  + +  Q L+  I W           + ++ E H+           ++ Y I  +K+LLTGTPLQN +EELF LL+F+ P +F     FL EF  +  EEQV++L  IL   +LRRLK DV  ++  K E I+ VEL+ +Q K+Y+ IL RNF  L+   G + + +L+N +M+L+KCCNHPYL  +G++E      +  +GA    +   A+++A+GKL L+ K+LP+L+ GGH+VLIFSQM R LDILED++    Y +ERIDG V G  RQ +IDRF  PDS  FVFLL TRAGGLGINL  ADT II+DSDWNP ND+QA +R HRIGQS  V +YR +TRN+ E  +   A  K+ L   V++   G      G   MSKKE++++L+ G        DE ++  K   +D  ID+++ R    I  E E   + +  +  VA  ++ ++S++                       DP +W+K  +    + + DL    GK        RIRKQV  Y+A + ED
Sbjct:    1 MGLGKTIQSIAFLQDVALAG-VHGPFLVIAPLSTIANWEREFRTWT-DMNAVVFHGSVASRQMIQQYEMYTRDA------------QGRRGR---IIRSAVVWAACQILVKIILWGSGRLIHELFSLSILPELHKDSYFDCNLVHSVTIYNIEEHKVLLTGTPLQNTVEELFSLLNFLEPARFPSESSFLQEFGQLKSEEQVQKLQAILKPMMLRRLKEDVEKNLAPKQETIIEVELTNIQKKYYRAILERNFSFLAKGAGQANLPNLMNTMMELRKCCNHPYLI-NGAEEKILSDFREAHGADVPDFYLQAMVQAAGKLVLIDKLLPRLREGGHKVLIFSQMVRCLDILEDYLVQKRYPYERIDGRVRGNMRQVAIDRFCKPDSDRFVFLLCTRAGGLGINLTAADTCIIFDSDWNPQNDLQAQARCHRIGQSKAVKVYRLITRNSYEREMFDKASLKLGLDRAVLQSMSGRENTTNGVQQMSKKEIEDLLRKGAYGAI--MDEEDEGSKFCEED--IDQILQRRTHTITIESEGKGSTFAKASFVASGNRTDISLD-----------------------DPNFWQKWAK----KAEIDLESMHGKNSLVIDTPRIRKQVRQYTAAKGED 582          
BLAST of chromodomain helicase DNA-binding protein 4 vs. Ensembl Yeast
Match: CHD1 (Chromatin remodeler that regulates various aspects of transcription; acts in in conjunction with Isw1b to regulate chromatin structure and maintain chromatin integrity during transcription elongation by RNAP II by preventing trans-histone exchange over coding regions; contains a chromo domain, a helicase domain and a DNA-binding domain; component of both the SAGA and SLIK complexes [Source:SGD;Acc:S000000966])

HSP 1 Score: 494.582 bits (1272), Expect = 3.207e-146
Identity = 281/641 (43.84%), Postives = 380/641 (59.28%), Query Frame = -1
Query: 1952 RIIDH----MTHRNNSIWYLIKWRDLAYDECTWEQLDGEYEVIDMKHLVEEYHIMRKLFTGDIYKKKFKNSSXXXXXXXXXXXXXXPTTDLKKRMSKQPDYIEETGGKLHQYQLEGLNWLRFSFGNVVDTILADEMGLGKTIQTITFLYSLYKEGHSKGPFLVAAPLSTVINWEREFEFWAPDFYVVTYVGDKDSRAVVREHEFSYEEGAMRTSKHACRMRQGTRT-KFHVLLTSYELISIDQALLGSISWEVLVVDEAHRLKNNQSKFFRILSSYKINYKLLLTGTPLQNNLEELFHLLHFMTPEKFNDMQGFLDEFADISKEEQVKRLHEILGEHLLRRLKADVLTDMPSKGEFIVRVELSPMQAKFYKYILTRNFDALSVKGGGSQISLINIVMDLKKCCNHPYLFPSGSD-------EAPKLRNGAYEGLALIKASGKLELLYKMLPKLKTGGHRVLIFSQMTRLLDILEDFMDYMGYKFERIDGAVTGQQRQDSIDRFNAPDSVSFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQSNKVMIYRFVTRNTVEERVTQVAKKKMMLTHLVVRPGLGGKGGASMSKK------ELDEILKFGTEDLFKEKDENEDDHKIVYDD 3820
            RIID     +    + + YL+KWR L YDE TWE         D+  L  E              K F+N    K +              +K +S QP +I+  GG+L  +QL G+NW+ F +    + ILADEMGLGKT+QT+ F+  L       GP ++  PLST+  W   FE WAPD   + Y+G++ SR  +RE+EF     A           +G +T KF+VLLT+YE I  D+A LGSI W+ + VDEAHRLKN +S  +  L+S+K+  ++L+TGTPLQNN++EL  L++F+ P +F   Q    E  D  +EE +  LH  +   +LRRLK DV   +PSK E I+RVELS +Q ++YK ILT+N+ AL+    G   SL+NI+ +LKK  NHPYLF +  +       +    R     GL  I +SGK+ LL ++L +LK  GHRVLIFSQM R+LDIL D++   G  F+R+DG V   QR+ SID FN+PDS  FVFLLSTRAGGLGINL TADTV+I+DSDWNP  D+QA +RAHRIGQ N VM+YR V+++TVEE V + A+KKM+L + ++   LG   G   +KK      EL  ILKFG  ++F   D  +    +  DD
Sbjct:  289 RIIDSQRASLEDGTSQLQYLVKWRRLNYDEATWEN------ATDIVKLAPEQ------------VKHFQNRENSKILPQYSSNYTSQRPRFEK-LSVQPPFIK--GGELRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISWLIFARRQNGPHIIVVPLSTMPAWLDTFEKWAPDLNCICYMGNQKSRDTIREYEFYTNPRA-----------KGKKTMKFNVLLTTYEYILKDRAELGSIKWQFMAVDEAHRLKNAESSLYESLNSFKVANRMLITGTPLQNNIKELAALVNFLMPGRFTIDQEIDFENQDEEQEEYIHDLHRRIQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGAKGGHFSLLNIMNELKKASNHPYLFDNAEERVLQKFGDGKMTRENVLRGL--IMSSGKMVLLDQLLTRLKKDGHRVLIFSQMVRMLDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNSPDSNDFVFLLSTRAGGLGINLMTADTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAII--SLGVTDGNKYTKKNEPNAGELSAILKFGAGNMFTATDNQKKLEDLNLDD 893          
BLAST of chromodomain helicase DNA-binding protein 4 vs. Ensembl Yeast
Match: ISW2 (ATP-dependent DNA translocase involved in chromatin remodeling; ATPase component that, with Itc1p, forms a complex required for repression of a-specific genes, INO1, and early meiotic genes during mitotic growth; the Isw2 complex exhibits basal levels of chromatin binding throughout the genome as well as target-specific chromatin interactions; targeted by Ume6p- and Sua7p-dependent DNA looping to many loci genome-wide [Source:SGD;Acc:S000005831])

HSP 1 Score: 439.499 bits (1129), Expect = 1.932e-130
Identity = 242/558 (43.37%), Postives = 352/558 (63.08%), Query Frame = -1
Query: 1904 MSKQPDYIEETGGKLHQYQLEGLNWLRFSFGNVVDTILADEMGLGKTIQTITFLYSLYKEGHSKGPFLVAAPLSTVINWEREFEFWAPDFYVVTYVGDKDSRA-VVREHEFSYEEGAMRTSKHACRMRQGTRTKFHVLLTSYELISIDQALLGSISWEVLVVDEAHRLKNNQSKFFRILSSYKINYKLLLTGTPLQNNLEELFHLLHFMTPEKFNDMQGFLDEFADISKEEQ-----VKRLHEILGEHLLRRLKADVLTDMPSKGEFIVRVELSPMQAKFYKYILTRNFDALSVKGGG--SQISLINIVMDLKKCCNHPYLFPSGSDEAPKLRNGAYEGLALIKASGKLELLYKMLPKLKTGGHRVLIFSQMTRLLDILEDFMDYMGYKFERIDGAVTGQQRQDSIDRFNAPDSVSFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQSNKVMIYRFVTRNTVEERVTQVAKKKMMLTHLVVRPGLGGKGGA-SMSKKELDEILKFGTEDLFKEKDENEDDHKIVYDDGAIDRLIDRSQQGIEE 3550
            +S+ P +++   GKL  YQ++GLNWL     N +  ILADEMGLGKT+QTI+FL  L      +GPFL+  P ST+ NW REF  W P+  V+   GDKD+RA +VR                          +F VL+TSYE++  ++  L  ++W+ +V+DEAHR+KN QS   +I+  +    +LL+TGTPLQNNL EL+ LL+F+ P+ F D + F DE+ + +  EQ     +++LH +L   LLRR+KADV   +  K E  V V ++ MQ ++YK +L ++ DA++   G    +  L+NIVM L+KCCNHPYLF  G++  P      +    LI  SGK+ +L K+L +LK  G RVLIFSQM+RLLDILED+  +  +++ RIDG+ + ++R ++ID +N P+S  FVFLL+TRAGGLGINL TADTVI++DSDWNP  D+QA  RAHRIGQ  +V +YRFVT N +EE+V + A +K+ L  LV++ G G K  +   SK +L ++++FG +++F++K         V  D  ID ++ + +Q  +E
Sbjct:  172 VSESPSFVK--SGKLRDYQVQGLNWLISLHENKLSGILADEMGLGKTLQTISFLGYLRYVKQIEGPFLIIVPKSTLDNWRREFLKWTPNVNVLVLHGDKDTRADIVRNIILE--------------------ARFDVLITSYEMVIREKNALKRLAWQYIVIDEAHRIKNEQSALSQIIRLFYSKNRLLITGTPLQNNLHELWALLNFLLPDIFGDSELF-DEWFEQNNSEQDQEIVIQQLHSVLNPFLLRRVKADVEKSLLPKIETNVYVGMTDMQIQWYKSLLEKDIDAVNGAVGKREGKTRLLNIVMQLRKCCNHPYLF-EGAEPGPPYTTDEH----LIFNSGKMIILDKLLKRLKEKGSRVLIFSQMSRLLDILEDYCYFRDFEYCRIDGSTSHEERIEAIDEYNKPNSEKFVFLLTTRAGGLGINLVTADTVILFDSDWNPQADLQAMDRAHRIGQKKQVHVYRFVTENAIEEKVIERAAQKLRLDQLVIQQGTGKKTASLGNSKDDLLDMIQFGAKNMFEKKASK------VTVDADIDDILKKGEQKTQE 695          
BLAST of chromodomain helicase DNA-binding protein 4 vs. Ensembl Yeast
Match: ISW1 (ATPase subunit of imitation-switch (ISWI) class chromatin remodelers; with Ioc3p forms Isw1a complex involved in repression of transcription initiation; with Ioc2p and Ioc4p forms Isw1b complex involved in regulation of transcription elongation; Isw1b recruited to ORFs by H3K36 methylation and acts with Chd1p to prevent trans-histone exchange over coding regions; Isw1p import into nucleus depends on C-terminal bipartite nuclear targeting signal KRIR X19 KKAK [Source:SGD;Acc:S000000449])

HSP 1 Score: 413.69 bits (1062), Expect = 1.077e-121
Identity = 236/523 (45.12%), Postives = 325/523 (62.14%), Query Frame = -1
Query: 1997 PDYIEETGGKLHQYQLEGLNWLRFSFGNVVDTILADEMGLGKTIQTITFLYSLYKEGHSKGPFLVAAPLSTVINWEREFEFWAPDFYVVTYVGDKDSRAVVREHEFSYEEGAMRTSKHACRMRQGTRTKFHVLLTSYELISIDQALLGSISWEVLVVDEAHRLKNNQSKFFRILSSYKINYKLLLTGTPLQNNLEELFHLLHFMTPEKFNDMQGFLDEFADISKEEQ----VKRLHEILGEHLLRRLKADVLTDMPSKGEFIVRVELSPMQAKFYKYILTRNFDALSVKGGG--SQISLINIVMDLKKCCNHPYLFPSGSDEAPKLRNGAYEGLALIKASGKLELLYKMLPKLKTGGHRVLIFSQMTRLLDILEDFMDYMGYKFERIDGAVTGQQRQDSIDRFNAPDSVSFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQSNKVMIYRFVTRNTVEERVTQVAKKKMMLTHLVV---RPGLGGKGGASMSKKELDEILKFGTEDLFK 3538
            P Y+    G+L  YQ++G+NWL     N +  ILADEMGLGKT+QTI+FL  L       GPFLV AP ST+ NW RE   W PD       GDK+ RA + + +              C         F V++ SYE+I  +++ L  I+WE +++DEAHR+KN +S   ++L  +    +LL+TGTPLQNNL EL+ LL+F+ P+ F+D Q F D F+  S EE     VK+LH +L   LLRR+K+DV T +  K E  + V +S MQ K+YK IL ++ DA++   G   S+  L+NI+M L+KCCNHPYLF  G++  P      +    L+  + KL++L K+L KLK  G RVLIFSQM+RLLDILED+  +  Y++ RIDG+   + R  +ID +NAPDS  FVFLL+TRAGGLGINL +AD V++YDSDWNP  D+QA  RAHRIGQ  +V ++R VT N+VEE++ + A +K+ L  LV+   R  L  K   + SK  L  +++ G  D+FK
Sbjct:  189 PAYV---NGQLRPYQIQGVNWLVSLHKNKIAGILADEMGLGKTLQTISFLGYLRYIEKIPGPFLVIAPKSTLNNWLREINRWTPDVNAFILQGDKEERAELIQKKLL-----------GC--------DFDVVIASYEIIIREKSPLKKINWEYIIIDEAHRIKNEESMLSQVLREFTSRNRLLITGTPLQNNLHELWALLNFLLPDIFSDAQDFDDWFSSESTEEDQDKIVKQLHTVLQPFLLRRIKSDVETSLLPKKELNLYVGMSSMQKKWYKKILEKDLDAVNGSNGSKESKTRLLNIMMQLRKCCNHPYLF-DGAEPGPPYTTDEH----LVYNAAKLQVLDKLLKKLKEEGSRVLIFSQMSRLLDILEDYCYFRNYEYCRIDGSTAHEDRIQAIDDYNAPDSKKFVFLLTTRAGGLGINLTSADVVVLYDSDWNPQADLQAMDRAHRIGQKKQVKVFRLVTDNSVEEKILERATQKLRLDQLVIQQNRTSLKKKENKADSKDALLSMIQHGAADVFK 684          
BLAST of chromodomain helicase DNA-binding protein 4 vs. Ensembl Yeast
Match: SNF2 (Catalytic subunit of the SWI/SNF chromatin remodeling complex; involved in transcriptional regulation; contains DNA-stimulated ATPase activity; functions interdependently in transcriptional activation with Snf5p and Snf6p [Source:SGD;Acc:S000005816])

HSP 1 Score: 401.749 bits (1031), Expect = 2.917e-114
Identity = 221/521 (42.42%), Postives = 319/521 (61.23%), Query Frame = -1
Query: 2078 LKKRMSKQPDYIEETGGKLHQYQLEGLNWLRFSFGNVVDTILADEMGLGKTIQTITFLYSLYKEGHSKGPFLVAAPLSTVINWEREFEFWAPDFYVVTYVGDKDSRAVVREHEFSYEEGAMRTSKHACRMRQGTRTKFHVLLTSYELISIDQALLGSISWEVLVVDEAHRLKNNQSKFFRILSS-YKINYKLLLTGTPLQNNLEELFHLLHFMTPEKFNDMQGFLDE-----FAD--------ISKEEQ---VKRLHEILGEHLLRRLKADVLTDMPSKGEFIVRVELSPMQAKFYKYIL---------TRNFDALSVKGGGSQISLINIVMDLKKCCNHPYLFPSGSDEAPKLRNGAYEGLALIKASGKLELLYKMLPKLKTGGHRVLIFSQMTRLLDILEDFMDYMGYKFERIDGAVTGQQRQDSIDRFNAPDSVSFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQSNKVMIYRFVTRNTVEERVTQVAKKKMMLTHLVVRPG 3562
            +K+ + KQP  +   GG L  YQ++GL W+   F N ++ ILADEMGLGKTIQTI+ L  LY+  + +GP+LV  PLST+ NW  EF  WAP    +++ G  + R   +                  ++R G   +F V+LT++E I  ++ALL  + W  +++DE HR+KN QSK    L++ Y  +Y+L+LTGTPLQNNL EL+ LL+F+ P+ FN ++ F DE     FA+        +S+EE    ++RLH++L   LLRRLK DV  ++P K E +V+ ++S +Q   Y+ +L           N   + ++G  +QI      M LKK CNHP++F    D+    R    +   + + +GK ELL ++LPKLK  GHRVLIF QMT+++DI+EDF+ Y+  K+ R+DG     +R + +  FNAPDS    F+LSTRAGGLG+NL TADTVII+D+DWNPH D+QA  RAHRIGQ N+V I R +T N+VEE + + A KK+ +   V++ G
Sbjct:  751 IKEDIKKQPSIL--VGGTLKDYQIKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEMKNIRGPYLVIVPLSTLSNWSSEFAKWAPTLRTISFKGSPNERKAKQ-----------------AKIRAG---EFDVVLTTFEYIIKERALLSKVKWVHMIIDEGHRMKNAQSKLSLTLNTHYHADYRLILTGTPLQNNLPELWALLNFVLPKIFNSVKSF-DEWFNTPFANTGGQDKIELSEEETLLVIRRLHKVLRPFLLRRLKKDVEKELPDKVEKVVKCKMSALQQIMYQQMLKYRRLFIGDQNNKKMVGLRGFNNQI------MQLKKICNHPFVFEEVEDQINPTRETNDD---IWRVAGKFELLDRILPKLKATGHRVLIFFQMTQIMDIMEDFLRYINIKYLRLDGHTKSDERSELLRLFNAPDSEYLCFILSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTNSVEEVILERAYKKLDIDGKVIQAG 1239          
BLAST of chromodomain helicase DNA-binding protein 4 vs. Ensembl Yeast
Match: STH1 (ATPase component of the RSC chromatin remodeling complex; required for expression of early meiotic genes; promotes base excision repair in chromatin; essential helicase-related protein homologous to Snf2p [Source:SGD;Acc:S000001388])

HSP 1 Score: 395.971 bits (1016), Expect = 5.360e-114
Identity = 224/518 (43.24%), Postives = 316/518 (61.00%), Query Frame = -1
Query: 2078 LKKRMSKQPDYIEETGGKLHQYQLEGLNWLRFSFGNVVDTILADEMGLGKTIQTITFLYSLYKEGHSKGPFLVAAPLSTVINWEREFEFWAPDFYVVTYVGDKDSRAVVREHEFSYEEGAMRTSKHACRMRQGTRTKFHVLLTSYELISIDQALLGSISWEVLVVDEAHRLKNNQSKF-FRILSSYKINYKLLLTGTPLQNNLEELFHLLHFMTPEKFNDMQGFLD----EFADISKEEQ-----------VKRLHEILGEHLLRRLKADVLTDMPSKGEFIVRVELSPMQAKFYKYILTRNFDALSVKGG------GSQISLINIVMDLKKCCNHPYLFPSGSDEAPKLRNGAYEGLALI-KASGKLELLYKMLPKLKTGGHRVLIFSQMTRLLDILEDFMDYMGYKFERIDGAVTGQQRQDSIDRFNAPDSVSFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQSNKVMIYRFVTRNTVEERVTQVAKKKMMLTHLVVRPG 3562
            +K+++ KQP  +   GG L +YQL GL W+   + N ++ ILADEMGLGKTIQ+I+ +  LY+     GPFLV  PLST+ NW  EFE WAP    + Y G  + R     H   ++            +R G    F VLLT+YE I  D++LL    W  +++DE HR+KN QSK  F I   Y+   +L+LTGTPLQNNL EL+ LL+F+ P+ FN  + F D     FA+   +E+           ++RLH++L   LLRRLK +V  D+P K E +++ +LS +Q + Y+ +L  N  AL V  G      G    L N +M L+K CNHP++F    DE   + N +     L+ + +GK ELL ++LPK K  GHRVL+F QMT+++DI+EDF+     K+ R+DG+   ++R + ++ FNAPDS  F FLLSTRAGGLG+NL TADTVII+D+DWNPH D+QA  RAHRIGQ N+V I R +T ++VEE + + A +K+ +   V++ G
Sbjct:  454 IKEKIDKQPSIL--VGGTLKEYQLRGLEWMVSLYNNHLNGILADEMGLGKTIQSISLITYLYEVKKDIGPFLVIVPLSTITNWTLEFEKWAPSLNTIIYKGTPNQR-----HSLQHQ------------IRVGN---FDVLLTTYEYIIKDKSLLSKHDWAHMIIDEGHRMKNAQSKLSFTISHYYRTRNRLILTGTPLQNNLPELWALLNFVLPKIFNSAKTFEDWFNTPFANTGTQEKLELTEEETLLIIRRLHKVLRPFLLRRLKKEVEKDLPDKVEKVIKCKLSGLQQQLYQQMLKHN--ALFVGAGTEGATKGGIKGLNNKIMQLRKICNHPFVF----DEVEGVVNPSRGNSDLLFRVAGKFELLDRVLPKFKASGHRVLMFFQMTQVMDIMEDFLRMKDLKYMRLDGSTKTEERTEMLNAFNAPDSDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTDSVEEVILERAMQKLDIDGKVIQAG 943          
BLAST of chromodomain helicase DNA-binding protein 4 vs. Ensembl Nematostella
Match: EDO39585 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9J4])

HSP 1 Score: 976.082 bits (2522), Expect = 0.000e+0
Identity = 490/864 (56.71%), Postives = 615/864 (71.18%), Query Frame = -1
Query: 1853 KDEHQEFCNECKDGGDLICCAKCPVSYHPECLYPPLSEIPEGPWLCPRCGCGPLKAKVHKILTWRWMEPPKGKDELDHTHKSTEVEKNPTGGHGRQRAPMREFFVKFRDLSYWNCEWLTELQLDVHHPILLRNYFKKNDMD-----------------EPPAPEDGSTYKGRAREKVADPHNLEERFYKWSVRPEWMQIHRIIDHMTHRNNSIWYLIKWRDLAYDECTWEQLDGEYEVIDMKHLVEEYHIMRKLFTGDIYKKKFKNSSXXXXXXXXXXXXXXPTTDLKKRMSKQPDYIEETGGKLHQYQLEGLNWLRFSFGNVVDTILADEMGLGKTIQTITFLYSLYKEGHSKGPFLVAAPLSTVINWEREFEFWAPDFYVVTYVGDKDSRAVVREHEFSYEEGAMRTSKHACRMRQGTRTKFHVLLTSYELISIDQALLGSISWEVLVVDEAHRLKNNQSKFFRILSSYKINYKLLLTGTPLQNNLEELFHLLHFMTPEKFNDMQGFLDEFADISKEEQVKRLHEILGEHLLRRLKADVLTDMPSKGEFIVRVELSPMQAKFYKYILTRNFDALSVKGGGSQISLINIVMDLKKCCNHPYLFPSGSDEAPKLRNGAYEGLALIKASGKLELLYKMLPKLKTGGHRVLIFSQMTRLLDILEDFMDYMGYKFERIDGAVTGQQRQDSIDRFNAPDSVSFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQSNKVMIYRFVTRNTVEERVTQVAKKKMMLTHLVVRPGLGGKGGASMSKKELDEILKFGTEDLFKEKD----ENEDDHKIVYDDGAIDRLIDRSQQGIEEK---EDMMTD-YLSSFKVAHY 4369
            +D H ++C  CKDGG L+CC KCP++YH +CL PP+  +P G W CPRC   PLK KV +IL WRW+  P   D    T +  E +      +       REFFVK+R+ SYW+C W+TELQ+++ HP + R + +KNDMD                 + P+P    T K +A+E+  D +NLE RFY++ V PEW+QI+RI++H   ++ S  + +KWRD+ Y + TWE  D       + H +                                        + K+R  KQP Y++ETGGKLH+YQ EGLNWLRFS+    +TILADEMGLGKTIQTI+FLYSL KEGHS+GPFLV+APLST++NWEREFEFWAPD YVVTY GDK+SRA +R  +FS++E A ++   A ++++ +  KFHVLLTSYEL+SID A L SI W +LVVDEAHRLKNNQSKFFR LS Y I YKLLLTGTPLQNNLEEL++LL F+ P +FN+   FL EF +++KE+Q+K+LH+ILG H+LRRLKADVL  +PSK E IVRVELSPMQ K+YK+ILTRNF+AL+ K G  Q+SL+N++M+LKKCCNHPYLF + + EA + ++G YE  +L +ASGKL LL KML KL+  GHRVLIFSQMTR+LD+LEDF++  GYK+ERIDG+V G  RQ++IDRFNAP S +F FLLSTRAGGLGINLATADTV IYDSDWNPHNDIQAFSRAHRIGQ+NKVMIYRFVTR++VEER+TQVAKKKMMLTHLVVRPGLG      MSK ELD+ILKFGT +LFK+ D    E+ D     YDD AI  L+DR QQ +E++   E M+ + YL+SFKV  Y
Sbjct:    7 EDIHSDYCRVCKDGGQLLCCDKCPMAYHLKCLIPPMMRVPTGEWKCPRCQSEPLKGKVERILHWRWVTLPIPPDYQALTPEGEEQKDKTVDTY-----TTREFFVKWREKSYWHCSWITELQIEIQHPEMFRAFSRKNDMDEPPPLSDDDDEDSIEDGQHPSP----TAKSKAKEQ--DENNLEARFYRYGVNPEWLQINRIMNHRVLKDGSEEFFVKWRDVPYSQSTWESPDDP-----INHQIS-------------------------------------YINCKERYEKQPAYLDETGGKLHEYQREGLNWLRFSWAQGTNTILADEMGLGKTIQTISFLYSLMKEGHSQGPFLVSAPLSTLVNWEREFEFWAPDMYVVTYAGDKESRATIRNFDFSFDEDAFKSGLKAYKLKKDSPVKFHVLLTSYELVSIDSASLQSIDWAMLVVDEAHRLKNNQSKFFRTLSDYNIGYKLLLTGTPLQNNLEELWNLLFFLDPVEFNNKNNFLTEFDNVAKEDQIKKLHDILGPHMLRRLKADVLKGIPSKSELIVRVELSPMQKKYYKWILTRNFEALNTK-GAQQVSLLNVMMELKKCCNHPYLFHAAALEAKRTQSGGYEPNSLTEASGKLMLLVKMLKKLREQGHRVLIFSQMTRMLDLLEDFLEGHGYKYERIDGSVNGAARQEAIDRFNAPTSQAFCFLLSTRAGGLGINLATADTVFIYDSDWNPHNDIQAFSRAHRIGQNNKVMIYRFVTRSSVEERITQVAKKKMMLTHLVVRPGLGSNKATIMSKSELDDILKFGTSELFKDDDTKDGESGDSVVFHYDDKAITSLLDRDQQVMEDEVKDEPMLANEYLASFKVLSY 816          

HSP 2 Score: 73.9442 bits (180), Expect = 5.966e-13
Identity = 25/49 (51.02%), Postives = 32/49 (65.31%), Query Frame = -1
Query: 4472 HQDYCEVCQQGGEIMLCDTCPRAFHLVCLDPELEEAPEGSWSCPHCEKE 4618
            H DYC VC+ GG+++ CD CP A+HL CL P +   P G W CP C+ E
Sbjct:   10 HSDYCRVCKDGGQLLCCDKCPMAYHLKCLIPPMMRVPTGEWKCPRCQSE 58          
BLAST of chromodomain helicase DNA-binding protein 4 vs. Ensembl Nematostella
Match: EDO47298 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMN4])

HSP 1 Score: 499.975 bits (1286), Expect = 1.943e-148
Identity = 305/742 (41.11%), Postives = 431/742 (58.09%), Query Frame = -1
Query: 1907 MREFFVKFRDLSYWNCEWLTELQLDVHHPILLRNYFKKNDMDEPPAPEDGSTYKGRAREKVADPHNLEERFYKWSVRPEWMQIHRIIDHMTHRNNSIW-----YLIKWRDLAYDECTWE-QLDGEYEVIDMKH-LVEEYHIMRKLFTGDIYKKKFKNSSXXXXXXXXXXXXXXPTTDLKKRMSKQPDYIEETGGKLHQYQLEGLNWLRFSFGNVVDTILADEMGLGKTIQTITFLYSLYKEGHSKGPFLVAAPLSTVINWEREFEFWAPDFYVVTYVGDKDSRAVVREHEFSYEEGAMRTSKHACRMRQGTRTKFHVLLTSYELISIDQALLGSISWEVLVVDEAHRLKNNQSKFFRILSSYKINYKLLLTGTPLQNNLEELFHLLHFMTPEKFNDMQGFLDEFADISKEEQVKRLHEILGEHLLRRLKADVLTDMPSKGEFIVRVELSPMQAKFYKYILTRNFDALSVKGGGSQIS---LINIVMDLKKCCNHPYLFPSGSDEAPKLRNGAYEGL-----ALIKASGKLELLYKMLPKLKTGGHRVLIFSQMTRLLDILEDFMDYMGYKFERIDGAVTGQQRQDSIDRFNAPDSVSFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQSNKVMIYRFVTRNTVEERVTQVAKKKMMLTHLVV-----RPGLGGKGGASMSKKELDEILKFGTEDLFKEKDENEDDHKIVYDDGAIDRLIDRSQQGIE 4072
            + EF VKF++ SY + EW T  +L             K D            YK +     A    +EE     S  P+++++ R++D  T  +++       +L+KWR L Y+E TWE + D E   I   + L E   + ++ F    Y  ++                         ++   P Y +E    L +YQLEG+NWL F + N  ++ILADEMGLGKTIQ+I FL+ + + G  +GP LV APLST+ NW+REFE W  D   V Y G   SR +++E+EF Y +   +   +          KF VL+T+YE+I  D   L ++ W  +++DEAHRLKN   K    L++ ++ +++LLTGTPLQNN+EELF LL+F+ P +F     FL EF D+  E QV +L ++L   +LRRLK DV  ++  K E I+ VEL+ +Q KFY+ IL RNF A   KG  S  +   L+N +M+L+KCCNHP+L  +G++E   L+    E +     A+I+ASGKL L++K+LPKLK GGH+VL+FSQM R LDILED++ +M Y +ERIDG V G  RQ +IDRF+ PDS  FVFLL TRAGGLGINL  ADTVII+DSDWNP ND+QA +R HRIGQS  V +YR +TRN+ E  +   A  K+ L   V+     +   G  G   MSK+E++++LK G      E+D N+D  K   +D  ID++++R  Q I+
Sbjct:   79 VEEFHVKFKNYSYLHAEWATAEKL------------AKGDKR---VQMKIKRYKAKQLNTAAFFSEMEED----SFNPDYVEVDRVLDMSTGMDHNTGEPITHFLVKWRSLPYEESTWEVKADVEESKIQQFYKLREPPPLPQRQFRPRPYPHEWH------------------------KLETSPVYKDEN--TLREYQLEGVNWLMFCWCNRQNSILADEMGLGKTIQSIAFLFEMQRYG-IRGPNLVIAPLSTISNWQREFESWN-DINAVVYHGSASSRHLIQEYEFYYRDEHGQPIPNI--------FKFQVLITTYEIIIADNMQLSTVPWRAVIIDEAHRLKNRNCKLLEGLNNLQMEHRILLTGTPLQNNVEELFSLLNFLEPSQFPSQGAFLMEFGDLKTESQVDKLKQLLKPMMLRRLKEDVEKNIAPKEETIIEVELTTVQKKFYRAILERNF-AFLAKGTSSTANVPNLMNTMMELRKCCNHPFLI-TGAEEK-ILQEYGREHVDRHTHAMIEASGKLVLIHKLLPKLKLGGHKVLVFSQMVRCLDILEDYLVHMKYPYERIDGRVRGNLRQAAIDRFSKPDSDRFVFLLCTRAGGLGINLTAADTVIIFDSDWNPQNDLQAQARCHRIGQSRSVKVYRLITRNSYEREMFDRASMKLGLDKAVLQSMNTKENAGNNG--QMSKREIEDLLKRGAYGAIMEED-NDDASKFCEED--IDQILERRTQVIQ 757          
BLAST of chromodomain helicase DNA-binding protein 4 vs. Ensembl Nematostella
Match: EDO40761 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S667])

HSP 1 Score: 415.616 bits (1067), Expect = 7.540e-123
Identity = 220/520 (42.31%), Postives = 320/520 (61.54%), Query Frame = -1
Query: 1991 PDYIEETGGKLHQYQLEGLNWLRFSFGNVVDTILADEMGLGKTIQTITFLYSLYKEGHSKGPFLVAAPLSTVINWEREFEFWAPDFYVVTYVGDKDSR-AVVREHEFSYEEGAMRTSKHACRMRQGTRTKFHVLLTSYELISIDQALLGSISWEVLVVDEAHRLKNNQSKFFRILSSYKINYKLLLTGTPLQNNLEELFHLLHFMTPEKF---NDMQGFLDEFADISKEEQVKRLHEILGEHLLRRLKADVLTDMPSKGEFIVRVELSPMQAKFYKYILTRNFDALSVKGGGSQISLINIVMDLKKCCNHPYLFPSGSDEAPKLRNGAYEGLALIKASGKLELLYKMLPKLKTGGHRVLIFSQMTRLLDILEDFMDYMGYKFERIDGAVTGQQRQDSIDRFNAPDSVSFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQSNKVMIYRFVTRNTVEERVTQVAKKKMMLTHLVVRPGLGGKGGASMSKKELDEILKFGTEDLFKEK 3538
            P+YI+  GG++  YQ+ GLNWL   + N ++ ILADEMGLGKT+QTI+ L  +    +  GP +V  P ST+ NW  EFE W P    V  +G+++ R A +R+     E                    + V +TSYE++  ++A+    +W  +V+DEAHR+KN +SK   I+   +   +LLLTGTPLQNNL EL+ LL+F+ P+ F   +D   + +    + +++ V+RLH +L   LLRRLK+DV   +  K E  V   L+ MQ  +Y  IL ++ D ++  G   ++ L+NI+M L+KCCNHPYLF  G++  P      +    LI+ SGK+ +L K+L +LK  G RVLIFSQMTRLLDILED+  +  Y + R+DG    ++RQ  I+ FN P S  F+F+LSTRAGGLGINLATAD VI+YDSDWNP  D+QA  RAHRIGQ  +V ++RF++ +TVEER+ + A+ K+ L  +V++ G        + K+E+  +++ G E +F  K
Sbjct:  136 PNYIK--GGEMRDYQVRGLNWLISLYENGINGILADEMGLGKTLQTISLLGYMKNFRNVPGPHMVICPKSTLANWMAEFERWCPSIRAVCLIGNQEQRTAFIRDTMLPGE--------------------WDVCVTSYEMVIREKAVFKKFAWRYIVIDEAHRIKNEKSKLSEIVRELRSANRLLLTGTPLQNNLHELWALLNFLLPDVFSSSDDFDAWFNSNNLVEEKQLVERLHSVLRPFLLRRLKSDVEKRLLPKKETKVYTGLTKMQRSWYTKILMKDIDVVNGAGKTDKMRLLNILMQLRKCCNHPYLF-DGAEPGPPYTTDVH----LIENSGKMRVLDKLLARLKQEGSRVLIFSQMTRLLDILEDYCLWRQYDYCRLDGQTPHEERQAYINSFNMPGSTKFIFMLSTRAGGLGINLATADIVILYDSDWNPQVDLQAMDRAHRIGQKKQVKVFRFISESTVEERIIERAEMKLRLDAVVIQQGRLVDPNLKVGKEEMLSMIRHGAEAVFASK 628          
BLAST of chromodomain helicase DNA-binding protein 4 vs. Ensembl Nematostella
Match: EDO48116 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK66])

HSP 1 Score: 400.979 bits (1029), Expect = 3.016e-114
Identity = 230/585 (39.32%), Postives = 337/585 (57.61%), Query Frame = -1
Query: 1907 LKKRMSKQPDYIEETGGKLHQYQLEGLNWLRFSFGNVVDTILADEMGLGKTIQTITFLYSLYKEGHSKGPFLVAAPLSTVINWEREFEFWAPDFYVVTYVGDKDSRAVVREHEFSYEEGAMRTSKHACRMRQGTRTKFHVLLTSYELISIDQALLGSISWEVLVVDEAHRLKNNQSKFFRILSS-YKINYKLLLTGTPLQNNLEELFHLLHFMTPEKFNDMQGF----------LDEFADISKEEQV---KRLHEILGEHLLRRLKADVLTDMPSKGEFIVRVELSPMQAKFY-----KYILTRNFDALSVKGGGSQISLINIVMDLKKCCNHPYLFPSGSDEAPK---LRNGAYEGLALIKASGKLELLYKMLPKLKTGGHRVLIFSQMTRLLDILEDFMDYMGYKFERIDGAVTGQQRQDSIDRFNAPDSVSFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQSNKVMIYRFVTRNTVEERVTQVAKKKMMLTHLVVRPGLGGKGGASMSKKEL-----------DEILKFGTEDLFKEKDENEDDHKIVYDDGAIDRLIDRSQQGIE 3562
            +K+ +++QP  +   GG+L +YQL GL W+     N ++ ILADEMGLGKTIQTI     L ++    GPFLV  PLST+ NW+ EFE WAP   VV+Y G  +                MR S  A  +R G   KF+V+LT+YE +  D+A+L  + W+ +VVDE HR+KN+  K  ++L++ Y   +++LLTGTPLQN L EL+ LL+F+ P  F  +  F            E  ++++EE +   +RLH++L   LLRRLK +V + +P K E++V+ ++S +Q   Y     K +L  +      KG G   +L+N +M L+K CNHP++F    +   +      G   G  + +ASGK ELL ++LPKLK   HRVL+F QMT L+ ILED+ ++ G+ + R+DG    + R   +  FNA DS  FVFLLSTRAGGLG+NL  ADTV+I+DSDWNPH D+QA  RAHRIGQ  +V + R +T N+VEE++   A+ K+ +   V++ G+  +   S  +K             DE  K  +        E  +    V DD  ++++I RS++  E
Sbjct:  630 MKETITEQPSML--VGGRLKEYQLAGLEWMVSLHNNNLNGILADEMGLGKTIQTIALFSYLIEKKRLNGPFLVIVPLSTLSNWQLEFEKWAPSAIVVSYKGSPN----------------MRRSAGAV-LRTG---KFNVVLTTYEYVMRDKAILAKVRWKYMVVDEGHRMKNHHCKLTQVLNTHYAAQHRILLTGTPLQNRLPELWALLNFLLPTIFKSVSTFEQWFNAPFAMTGEKVELNEEETILIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVVKCDMSILQRILYNHMYKKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPFMFQHIEESIAEHLGFHGGIVTGPDIYRASGKFELLDRILPKLKRNKHRVLMFCQMTSLMTILEDYFNWKGFPYLRLDGTTKSEDRGQLLSLFNAKDSPYFVFLLSTRAGGLGLNLQAADTVVIFDSDWNPHQDLQAQDRAHRIGQEKEVRVLRLMTVNSVEEKILAAARYKLNVDEKVIQAGMFNQNSTSSERKAFLMALLDTENDDDEAPKSNSNGASSAAMEESE----VPDDETVNQMIARSEEEFE 1188          
BLAST of chromodomain helicase DNA-binding protein 4 vs. Ensembl Nematostella
Match: EDO31943 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWF7])

HSP 1 Score: 375.555 bits (963), Expect = 8.261e-111
Identity = 221/519 (42.58%), Postives = 307/519 (59.15%), Query Frame = -1
Query: 1988 GGKLHQYQLEGLNWLRFSFGNVVDTILADEMGLGKTIQTITFLYSLYKEGHSKGPFLVAAPLSTVINWEREFEFWAPDFYVVTYVGDKDSRAVVREHEFSYEEGAMRTSKHACRMRQGTRTKFHVLLTSYELISIDQALLGSISWEVLVVDEAHRLKNNQSKFFRILSSYKINYKLLLTGTPLQNNLEELFHLLHFMTPEKFNDMQGFLDEFADISKEEQVKR------LHEILGEHLLRRLKADVLTDMPSKGEFIVRVELSPMQAKFYKYILTRNFDALSVKGGGSQISLINIVMDLKKCCNHPYLFPSGSDEAPKLRNGAYEGLALIKASGKLELLYKMLPKLKTGGHRVLIFSQMTRLLDILEDFMDYMGYKFERIDGAVTGQQRQDSIDRFNAPDSVSFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQSNKVMIYRFVTRNTVEERVTQVAKKKMMLTHLVVRPGL---GGKGGASMSKKELDEILKFGTEDLFKEKD 3517
            G  L  YQLEG+ W+R         IL DEMGLGKTIQTI+ L  L +     G FLV +PLS + NW+ E + +     V++ +G K+ R + +   F                 Q  +    VLLTSYE+   + + L    W  + VDEAHRLKN+QS  +  L  +K ++ +LLTGTP+QNNL+EL+ LL F+ P  F D++ +++EF    K     R      L ++L   LLRR+K++V+ D+P K E I+   +S +Q K+YK IL +++D  S  G  S+  L +I+ +L+KC NHPYLF     E   L      G  LI ASGKL  + ++L  L   GH+VL+FSQMTR+LDI++D++ Y GY +ER+DG+V G++R  +I  FN     +F+FLLST+AGG G+NL +ADTVI  DSD+NP ND+QA +RAHRIGQ+  V I R V RNTVEE + + A  KM LT+ V+  G      K  AS     L  ILKFG E LF+ ++
Sbjct:   13 GITLRPYQLEGVGWMRDCALTGHGCILGDEMGLGKTIQTISVLLLLKRTIKHTGLFLVLSPLSVMANWKNEIKRFTKSLKVLSLIGSKEEREITKNKLF-----------------QDIKN-IDVLLTSYEICLRETSFLQRFHWSAVAVDEAHRLKNSQSLLYTELIQFKYDFSILLTGTPVQNNLKELYSLLSFIAPSIF-DLE-YVEEFETAFKNLATGRDNTNSDLPQLLSPFLLRRVKSEVMVDLPEKSEVILYAGMSELQKKYYKAILMKDYDIFSTDGP-SRNKLNSILTNLRKCVNHPYLFDGVEPEPFAL------GEHLITASGKLHAIDQLLSYLYKRGHKVLMFSQMTRMLDIVQDYLGYRGYAYERLDGSVRGEERYIAIKNFNEEQD-NFIFLLSTKAGGQGLNLMSADTVIFVDSDYNPQNDLQAAARAHRIGQTRPVKIIRLVGRNTVEEIILKHADDKMRLTNNVIEGGQVYDSSKIVASYRTLLLANILKFGLEKLFESEE 503          
BLAST of chromodomain helicase DNA-binding protein 4 vs. Ensembl Medaka
Match: chd4a (chromodomain-helicase-DNA-binding protein 4 [Source:NCBI gene;Acc:101174845])

HSP 1 Score: 1451.8 bits (3757), Expect = 0.000e+0
Identity = 717/1182 (60.66%), Postives = 900/1182 (76.14%), Query Frame = -1
Query: 1136 GYDTDHQDYCEVCQQGGEIMLCDTCPRAFHLVCLDPELEEAPEGSWSCPHCEKEGVVAASRSTTPATGGDMSQNPQNIRKSAQPNEEEKDEHQEFCNECKDGGDLICCAKCPVSYHPECLYPPLSEIPEGPWLCPRCGCGPLKAKVHKILTWRWMEPPKGKDELDHTHKSTEVEKNPTGGHGRQRAPMREFFVKFRDLSYWNCEWLTELQLDVHHPILLRNYFKKNDMDEPPAPEDGSTYKGR-AREKVADPH--NLEERFYKWSVRPEWMQIHRIIDHMTHRNNSIWYLIKWRDLAYDECTWEQLDGEYEVIDMKHLVEEYHIMRKLFTGDIYK--KKFKNSSXXXXXXXXXXXXXXPTTDLKKRMSKQPDYIEETGGKLHQYQLEGLNWLRFSFGNVVDTILADEMGLGKTIQTITFLYSLYKEGHSKGPFLVAAPLSTVINWEREFEFWAPDFYVVTYVGDKDSRAVVREHEFSYEEGAMRTSKHACRMRQGTRTKFHVLLTSYELISIDQALLGSISWEVLVVDEAHRLKNNQSKFFRILSSYKINYKLLLTGTPLQNNLEELFHLLHFMTPEKFNDMQGFLDEFADISKEEQVKRLHEILGEHLLRRLKADVLTDMPSKGEFIVRVELSPMQAKFYKYILTRNFDALSVKGGGSQISLINIVMDLKKCCNHPYLFPSGSDEAPKLRNGAYEGLALIKASGKLELLYKMLPKLKTGGHRVLIFSQMTRLLDILEDFMDYMGYKFERIDGAVTGQQRQDSIDRFNAPDSVSFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQSNKVMIYRFVTRNTVEERVTQVAKKKMMLTHLVVRPGLGGKGGASMSKKELDEILKFGTEDLFKEKDEN----EDDHKIVYDDGAIDRLIDRSQQGIEEKE-DMMTDYLSSFKVAHYSKREVSVNXXXXXXXXXETRGEIIKQDLDPADPTYWEKLLRHHYEQDQEDLSKSLGKGKRIRKQVNYSATQQED-DNWND--AVGDSDHESGSINKEEDDEEYDESRGEIIG---TRRSKRERDGTKMPPLLVKVNGQLEVLGFNVRQRKAFINAVMRYGLPPMDFINSHWMVRELRCKSDRVMRAYINLFLRHLCEPESDNTDCYSDQVPREGVSRQHVLTRIGIMAVVRKKVQEFEKINGQYS 4633
            GY+TDHQDYCEVCQQGGEI+LCDTCPRA+H+VCLDP++E+APEG+WSCPHCEKEG+   +R        D+S   ++  ++ +   EE D H EFC  CKDGG+L+CC  CP SYH  CL PPL EIP G W+CPRC C P+K KV KILTWRW EPP           +++   +P    GR     REFF K+ ++SYW+C W++ELQL++H  ++ RNY +KNDMDEPP  + G   + +  + K  DP   +LEE++ ++ ++ EW+ IHRI++H   R N++ YLIKWR+L YD+ TWE  D   ++ + +   ++Y   R+L  GD  +  KK K   +   +   + PPE+P  D   +  +QPDY++ TGG LH YQLEGLNWLRFS+    DTILADEMGLGKT+QT  FLYSLYKEGHSKGPFLV+APLST+INWEREFE WAPD YVVTY+GDKDSRAV+RE+EFS+E+ A+R  K A RM++ +  KFHVLLTSYELI+ID A LGSI W  LVVDEAHRLKNNQSKFFR+L++Y + +KLLLTGTPLQNNLEELFHLL+F+TPE+FN+++ FL+EFADI+KE+Q+K+LH++LG H+LRRLKADV   MPSK E IVRVELSPMQ K+YK+ILT+NF+AL+ KGGG+Q+SL+N+VMDLKKCCNHPYLFP+ + EAPKL NG Y+G AL K+SGKL LL KM+ KLK GGHRVL+FSQMT++LD+LEDF++  GYK+ERIDG +TG  RQ++IDRFNAP +  F FLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQ+ KVMIYRFVT+ +VEER+TQVAKKKMMLTHLVVRPGLG K G SMSK+ELD+ILKFGTE+LFK++ E     ED   I YDD AIDRL+DR+Q   ++ E   M +YLSSFKVA Y  ++           +EE + EIIKQ+ +  DP YWEKLLRHHYEQ QEDL+++LGKGKRIRKQVNY+   QED  +W D  + G SD+   S+  EE DE++DE R E       R+  R      +PPLL +V G +EVLGFN RQRKAF+NAVMRYG+PP D   + W+VR+LR KS++  +AY++LF+RHLCEP +D  + ++D VPREG+SRQHVLTRIG+M+++RKKVQEFE +NGQ+S
Sbjct:  360 GYETDHQDYCEVCQQGGEIILCDTCPRAYHMVCLDPDMEKAPEGTWSCPHCEKEGIQWEARE-------DVSDAEEDNGETGE--MEEDDHHMEFCRVCKDGGELLCCDSCPSSYHIHCLNPPLPEIPNGEWICPRCTCPPMKGKVQKILTWRWGEPPPPTVVPRPPELASDA-PDPPPLKGRAE---REFFAKWCNMSYWHCSWVSELQLEMHCQVMFRNYQRKNDMDEPPPIDFGEGEEDKCVKRKSKDPTYVHLEEKYLRFGIKMEWLMIHRILNHSVDRKNNVHYLIKWRELPYDQATWEAED--MDLPEFEPYKQQYWNHRELMMGDDGRPGKKIK---VKGRVKRPERPPENPVVDPTIKFERQPDYLDSTGGTLHPYQLEGLNWLRFSWAQGTDTILADEMGLGKTVQTAVFLYSLYKEGHSKGPFLVSAPLSTIINWEREFEMWAPDMYVVTYIGDKDSRAVIRENEFSFEDNAIRGGKRASRMKKDSSIKFHVLLTSYELITIDMAALGSIDWACLVVDEAHRLKNNQSKFFRVLNNYSLQHKLLLTGTPLQNNLEELFHLLNFLTPERFNNLEVFLEEFADIAKEDQIKKLHDMLGPHMLRRLKADVFKHMPSKTELIVRVELSPMQKKYYKFILTKNFEALNTKGGGNQVSLLNVVMDLKKCCNHPYLFPAAAMEAPKLPNGMYDGSALTKSSGKLMLLQKMMRKLKEGGHRVLVFSQMTKMLDLLEDFLENEGYKYERIDGGITGGMRQEAIDRFNAPGAQQFAFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQNKKVMIYRFVTKASVEERITQVAKKKMMLTHLVVRPGLGSKTG-SMSKQELDDILKFGTEELFKDEGEGENKEEDSSIIHYDDKAIDRLLDRNQDATDDTELQSMNEYLSSFKVAQYVVKDEEEE-------EEEVQREIIKQE-ESVDPDYWEKLLRHHYEQQQEDLARNLGKGKRIRKQVNYNDGSQEDRADWQDDQSDGQSDY---SVASEEGDEDFDE-RSEANSRRPNRKGLRNDKDKPLPPLLARVGGNIEVLGFNSRQRKAFLNAVMRYGMPPQDAFTTQWLVRDLRGKSEKEFKAYVSLFMRHLCEPGADGAETFADGVPREGLSRQHVLTRIGVMSLIRKKVQEFEHVNGQWS 1510          

HSP 2 Score: 254.603 bits (649), Expect = 3.043e-67
Identity = 131/220 (59.55%), Postives = 167/220 (75.91%), Query Frame = -1
Query:  245 ECNKIVINKFMFNIADGGFTELHTIWQNEQRAL-VEGHEQDIWHRKHDYWLLAGVVAHGYGRWQDIHNDVRFAIVNEPFRNEQQKPNYLEIKNRFLARRFKLLEQALTIEEQLRRAAQLNLTYAPNDQVQNLNRRFTELECLATSQQNVYTEAVQGNKTLVPVLHRVLTQLEDLLSDMKQDXXXXXXXXXXXXXXSQRLNLTQTNLIQKLTVQMQQTKPQ 901
            E  K    +FMFNIADGGFTELH++WQNE+RA  V     +IWHR+HDYWLLAG++ HGY RWQDI NDVRFAI+NEPF+ E  + N+LEIKN+FLARRFKLLEQAL IEEQLRRAA LN++  P+     LN RF+E+ECLA S Q++  E++ GNK    VLH+VL QLE+LLSDMK DV RLPA++AR+ PV+ RL +++ N++ +L  +  +  PQ
Sbjct: 1724 EEKKKAKTRFMFNIADGGFTELHSLWQNEERAATVTKKTNEIWHRRHDYWLLAGIIQHGYARWQDIQNDVRFAILNEPFKGEINRGNFLEIKNKFLARRFKLLEQALVIEEQLRRAAYLNMSEDPSHPSMALNTRFSEVECLAESHQHLSKESMSGNKPANAVLHKVLKQLEELLSDMKADVTRLPATIARIPPVAVRLQMSERNILSRLASRAPEAPPQ 1943          
BLAST of chromodomain helicase DNA-binding protein 4 vs. Ensembl Medaka
Match: ENSORLT00000015622.2 (chromodomain helicase DNA binding protein 4 [Source:NCBI gene;Acc:101170871])

HSP 1 Score: 1425.99 bits (3690), Expect = 0.000e+0
Identity = 705/1183 (59.59%), Postives = 887/1183 (74.98%), Query Frame = -1
Query: 1136 GYDTDHQDYCEVCQQGGEIMLCDTCPRAFHLVCLDPELEEAPEGSWSCPHCEKEGVVAASRSTTPATGGDMSQNPQNIRKSAQPN--EEEKDEHQEFCNECKDGGDLICCAKCPVSYHPECLYPPLSEIPEGPWLCPRCGCGPLKAKVHKILTWRWMEPPKGKDELDHTHKSTEVEKNPTGGHGRQRAPMREFFVKFRDLSYWNCEWLTELQLDVHHPILLRNYFKKNDMDEPPAPE---DGSTYKGRAREKVADPH--NLEERFYKWSVRPEWMQIHRIIDHMTHRNNSIWYLIKWRDLAYDECTWEQLDGEYEVIDMKHLVEEYHIMRKLFTGDIYKKKFKNSSXXXXXXXXXXXXXXPTTDLKKRMSKQPDYIEETGGKLHQYQLEGLNWLRFSFGNVVDTILADEMGLGKTIQTITFLYSLYKEGHSKGPFLVAAPLSTVINWEREFEFWAPDFYVVTYVGDKDSRAVVREHEFSYEEGAMRTSKHACRMRQGTRTKFHVLLTSYELISIDQALLGSISWEVLVVDEAHRLKNNQSKFFRILSSYKINYKLLLTGTPLQNNLEELFHLLHFMTPEKFNDMQGFLDEFADISKEEQVKRLHEILGEHLLRRLKADVLTDMPSKGEFIVRVELSPMQAKFYKYILTRNFDALSVKGGGSQISLINIVMDLKKCCNHPYLFPSGSDEAPKLRNGAYEGLALIKASGKLELLYKMLPKLKTGGHRVLIFSQMTRLLDILEDFMDYMGYKFERIDGAVTGQQRQDSIDRFNAPDSVSFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQSNKVMIYRFVTRNTVEERVTQVAKKKMMLTHLVVRPGLGGKGGASMSKKELDEILKFGTEDLFKEK----DENEDDHKIV-YDDGAIDRLIDRSQQGIEEKE-DMMTDYLSSFKVAHYSKREVSVNXXXXXXXXXETRGEIIKQDLDPADPTYWEKLLRHHYEQDQEDLSKSLGKGKRIRKQVNYSATQQEDDNWNDAVGDSDHESGSINKEEDDEEYDESRGEIIGTRRSKR----ERDGTKMPPLLVKVNGQLEVLGFNVRQRKAFINAVMRYGLPPMDFINSHWMVRELRCKSDRVMRAYINLFLRHLCEPESDNTDCYSDQVPREGVSRQHVLTRIGIMAVVRKKVQEFEKINGQYS 4633
            GY+TDHQDYCEVCQQGGEI+LCDTCPRA+H+VCLDP++E+APEG WSCPHCEKEG+   +R        D+S          +    EEE D H EFC  CKDGG+L+CC  CP SYH  CL PPL EIP G W+CPRC C P+K KV +++TWRW +PP             +   +P    GR+    REFFVK+ ++SYW+C W+ ELQL+++  ++ RNY +K DMDEPP  +   +G   K   R K  DP   ++EE F ++ V+ EW+ IHR+++H   + N++ YLIKWRDL YD+ TWE  D +         + EY   ++ +    Y++ F +  +      K   P +  T    +  +QP+Y++ TGG LH YQLEGLNWLRFS+    DTILADEMGLGKT+QT  FLYSLYKEGHSKGPFLV+APLST+INWEREFE WAPD YVVTYVGDKDSRAV+RE+EFS+E  A+R  K A +M++ +  KFHVLLTSYELI+IDQA+LGSI W  LVVDEAHRLKNNQSKFFR+L++Y + +KLLLTGTPLQNNLEELFHLL+F+TPE+FN+++GFL+EFADI+KE+Q+K+LH++LG H+LRRLKADV   MPSK E IVRVELSPMQ K+YK+ILTRNF+AL+ +GGG+Q+SL+N+VMDLKKCCNHPYLFP+ + EAPKL NG YEG AL KASGKL LL KM+ KLK GGHRVL+FSQMT++LD+LEDF++  GYK+ERIDG VTG  RQ++IDRFNAP +  F FLLSTRAGGLGINLA+ADTVIIYDSDWNPHNDIQAFSRAHRIGQ+ KVMIYRFVT+ +VEER+TQVAKKKMMLTHLVVRPGLG K G SMSK+ELD+ILKFGTE+LFK++    D  EDD  ++ YDD AI RL+DR+Q   ++ E   M +YLSSFKVA Y  ++           ++E   E+IKQ+ +  DP YWEKLLRHHYEQ QEDL+++LGKGKR RK VNY+   QED +W +   D+  +  S+  EE DE++DE R E    R +++    +RD   +PPLL +V G +EVLGFN RQRKAF+NAVMRYG+PP D   + W+VR+LR KS++  +AY++LF+RHLCEP +D  + ++D VPREG+SRQHVLTRIG+M+++RKKVQEFE +NGQ+S
Sbjct:  266 GYETDHQDYCEVCQQGGEIILCDTCPRAYHMVCLDPDMEKAPEGKWSCPHCEKEGIQWEARD-------DLSDAEGEDDDDRRDEGLEEEDDHHIEFCRVCKDGGELLCCDTCPSSYHIHCLNPPLPEIPNGEWICPRCKCPPMKGKVQRVITWRWGDPPPPTPVPRPPDLPADA-PDPHPLMGRRE---REFFVKWCNMSYWHCSWVKELQLELNCQVMFRNYQRKTDMDEPPPVDFGGEGDDDKSTKR-KNKDPLFVHMEEEFGRFGVKLEWLMIHRVLNHSVDKKNNVHYLIKWRDLPYDQSTWESEDMD---------IPEYDPYKQTYWNHRYEEGFISLILKYSKPSKVRFPPYQPT---IKFDRQPEYLDSTGGTLHPYQLEGLNWLRFSWAQATDTILADEMGLGKTVQTAVFLYSLYKEGHSKGPFLVSAPLSTIINWEREFEMWAPDMYVVTYVGDKDSRAVIRENEFSFEGNAIRGGKKASKMKKDSPVKFHVLLTSYELITIDQAVLGSIEWACLVVDEAHRLKNNQSKFFRLLNNYSLQHKLLLTGTPLQNNLEELFHLLNFLTPERFNNLEGFLEEFADIAKEDQIKKLHDMLGPHMLRRLKADVFKHMPSKTELIVRVELSPMQKKYYKFILTRNFEALNTRGGGNQVSLLNVVMDLKKCCNHPYLFPAAATEAPKLPNGMYEGAALTKASGKLMLLQKMMKKLKEGGHRVLVFSQMTKMLDLLEDFLENEGYKYERIDGGVTGNMRQEAIDRFNAPGAQQFAFLLSTRAGGLGINLASADTVIIYDSDWNPHNDIQAFSRAHRIGQNRKVMIYRFVTKASVEERITQVAKKKMMLTHLVVRPGLGSKTG-SMSKQELDDILKFGTEELFKDEIGDGDNKEDDSSVIHYDDQAISRLLDRNQDATDDTEIQSMNEYLSSFKVAQYVVKDEDDE-------EDEVEREVIKQE-ESVDPDYWEKLLRHHYEQQQEDLARNLGKGKRTRKPVNYNDGSQEDRDWQEDQSDNQSDY-SVASEEGDEDFDE-RSEANARRPNRKGLRNDRD-KPLPPLLARVGGNIEVLGFNARQRKAFLNAVMRYGMPPQDAFTNQWLVRDLRGKSEKEFKAYVSLFMRHLCEPGADGAETFADGVPREGLSRQHVLTRIGVMSLIRKKVQEFEHVNGQWS 1412          

HSP 2 Score: 255.758 bits (652), Expect = 9.936e-68
Identity = 132/230 (57.39%), Postives = 172/230 (74.78%), Query Frame = -1
Query:  236 AVMSEADECNKIVINKFMFNIADGGFTELHTIWQNEQRAL-VEGHEQDIWHRKHDYWLLAGVVAHGYGRWQDIHNDVRFAIVNEPFRNEQQKPNYLEIKNRFLARRFKLLEQALTIEEQLRRAAQLNLTYAPNDQVQNLNRRFTELECLATSQQNVYTEAVQGNKTLVPVLHRVLTQLEDLLSDMKQDXXXXXXXXXXXXXXSQRLNLTQTNLIQKLTVQMQQTKPQPPA 922
            A ++ ++E  K    +FMFNIADGGFTELH++WQNE+RA  V     +IWHR+HDYWLLAG++ HGY RWQD+ NDVRFAI+NEPF+ E  + N+LEIKN+FLARRFKLLEQAL IEEQLRRAA LN+T  P      LN RF+E+ECLA S Q++  E++ GNK    VLH+VL QLE+LLSDMK DV RLPA++AR+ PV+ RL +++ N++ +L  +  +   Q P+
Sbjct: 1533 AALNISEEKKKATKQRFMFNIADGGFTELHSLWQNEERAATVTKKTYEIWHRRHDYWLLAGIIQHGYARWQDVQNDVRFAIINEPFKGEMSRGNFLEIKNKFLARRFKLLEQALVIEEQLRRAAYLNMTEDPAHPSMALNTRFSEVECLAESHQHLSKESMSGNKPANAVLHKVLKQLEELLSDMKADVTRLPATIARIPPVAVRLQMSERNILSRLASRGPEVTAQNPS 1762          

HSP 3 Score: 66.6254 bits (161), Expect = 4.425e-10
Identity = 26/57 (45.61%), Postives = 36/57 (63.16%), Query Frame = -1
Query: 4223 NEEEKD----EHQEFCNECKDGGDLICCAKCPVSYHPECLYPPLSEIPEGPWLCPRC 4381
            NEE+ D    +HQ++C  C+ GG++I C  CP +YH  CL P + + PEG W CP C
Sbjct:  260 NEEDGDGYETDHQDYCEVCQQGGEIILCDTCPRAYHMVCLDPDMEKAPEGKWSCPHC 316          
BLAST of chromodomain helicase DNA-binding protein 4 vs. Ensembl Medaka
Match: ENSORLT00000046718.1 (chromodomain helicase DNA binding protein 4 [Source:NCBI gene;Acc:101170871])

HSP 1 Score: 1424.84 bits (3687), Expect = 0.000e+0
Identity = 707/1187 (59.56%), Postives = 890/1187 (74.98%), Query Frame = -1
Query: 1136 GYDTDHQDYCEVCQQGGEIMLCDTCPRAFHLVCLDPELEEAPEGSWSCPHCEKEGVVAASRSTTPATGGDMSQNPQNIRKSAQPN--EEEKDEHQEFCNECKDGGDLICCAKCPVSYHPECLYPPLSEIPEGPWLCPRCGCGPLKAKVHKILTWRWMEPPKGKDELDHTHKSTEVEKNPTGGHGRQRAPMREFFVKFRDLSYWNCEWLTELQLDVHHPILLRNYFKKNDMDEPPAPE---DGSTYKGRAREKVADPH--NLEERFYKWSVRPEWMQIHRIIDHMTHRNNSIWYLIKWRDLAYDECTWEQLDGEYEVIDMKHLVEEYHIMRKLFTGDIYKKKFKNSSXXXXXXXXXXXXXXPTTDLKKRMSKQPDYIEETGGKLHQYQLEGLNWLRFSFGNVVDTILADEMGLGKTIQTITFLYSLYKEGHSKGPFLVAAPLSTVINWEREFEFWAPDFYVVTYVGDKDSRAVVREHEFSYEEGAMRTSKHACRMRQGTRTKFHVLLTSYELISIDQALLGSISWEVLVVDEAHRLKNNQSKFFRILSSYKINYKLLLTGTPLQNNLEELFHLLHFMTPEKFNDMQGFLDEFADISKEEQVKRLHEILGEHLLRRLKADVLTDMPSKGEFIVRVELSPMQAKFYKYILTRNFDALSVKGGGSQISLINIVMDLKKCCNHPYLFPSGSDEAPKLRNGAYEGLALIKASGKLELLYKMLPKLKTGGHRVLIFSQMTRLLDILEDFMDYMGYKFERIDGAVTGQQRQDSIDRFNAPDSVSFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQSNKVMIYRFVTRNTVEERVTQVAKKKMMLTHLVVRPGLGGKGGASMSKKELDEILKFGTEDLFKEK----DENEDDHKIV-YDDGAIDRLIDRSQQGIEEKE-DMMTDYLSSFKVAHYSKREVSVNXXXXXXXXXETRGEIIKQDLDPADPTYWEKLLRHHYEQDQEDLSKSLGKGKRIRKQVNYSATQQED----DNWNDAVGDSDHESGSINKEEDDEEYDESRGEIIGTRRSKR----ERDGTKMPPLLVKVNGQLEVLGFNVRQRKAFINAVMRYGLPPMDFINSHWMVRELRCKSDRVMRAYINLFLRHLCEPESDNTDCYSDQVPREGVSRQHVLTRIGIMAVVRKKVQEFEKINGQYS 4633
            GY+TDHQDYCEVCQQGGEI+LCDTCPRA+H+VCLDP++E+APEG WSCPHCEKEG+   +R        D+S          +    EEE D H EFC  CKDGG+L+CC  CP SYH  CL PPL EIP G W+CPRC C P+K KV +++TWRW +PP             +   +P    GR+    REFFVK+ ++SYW+C W+ ELQL+++  ++ RNY +K DMDEPP  +   +G   K   R K  DP   ++EE F ++ V+ EW+ IHR+++H   + N++ YLIKWRDL YD+ TWE  D   ++ +     + Y   R+L  G+   +  K      ++   + PP +P  D   +  +QP+Y++ TGG LH YQLEGLNWLRFS+    DTILADEMGLGKT+QT  FLYSLYKEGHSKGPFLV+APLST+INWEREFE WAPD YVVTYVGDKDSRAV+RE+EFS+E  A+R  K A +M++ +  KFHVLLTSYELI+IDQA+LGSI W  LVVDEAHRLKNNQSKFFR+L++Y + +KLLLTGTPLQNNLEELFHLL+F+TPE+FN+++GFL+EFADI+KE+Q+K+LH++LG H+LRRLKADV   MPSK E IVRVELSPMQ K+YK+ILTRNF+AL+ +GGG+Q+SL+N+VMDLKKCCNHPYLFP+ + EAPKL NG YEG AL KASGKL LL KM+ KLK GGHRVL+FSQMT++LD+LEDF++  GYK+ERIDG VTG  RQ++IDRFNAP +  F FLLSTRAGGLGINLA+ADTVIIYDSDWNPHNDIQAFSRAHRIGQ+ KVMIYRFVT+ +VEER+TQVAKKKMMLTHLVVRPGLG K G SMSK+ELD+ILKFGTE+LFK++    D  EDD  ++ YDD AI RL+DR+Q   ++ E   M +YLSSFKVA Y  ++           ++E   E+IKQ+ +  DP YWEKLLRHHYEQ QEDL+++LGKGKR RK VNY+   QED     +W +   D+  +  S+  EE DE++DE R E    R +++    +RD   +PPLL +V G +EVLGFN RQRKAF+NAVMRYG+PP D   + W+VR+LR KS++  +AY++LF+RHLCEP +D  + ++D VPREG+SRQHVLTRIG+M+++RKKVQEFE +NGQ+S
Sbjct:  378 GYETDHQDYCEVCQQGGEIILCDTCPRAYHMVCLDPDMEKAPEGKWSCPHCEKEGIQWEARD-------DLSDAEGEDDDDRRDEGLEEEDDHHIEFCRVCKDGGELLCCDTCPSSYHIHCLNPPLPEIPNGEWICPRCKCPPMKGKVQRVITWRWGDPPPPTPVPRPPDLPADA-PDPHPLMGRRE---REFFVKWCNMSYWHCSWVKELQLELNCQVMFRNYQRKTDMDEPPPVDFGGEGDDDKSTKR-KNKDPLFVHMEEEFGRFGVKLEWLMIHRVLNHSVDKKNNVHYLIKWRDLPYDQSTWESED--MDIPEYDPYKQTYWNHRELMMGE-EGRPVKKLKKQVKVKKAERPPANPIVDPTIKFDRQPEYLDSTGGTLHPYQLEGLNWLRFSWAQATDTILADEMGLGKTVQTAVFLYSLYKEGHSKGPFLVSAPLSTIINWEREFEMWAPDMYVVTYVGDKDSRAVIRENEFSFEGNAIRGGKKASKMKKDSPVKFHVLLTSYELITIDQAVLGSIEWACLVVDEAHRLKNNQSKFFRLLNNYSLQHKLLLTGTPLQNNLEELFHLLNFLTPERFNNLEGFLEEFADIAKEDQIKKLHDMLGPHMLRRLKADVFKHMPSKTELIVRVELSPMQKKYYKFILTRNFEALNTRGGGNQVSLLNVVMDLKKCCNHPYLFPAAATEAPKLPNGMYEGAALTKASGKLMLLQKMMKKLKEGGHRVLVFSQMTKMLDLLEDFLENEGYKYERIDGGVTGNMRQEAIDRFNAPGAQQFAFLLSTRAGGLGINLASADTVIIYDSDWNPHNDIQAFSRAHRIGQNRKVMIYRFVTKASVEERITQVAKKKMMLTHLVVRPGLGSKTG-SMSKQELDDILKFGTEELFKDEIGDGDNKEDDSSVIHYDDQAISRLLDRNQDATDDTEIQSMNEYLSSFKVAQYVVKDEDDE-------EDEVEREVIKQE-ESVDPDYWEKLLRHHYEQQQEDLARNLGKGKRTRKPVNYNDGSQEDRGIRQDWQEDQSDNQSDY-SVASEEGDEDFDE-RSEANARRPNRKGLRNDRD-KPLPPLLARVGGNIEVLGFNARQRKAFLNAVMRYGMPPQDAFTNQWLVRDLRGKSEKEFKAYVSLFMRHLCEPGADGAETFADGVPREGLSRQHVLTRIGVMSLIRKKVQEFEHVNGQWS 1537          

HSP 2 Score: 256.529 bits (654), Expect = 6.449e-68
Identity = 132/230 (57.39%), Postives = 172/230 (74.78%), Query Frame = -1
Query:  236 AVMSEADECNKIVINKFMFNIADGGFTELHTIWQNEQRAL-VEGHEQDIWHRKHDYWLLAGVVAHGYGRWQDIHNDVRFAIVNEPFRNEQQKPNYLEIKNRFLARRFKLLEQALTIEEQLRRAAQLNLTYAPNDQVQNLNRRFTELECLATSQQNVYTEAVQGNKTLVPVLHRVLTQLEDLLSDMKQDXXXXXXXXXXXXXXSQRLNLTQTNLIQKLTVQMQQTKPQPPA 922
            A ++ ++E  K    +FMFNIADGGFTELH++WQNE+RA  V     +IWHR+HDYWLLAG++ HGY RWQD+ NDVRFAI+NEPF+ E  + N+LEIKN+FLARRFKLLEQAL IEEQLRRAA LN+T  P      LN RF+E+ECLA S Q++  E++ GNK    VLH+VL QLE+LLSDMK DV RLPA++AR+ PV+ RL +++ N++ +L  +  +   Q P+
Sbjct: 1730 AALNISEEKKKATKQRFMFNIADGGFTELHSLWQNEERAATVTKKTYEIWHRRHDYWLLAGIIQHGYARWQDVQNDVRFAIINEPFKGEMSRGNFLEIKNKFLARRFKLLEQALVIEEQLRRAAYLNMTEDPAHPSMALNTRFSEVECLAESHQHLSKESMSGNKPANAVLHKVLKQLEELLSDMKADVTRLPATIARIPPVAVRLQMSERNILSRLASRGPEVTAQNPS 1959          
BLAST of chromodomain helicase DNA-binding protein 4 vs. Ensembl Medaka
Match: ENSORLT00000043581.1 (chromodomain helicase DNA binding protein 4 [Source:NCBI gene;Acc:101170871])

HSP 1 Score: 1424.84 bits (3687), Expect = 0.000e+0
Identity = 707/1187 (59.56%), Postives = 890/1187 (74.98%), Query Frame = -1
Query: 1136 GYDTDHQDYCEVCQQGGEIMLCDTCPRAFHLVCLDPELEEAPEGSWSCPHCEKEGVVAASRSTTPATGGDMSQNPQNIRKSAQPN--EEEKDEHQEFCNECKDGGDLICCAKCPVSYHPECLYPPLSEIPEGPWLCPRCGCGPLKAKVHKILTWRWMEPPKGKDELDHTHKSTEVEKNPTGGHGRQRAPMREFFVKFRDLSYWNCEWLTELQLDVHHPILLRNYFKKNDMDEPPAPE---DGSTYKGRAREKVADPH--NLEERFYKWSVRPEWMQIHRIIDHMTHRNNSIWYLIKWRDLAYDECTWEQLDGEYEVIDMKHLVEEYHIMRKLFTGDIYKKKFKNSSXXXXXXXXXXXXXXPTTDLKKRMSKQPDYIEETGGKLHQYQLEGLNWLRFSFGNVVDTILADEMGLGKTIQTITFLYSLYKEGHSKGPFLVAAPLSTVINWEREFEFWAPDFYVVTYVGDKDSRAVVREHEFSYEEGAMRTSKHACRMRQGTRTKFHVLLTSYELISIDQALLGSISWEVLVVDEAHRLKNNQSKFFRILSSYKINYKLLLTGTPLQNNLEELFHLLHFMTPEKFNDMQGFLDEFADISKEEQVKRLHEILGEHLLRRLKADVLTDMPSKGEFIVRVELSPMQAKFYKYILTRNFDALSVKGGGSQISLINIVMDLKKCCNHPYLFPSGSDEAPKLRNGAYEGLALIKASGKLELLYKMLPKLKTGGHRVLIFSQMTRLLDILEDFMDYMGYKFERIDGAVTGQQRQDSIDRFNAPDSVSFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQSNKVMIYRFVTRNTVEERVTQVAKKKMMLTHLVVRPGLGGKGGASMSKKELDEILKFGTEDLFKEK----DENEDDHKIV-YDDGAIDRLIDRSQQGIEEKE-DMMTDYLSSFKVAHYSKREVSVNXXXXXXXXXETRGEIIKQDLDPADPTYWEKLLRHHYEQDQEDLSKSLGKGKRIRKQVNYSATQQED----DNWNDAVGDSDHESGSINKEEDDEEYDESRGEIIGTRRSKR----ERDGTKMPPLLVKVNGQLEVLGFNVRQRKAFINAVMRYGLPPMDFINSHWMVRELRCKSDRVMRAYINLFLRHLCEPESDNTDCYSDQVPREGVSRQHVLTRIGIMAVVRKKVQEFEKINGQYS 4633
            GY+TDHQDYCEVCQQGGEI+LCDTCPRA+H+VCLDP++E+APEG WSCPHCEKEG+   +R        D+S          +    EEE D H EFC  CKDGG+L+CC  CP SYH  CL PPL EIP G W+CPRC C P+K KV +++TWRW +PP             +   +P    GR+    REFFVK+ ++SYW+C W+ ELQL+++  ++ RNY +K DMDEPP  +   +G   K   R K  DP   ++EE F ++ V+ EW+ IHR+++H   + N++ YLIKWRDL YD+ TWE  D   ++ +     + Y   R+L  G+   +  K      ++   + PP +P  D   +  +QP+Y++ TGG LH YQLEGLNWLRFS+    DTILADEMGLGKT+QT  FLYSLYKEGHSKGPFLV+APLST+INWEREFE WAPD YVVTYVGDKDSRAV+RE+EFS+E  A+R  K A +M++ +  KFHVLLTSYELI+IDQA+LGSI W  LVVDEAHRLKNNQSKFFR+L++Y + +KLLLTGTPLQNNLEELFHLL+F+TPE+FN+++GFL+EFADI+KE+Q+K+LH++LG H+LRRLKADV   MPSK E IVRVELSPMQ K+YK+ILTRNF+AL+ +GGG+Q+SL+N+VMDLKKCCNHPYLFP+ + EAPKL NG YEG AL KASGKL LL KM+ KLK GGHRVL+FSQMT++LD+LEDF++  GYK+ERIDG VTG  RQ++IDRFNAP +  F FLLSTRAGGLGINLA+ADTVIIYDSDWNPHNDIQAFSRAHRIGQ+ KVMIYRFVT+ +VEER+TQVAKKKMMLTHLVVRPGLG K G SMSK+ELD+ILKFGTE+LFK++    D  EDD  ++ YDD AI RL+DR+Q   ++ E   M +YLSSFKVA Y  ++           ++E   E+IKQ+ +  DP YWEKLLRHHYEQ QEDL+++LGKGKR RK VNY+   QED     +W +   D+  +  S+  EE DE++DE R E    R +++    +RD   +PPLL +V G +EVLGFN RQRKAF+NAVMRYG+PP D   + W+VR+LR KS++  +AY++LF+RHLCEP +D  + ++D VPREG+SRQHVLTRIG+M+++RKKVQEFE +NGQ+S
Sbjct:  378 GYETDHQDYCEVCQQGGEIILCDTCPRAYHMVCLDPDMEKAPEGKWSCPHCEKEGIQWEARD-------DLSDAEGEDDDDRRDEGLEEEDDHHIEFCRVCKDGGELLCCDTCPSSYHIHCLNPPLPEIPNGEWICPRCKCPPMKGKVQRVITWRWGDPPPPTPVPRPPDLPADA-PDPHPLMGRRE---REFFVKWCNMSYWHCSWVKELQLELNCQVMFRNYQRKTDMDEPPPVDFGGEGDDDKSTKR-KNKDPLFVHMEEEFGRFGVKLEWLMIHRVLNHSVDKKNNVHYLIKWRDLPYDQSTWESED--MDIPEYDPYKQTYWNHRELMMGE-EGRPVKKLKKQVKVKKAERPPANPIVDPTIKFDRQPEYLDSTGGTLHPYQLEGLNWLRFSWAQATDTILADEMGLGKTVQTAVFLYSLYKEGHSKGPFLVSAPLSTIINWEREFEMWAPDMYVVTYVGDKDSRAVIRENEFSFEGNAIRGGKKASKMKKDSPVKFHVLLTSYELITIDQAVLGSIEWACLVVDEAHRLKNNQSKFFRLLNNYSLQHKLLLTGTPLQNNLEELFHLLNFLTPERFNNLEGFLEEFADIAKEDQIKKLHDMLGPHMLRRLKADVFKHMPSKTELIVRVELSPMQKKYYKFILTRNFEALNTRGGGNQVSLLNVVMDLKKCCNHPYLFPAAATEAPKLPNGMYEGAALTKASGKLMLLQKMMKKLKEGGHRVLVFSQMTKMLDLLEDFLENEGYKYERIDGGVTGNMRQEAIDRFNAPGAQQFAFLLSTRAGGLGINLASADTVIIYDSDWNPHNDIQAFSRAHRIGQNRKVMIYRFVTKASVEERITQVAKKKMMLTHLVVRPGLGSKTG-SMSKQELDDILKFGTEELFKDEIGDGDNKEDDSSVIHYDDQAISRLLDRNQDATDDTEIQSMNEYLSSFKVAQYVVKDEDDE-------EDEVEREVIKQE-ESVDPDYWEKLLRHHYEQQQEDLARNLGKGKRTRKPVNYNDGSQEDRGIRQDWQEDQSDNQSDY-SVASEEGDEDFDE-RSEANARRPNRKGLRNDRD-KPLPPLLARVGGNIEVLGFNARQRKAFLNAVMRYGMPPQDAFTNQWLVRDLRGKSEKEFKAYVSLFMRHLCEPGADGAETFADGVPREGLSRQHVLTRIGVMSLIRKKVQEFEHVNGQWS 1537          

HSP 2 Score: 256.529 bits (654), Expect = 6.449e-68
Identity = 132/230 (57.39%), Postives = 172/230 (74.78%), Query Frame = -1
Query:  236 AVMSEADECNKIVINKFMFNIADGGFTELHTIWQNEQRAL-VEGHEQDIWHRKHDYWLLAGVVAHGYGRWQDIHNDVRFAIVNEPFRNEQQKPNYLEIKNRFLARRFKLLEQALTIEEQLRRAAQLNLTYAPNDQVQNLNRRFTELECLATSQQNVYTEAVQGNKTLVPVLHRVLTQLEDLLSDMKQDXXXXXXXXXXXXXXSQRLNLTQTNLIQKLTVQMQQTKPQPPA 922
            A ++ ++E  K    +FMFNIADGGFTELH++WQNE+RA  V     +IWHR+HDYWLLAG++ HGY RWQD+ NDVRFAI+NEPF+ E  + N+LEIKN+FLARRFKLLEQAL IEEQLRRAA LN+T  P      LN RF+E+ECLA S Q++  E++ GNK    VLH+VL QLE+LLSDMK DV RLPA++AR+ PV+ RL +++ N++ +L  +  +   Q P+
Sbjct: 1730 AALNISEEKKKATKQRFMFNIADGGFTELHSLWQNEERAATVTKKTYEIWHRRHDYWLLAGIIQHGYARWQDVQNDVRFAIINEPFKGEMSRGNFLEIKNKFLARRFKLLEQALVIEEQLRRAAYLNMTEDPAHPSMALNTRFSEVECLAESHQHLSKESMSGNKPANAVLHKVLKQLEELLSDMKADVTRLPATIARIPPVAVRLQMSERNILSRLASRGPEVTAQNPS 1959          
BLAST of chromodomain helicase DNA-binding protein 4 vs. Ensembl Medaka
Match: ENSORLT00000021516.2 (chromodomain helicase DNA binding protein 5 [Source:NCBI gene;Acc:101166712])

HSP 1 Score: 1407.12 bits (3641), Expect = 0.000e+0
Identity = 724/1184 (61.15%), Postives = 890/1184 (75.17%), Query Frame = -1
Query: 1136 GYDTDHQDYCEVCQQGGEIMLCDTCPRAFHLVCLDPELEEAPEGSWSCPHCEKEGVVAASRSTTPATGGDMSQNPQNIRKSAQPNEEEKDEHQEFCNECKDGGDLICCAKCPVSYHPECLYPPLSEIPEGPWLCPRCGCGPLKAKVHKILTWRWMEPPKGKDELDHTH-KSTEVEKNPTGGHGRQRAPMREFFVKFRDLSYWNCEWLTELQLDVHHPILLRNYFKKNDMDEPPAPEDGSTYK--GRAREKVADPHN--LEERFYKWSVRPEWMQIHRIIDHMTHRNNSIWYLIKWRDLAYDECTWEQLDGEYEVIDMKHLVEEYHIMRKLFTGDIYKKKF--KNSSXXXXXXXXXXXXXXPTTDLKKRMSKQPDYIEETGGKLHQYQLEGLNWLRFSFGNVVDTILADEMGLGKTIQTITFLYSLYKEGHSKGPFLVAAPLSTVINWEREFEFWAPDFYVVTYVGDKDSRAVVREHEFSYEEGAMRTSKHACRMRQGTRTKFHVLLTSYELISIDQALLGSISWEVLVVDEAHRLKNNQSKFFRILSSYKINYKLLLTGTPLQNNLEELFHLLHFMTPEKFNDMQGFLDEFADISKEEQVKRLHEILGEHLLRRLKADVLTDMPSKGEFIVRVELSPMQAKFYKYILTRNFDALSVKGGGSQISLINIVMDLKKCCNHPYLFPSGSDEAPKLRNGAYEGLALIKASGKLELLYKMLPKLKTGGHRVLIFSQMTRLLDILEDFMDYMGYKFERIDGAVTGQQRQDSIDRFNAPDSVSFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQSNKVMIYRFVTRNTVEERVTQVAKKKMMLTHLVVRPGLGGKGGASMSKKELDEILKFGTEDLFKEKDE----------NEDDHKIVYDDGAIDRLIDRSQQGIEEKE-DMMTDYLSSFKVAHYSKREVSVNXXXXXXXXXETRGEIIKQDLDPADPTYWEKLLRHHYEQDQEDLSKSLGKGKRIRKQVNYSATQQEDDNWNDAVGDSDHESGSINKEEDDEEYDESRGEIIGTRRSKRERDGTKMPPLLVKVNGQLEVLGFNVRQRKAFINAVMRYGLPPMDFINSHWMVRELRCKSDRVMRAYINLFLRHLCEPESDNTDCYSDQVPREGVSRQHVLTRIGIMAVVRKKVQEFEKINGQYS 4633
            GY+TDHQDYCEVCQQGGEI+LCDTCPRA+HLVCLDPELE+APEG WSCPHCEKEG+   ++                     +P  EE+D+H EFC  CKDGG+L+CC  CP SYH  CL PPL EIP G WLCPRC C PLK KV KIL W W EPP   +       K ++   NP    GR   P REFFVK+  LSYW+C W++ELQL+++H ++ RNY +KNDMDEPP  + GS  +     + K  DP    +EERFY++ ++PEWM +HRI++H   R+  + YLIKWRDL YD+CTWE  D  ++V +       Y   R+   G+  +     K   + +E   ++ PP+ P  D   +   QP YI  TGG LH YQLEGLNWLRFS+    DTILADEMGLGKT+QTI FLYSLYKEGHSKGPFLV+APLST+INWEREFE WAPDFYVVTY GDKDSRA++RE+EF++E+ A+++ +   RM++ T  KFHVLLTSYELI+IDQA+LGSISW  LVVDEAHRLKNNQSKFFRIL+ YKI YKLLLTGTPLQNNLEELFHLL+F+TP++FN+++GFL+EFADISKE+Q+K+LH++LG H+LRRLKADV  +MP+K E IVRVELSPMQ K+YK+ILTRNF+AL+ KGGG+Q+SL+NI+MDLKKCCNHPYLFP  + EAP L NG+Y+G  L+K+SGKL LL KML KLK  GHRVLIFSQMT++LD+LEDF+++ GYK+ERIDG +TG  RQ++IDRFNAP +  F FLLSTRAGGLGINLA+ADTVIIYDSDWNPHNDIQAFSRAHRIGQ+ KVMIYRFVTR +VEER+TQVAK+KMMLTHLVVRPGLG K G SMSK+ELD+ILKFGTE+LFK++ E           E+   I YDD AI +L+DRSQ   E+ +   M +YLSSFKVA Y  +E            EE   EIIKQ+ +  DP YWEKLLRHHYEQ QEDL+++LGKGKRIRKQVNY+ T QED  W D + D+  E    +++ED++  +   G    +RR  +      +PPLL +V G +EVLGFN RQRKAF+NA+MR+G+PP D  NSHW+VR+LR KS+R  RAY++LF+RHLCEP +D  + ++D VPREG+SRQHVLTRIG+M++VRKKVQEFE +NG+ S
Sbjct:  286 GYETDHQDYCEVCQQGGEIILCDTCPRAYHLVCLDPELEKAPEGKWSCPHCEKEGIQWEAKDEE--------------EDEEEPVGEEEDDHMEFCRVCKDGGELLCCDTCPSSYHIHCLNPPLPEIPNGEWLCPRCMCPPLKGKVQKILHWTWGEPPLPAEPPAGPDGKPSDPLSNPPL-KGR---PEREFFVKWAGLSYWHCSWVSELQLELYHTVMYRNYQRKNDMDEPPPYDYGSGEEEINNEKRKSKDPQYAVMEERFYRYGIKPEWMVMHRILNHSFDRDGDVHYLIKWRDLPYDQCTWEVDD--FDVPEYDSHKACYWDHREQILGEDQRPLVVRKGKKLREEHQKREAPPDAPIIDPTIKFEHQPWYINATGGTLHPYQLEGLNWLRFSWAQGTDTILADEMGLGKTVQTIVFLYSLYKEGHSKGPFLVSAPLSTIINWEREFEMWAPDFYVVTYTGDKDSRAIIRENEFTFEDSAVKSGRKVFRMKKDTPIKFHVLLTSYELITIDQAILGSISWACLVVDEAHRLKNNQSKFFRILNGYKIYYKLLLTGTPLQNNLEELFHLLNFLTPDRFNNLEGFLEEFADISKEDQIKKLHDLLGPHMLRRLKADVFKNMPAKTELIVRVELSPMQKKYYKFILTRNFEALNSKGGGNQVSLLNIMMDLKKCCNHPYLFPVAAVEAPVLPNGSYDGNLLVKSSGKLTLLQKMLKKLKDEGHRVLIFSQMTKMLDLLEDFLEFEGYKYERIDGGITGGLRQEAIDRFNAPGAQQFCFLLSTRAGGLGINLASADTVIIYDSDWNPHNDIQAFSRAHRIGQNKKVMIYRFVTRGSVEERITQVAKRKMMLTHLVVRPGLGSKTG-SMSKQELDDILKFGTEELFKDEMEAARTMGDNKDGEEGSVIHYDDDAISKLLDRSQDATEDTDIQNMNEYLSSFKVAQYVVKEEDGE--------EEVEREIIKQE-ENVDPDYWEKLLRHHYEQQQEDLARNLGKGKRIRKQVNYNDTTQEDQEWQDDLSDNQSEYSVGSEDEDEDFEERPEGGRRQSRRQLKNEKDKPLPPLLARVGGSIEVLGFNARQRKAFLNAIMRWGMPPQDAFNSHWLVRDLRGKSEREFRAYVSLFMRHLCEPGADGAETFADGVPREGLSRQHVLTRIGVMSLVRKKVQEFEHVNGKLS 1439          

HSP 2 Score: 255.373 bits (651), Expect = 1.181e-67
Identity = 134/217 (61.75%), Postives = 165/217 (76.04%), Query Frame = -1
Query:  239 KFMFNIADGGFTELHTIWQNEQRALVEGHE-QDIWHRKHDYWLLAGVVAHGYGRWQDIHNDVRFAIVNEPFRNEQQKPNYLEIKNRFLARRFKLLEQALTIEEQLRRAAQLNLTYAPNDQVQNLNRRFTELECLATSQQNVYTEAVQGNKTLVPVLHRVLTQLEDLLSDMKQDXXXXXXXXXXXXXXSQRLNLTQTNLIQKLTVQMQQTKPQ---PP 877
            KFMFNIADGGFTELHT+WQ E+RA     +  DIWHR+HDYWLLAG+V HGY RWQDI ND R+AI+NEPF++E  K NYLE+KN+FLARRFKLLEQAL IEEQLRRAA LN+T  P+     LN RFTE+ECLA S Q++  E++ GNK    VLH+VL QLE+LLSDMK DV RLP  L+R+ PVS RL +++ +++ +LT +  +  PQ   PP
Sbjct: 1562 KFMFNIADGGFTELHTLWQTEERAATSSPKMHDIWHRRHDYWLLAGIVTHGYARWQDIQNDPRYAILNEPFKSEMHKGNYLEMKNKFLARRFKLLEQALVIEEQLRRAAYLNMTQDPSHPAMALNTRFTEVECLAESHQHLSKESLAGNKPANAVLHKVLNQLEELLSDMKADVTRLPNMLSRIPPVSARLQMSERSILSRLTSRGGEPPPQQVRPP 1778          

HSP 3 Score: 53.1434 bits (126), Expect = 4.846e-6
Identity = 23/65 (35.38%), Postives = 38/65 (58.46%), Query Frame = -3
Query: 5280 LCEEMGIANVEVSYRMDDFENWTIQRLFDQYMRPKLEEKNPHATSDDIQRVLDAKWKEFALLNPY 5474
            L  E G+ +V+  +  DD++  T  + F Q++RP + +KNP      +  VL AKW+EF+  NP+
Sbjct:  104 LMHEWGLEDVQYGFTEDDYKTITNYKAFSQFLRPLIAKKNPKIPMSKMMTVLGAKWREFSANNPF 168          
BLAST of chromodomain helicase DNA-binding protein 4 vs. Planmine SMEST
Match: SMESG000068192.1 (SMESG000068192.1)

HSP 1 Score: 3022.65 bits (7835), Expect = 0.000e+0
Identity = 1586/1586 (100.00%), Postives = 1586/1586 (100.00%), Query Frame = -1
Query:  104 LVVGSNDTSDEEFERXXXXXXXXXXXXXERLRQRKLVTKGKRSHPEDPIVLDQEQEEANKKKTLHHRTTSKYPLMSGYDTDHQDYCEVCQQGGEIMLCDTCPRAFHLVCLDPELEEAPEGSWSCPHCEKEGVVAASRSTTPATGGDMSQNPQNIRKSAQPNEEEKDEHQEFCNECKDGGDLICCAKCPVSYHPECLYPPLSEIPEGPWLCPRCGCGPLKAKVHKILTWRWMEPPKGKDELDHTHKSTEVEKNPTGGHGRQRAPMREFFVKFRDLSYWNCEWLTELQLDVHHPILLRNYFKKNDMDEPPAPEDGSTYKGRAREKVADPHNLEERFYKWSVRPEWMQIHRIIDHMTHRNNSIWYLIKWRDLAYDECTWEQLDGEYEVIDMKHLVEEYHIMRKLFTGDIYKKKFKNSSXXXXXXXXXXXXXXPTTDLKKRMSKQPDYIEETGGKLHQYQLEGLNWLRFSFGNVVDTILADEMGLGKTIQTITFLYSLYKEGHSKGPFLVAAPLSTVINWEREFEFWAPDFYVVTYVGDKDSRAVVREHEFSYEEGAMRTSKHACRMRQGTRTKFHVLLTSYELISIDQALLGSISWEVLVVDEAHRLKNNQSKFFRILSSYKINYKLLLTGTPLQNNLEELFHLLHFMTPEKFNDMQGFLDEFADISKEEQVKRLHEILGEHLLRRLKADVLTDMPSKGEFIVRVELSPMQAKFYKYILTRNFDALSVKGGGSQISLINIVMDLKKCCNHPYLFPSGSDEAPKLRNGAYEGLALIKASGKLELLYKMLPKLKTGGHRVLIFSQMTRLLDILEDFMDYMGYKFERIDGAVTGQQRQDSIDRFNAPDSVSFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQSNKVMIYRFVTRNTVEERVTQVAKKKMMLTHLVVRPGLGGKGGASMSKKELDEILKFGTEDLFKEKDENEDDHKIVYDDGAIDRLIDRSQQGIEEKEDMMTDYLSSFKVAHYSKREVSVNXXXXXXXXXETRGEIIKQDLDPADPTYWEKLLRHHYEQDQEDLSKSLGKGKRIRKQVNYSATQQEDDNWNDAVGDSDHESGSINKEEDDEEYDESRGEIIGTRRSKRERDGTKMPPLLVKVNGQLEVLGFNVRQRKAFINAVMRYGLPPMDFINSHWMVRELRCKSDRVMRAYINLFLRHLCEPESDNTDCYSDQVPREGVSRQHVLTRIGIMAVVRKKVQEFEKINGQYSXXXXXXXXXXXXXXXXXXXXXXKLEPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGVEXXXXXXXQDAVMSEADECNKIVINKFMFNIADGGFTELHTIWQNEQRALVEGHEQDIWHRKHDYWLLAGVVAHGYGRWQDIHNDVRFAIVNEPFRNEQQKPNYLEIKNRFLARRFKLLEQALTIEEQLRRAAQLNLTYAPNDQVQNLNRRFTELECLATSQQNVYTEAVQGNKTLVPVLHRVLTQLEDLLSDMKQDXXXXXXXXXXXXXXSQRLNLTQTNLIQKLTVQMQQTKPQPPAICESDLPEIPNNGTSSIDQSINKVLDLKSNEAPVPAVISMVELK 4861
            LVVGSNDTSDEEFERQLQEADIAAAQEEERLRQRKLVTKGKRSHPEDPIVLDQEQEEANKKKTLHHRTTSKYPLMSGYDTDHQDYCEVCQQGGEIMLCDTCPRAFHLVCLDPELEEAPEGSWSCPHCEKEGVVAASRSTTPATGGDMSQNPQNIRKSAQPNEEEKDEHQEFCNECKDGGDLICCAKCPVSYHPECLYPPLSEIPEGPWLCPRCGCGPLKAKVHKILTWRWMEPPKGKDELDHTHKSTEVEKNPTGGHGRQRAPMREFFVKFRDLSYWNCEWLTELQLDVHHPILLRNYFKKNDMDEPPAPEDGSTYKGRAREKVADPHNLEERFYKWSVRPEWMQIHRIIDHMTHRNNSIWYLIKWRDLAYDECTWEQLDGEYEVIDMKHLVEEYHIMRKLFTGDIYKKKFKNSSIPKEIILKKIPPEHPTTDLKKRMSKQPDYIEETGGKLHQYQLEGLNWLRFSFGNVVDTILADEMGLGKTIQTITFLYSLYKEGHSKGPFLVAAPLSTVINWEREFEFWAPDFYVVTYVGDKDSRAVVREHEFSYEEGAMRTSKHACRMRQGTRTKFHVLLTSYELISIDQALLGSISWEVLVVDEAHRLKNNQSKFFRILSSYKINYKLLLTGTPLQNNLEELFHLLHFMTPEKFNDMQGFLDEFADISKEEQVKRLHEILGEHLLRRLKADVLTDMPSKGEFIVRVELSPMQAKFYKYILTRNFDALSVKGGGSQISLINIVMDLKKCCNHPYLFPSGSDEAPKLRNGAYEGLALIKASGKLELLYKMLPKLKTGGHRVLIFSQMTRLLDILEDFMDYMGYKFERIDGAVTGQQRQDSIDRFNAPDSVSFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQSNKVMIYRFVTRNTVEERVTQVAKKKMMLTHLVVRPGLGGKGGASMSKKELDEILKFGTEDLFKEKDENEDDHKIVYDDGAIDRLIDRSQQGIEEKEDMMTDYLSSFKVAHYSKREVSVNEDDEDDDDEETRGEIIKQDLDPADPTYWEKLLRHHYEQDQEDLSKSLGKGKRIRKQVNYSATQQEDDNWNDAVGDSDHESGSINKEEDDEEYDESRGEIIGTRRSKRERDGTKMPPLLVKVNGQLEVLGFNVRQRKAFINAVMRYGLPPMDFINSHWMVRELRCKSDRVMRAYINLFLRHLCEPESDNTDCYSDQVPREGVSRQHVLTRIGIMAVVRKKVQEFEKINGQYSMPEYAPKEEMEEPMKVEMEAEPKLEPTAITTITSIGTVTAIAAATATAEPIITTPIAVAGVEQQQQQQQQDAVMSEADECNKIVINKFMFNIADGGFTELHTIWQNEQRALVEGHEQDIWHRKHDYWLLAGVVAHGYGRWQDIHNDVRFAIVNEPFRNEQQKPNYLEIKNRFLARRFKLLEQALTIEEQLRRAAQLNLTYAPNDQVQNLNRRFTELECLATSQQNVYTEAVQGNKTLVPVLHRVLTQLEDLLSDMKQDVARLPASLARLAPVSQRLNLTQTNLIQKLTVQMQQTKPQPPAICESDLPEIPNNGTSSIDQSINKVLDLKSNEAPVPAVISMVELK
Sbjct:  283 LVVGSNDTSDEEFERQLQEADIAAAQEEERLRQRKLVTKGKRSHPEDPIVLDQEQEEANKKKTLHHRTTSKYPLMSGYDTDHQDYCEVCQQGGEIMLCDTCPRAFHLVCLDPELEEAPEGSWSCPHCEKEGVVAASRSTTPATGGDMSQNPQNIRKSAQPNEEEKDEHQEFCNECKDGGDLICCAKCPVSYHPECLYPPLSEIPEGPWLCPRCGCGPLKAKVHKILTWRWMEPPKGKDELDHTHKSTEVEKNPTGGHGRQRAPMREFFVKFRDLSYWNCEWLTELQLDVHHPILLRNYFKKNDMDEPPAPEDGSTYKGRAREKVADPHNLEERFYKWSVRPEWMQIHRIIDHMTHRNNSIWYLIKWRDLAYDECTWEQLDGEYEVIDMKHLVEEYHIMRKLFTGDIYKKKFKNSSIPKEIILKKIPPEHPTTDLKKRMSKQPDYIEETGGKLHQYQLEGLNWLRFSFGNVVDTILADEMGLGKTIQTITFLYSLYKEGHSKGPFLVAAPLSTVINWEREFEFWAPDFYVVTYVGDKDSRAVVREHEFSYEEGAMRTSKHACRMRQGTRTKFHVLLTSYELISIDQALLGSISWEVLVVDEAHRLKNNQSKFFRILSSYKINYKLLLTGTPLQNNLEELFHLLHFMTPEKFNDMQGFLDEFADISKEEQVKRLHEILGEHLLRRLKADVLTDMPSKGEFIVRVELSPMQAKFYKYILTRNFDALSVKGGGSQISLINIVMDLKKCCNHPYLFPSGSDEAPKLRNGAYEGLALIKASGKLELLYKMLPKLKTGGHRVLIFSQMTRLLDILEDFMDYMGYKFERIDGAVTGQQRQDSIDRFNAPDSVSFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQSNKVMIYRFVTRNTVEERVTQVAKKKMMLTHLVVRPGLGGKGGASMSKKELDEILKFGTEDLFKEKDENEDDHKIVYDDGAIDRLIDRSQQGIEEKEDMMTDYLSSFKVAHYSKREVSVNEDDEDDDDEETRGEIIKQDLDPADPTYWEKLLRHHYEQDQEDLSKSLGKGKRIRKQVNYSATQQEDDNWNDAVGDSDHESGSINKEEDDEEYDESRGEIIGTRRSKRERDGTKMPPLLVKVNGQLEVLGFNVRQRKAFINAVMRYGLPPMDFINSHWMVRELRCKSDRVMRAYINLFLRHLCEPESDNTDCYSDQVPREGVSRQHVLTRIGIMAVVRKKVQEFEKINGQYSMPEYAPKEEMEEPMKVEMEAEPKLEPTAITTITSIGTVTAIAAATATAEPIITTPIAVAGVEQQQQQQQQDAVMSEADECNKIVINKFMFNIADGGFTELHTIWQNEQRALVEGHEQDIWHRKHDYWLLAGVVAHGYGRWQDIHNDVRFAIVNEPFRNEQQKPNYLEIKNRFLARRFKLLEQALTIEEQLRRAAQLNLTYAPNDQVQNLNRRFTELECLATSQQNVYTEAVQGNKTLVPVLHRVLTQLEDLLSDMKQDVARLPASLARLAPVSQRLNLTQTNLIQKLTVQMQQTKPQPPAICESDLPEIPNNGTSSIDQSINKVLDLKSNEAPVPAVISMVELK 1868          

HSP 2 Score: 330.102 bits (845), Expect = 1.089e-90
Identity = 251/251 (100.00%), Postives = 251/251 (100.00%), Query Frame = -3
Query: 4956 MDDIYDVSNGSEINEEFXXXXXXXXXXXXXXXXXXXXXXXKRGRVKRKKESDDEFITEPPSKRRSSRAIKHKEKTVEGLCEEMGIANVEVSYRMDDFENWTIQRLFDQYMRPKLEEKNPHATSDDIQRVLDAKWKEFALLNPYIPKXXXXXXXXXXXXXXDAESDSIEKMITAEIXXXXXXXXXXXXXXXXXXXXXXXXXXXSKPGKGKEKVEVDISMEVSAGEDEIPTVDIPIESDQEPVASPSSSSNLI 5708
            MDDIYDVSNGSEINEEFDDISIDVKKSKKRKSKSDIKESKKRGRVKRKKESDDEFITEPPSKRRSSRAIKHKEKTVEGLCEEMGIANVEVSYRMDDFENWTIQRLFDQYMRPKLEEKNPHATSDDIQRVLDAKWKEFALLNPYIPKTEDENDENGEETLEDAESDSIEKMITAEISKKARGGKSRGRGRGRGRRTTVTPRGRSKPGKGKEKVEVDISMEVSAGEDEIPTVDIPIESDQEPVASPSSSSNLI
Sbjct:    1 MDDIYDVSNGSEINEEFDDISIDVKKSKKRKSKSDIKESKKRGRVKRKKESDDEFITEPPSKRRSSRAIKHKEKTVEGLCEEMGIANVEVSYRMDDFENWTIQRLFDQYMRPKLEEKNPHATSDDIQRVLDAKWKEFALLNPYIPKTEDENDENGEETLEDAESDSIEKMITAEISKKARGGKSRGRGRGRGRRTTVTPRGRSKPGKGKEKVEVDISMEVSAGEDEIPTVDIPIESDQEPVASPSSSSNLI 251          
BLAST of chromodomain helicase DNA-binding protein 4 vs. Planmine SMEST
Match: SMESG000068192.1 (SMESG000068192.1)

HSP 1 Score: 3018.02 bits (7823), Expect = 0.000e+0
Identity = 1585/1586 (99.94%), Postives = 1585/1586 (99.94%), Query Frame = -1
Query:  104 LVVGSNDTSDEEFERXXXXXXXXXXXXXERLRQRKLVTKGKRSHPEDPIVLDQEQEEANKKKTLHHRTTSKYPLMSGYDTDHQDYCEVCQQGGEIMLCDTCPRAFHLVCLDPELEEAPEGSWSCPHCEKEGVVAASRSTTPATGGDMSQNPQNIRKSAQPNEEEKDEHQEFCNECKDGGDLICCAKCPVSYHPECLYPPLSEIPEGPWLCPRCGCGPLKAKVHKILTWRWMEPPKGKDELDHTHKSTEVEKNPTGGHGRQRAPMREFFVKFRDLSYWNCEWLTELQLDVHHPILLRNYFKKNDMDEPPAPEDGSTYKGRAREKVADPHNLEERFYKWSVRPEWMQIHRIIDHMTHRNNSIWYLIKWRDLAYDECTWEQLDGEYEVIDMKHLVEEYHIMRKLFTGDIYKKKFKNSSXXXXXXXXXXXXXXPTTDLKKRMSKQPDYIEETGGKLHQYQLEGLNWLRFSFGNVVDTILADEMGLGKTIQTITFLYSLYKEGHSKGPFLVAAPLSTVINWEREFEFWAPDFYVVTYVGDKDSRAVVREHEFSYEEGAMRTSKHACRMRQGTRTKFHVLLTSYELISIDQALLGSISWEVLVVDEAHRLKNNQSKFFRILSSYKINYKLLLTGTPLQNNLEELFHLLHFMTPEKFNDMQGFLDEFADISKEEQVKRLHEILGEHLLRRLKADVLTDMPSKGEFIVRVELSPMQAKFYKYILTRNFDALSVKGGGSQISLINIVMDLKKCCNHPYLFPSGSDEAPKLRNGAYEGLALIKASGKLELLYKMLPKLKTGGHRVLIFSQMTRLLDILEDFMDYMGYKFERIDGAVTGQQRQDSIDRFNAPDSVSFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQSNKVMIYRFVTRNTVEERVTQVAKKKMMLTHLVVRPGLGGKGGASMSKKELDEILKFGTEDLFKEKDENEDDHKIVYDDGAIDRLIDRSQQGIEEKEDMMTDYLSSFKVAHYSKREVSVNXXXXXXXXXETRGEIIKQDLDPADPTYWEKLLRHHYEQDQEDLSKSLGKGKRIRKQVNYSATQQEDDNWNDAVGDSDHESGSINKEEDDEEYDESRGEIIGTRRSKRERDGTKMPPLLVKVNGQLEVLGFNVRQRKAFINAVMRYGLPPMDFINSHWMVRELRCKSDRVMRAYINLFLRHLCEPESDNTDCYSDQVPREGVSRQHVLTRIGIMAVVRKKVQEFEKINGQYSXXXXXXXXXXXXXXXXXXXXXXKLEPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGVEXXXXXXXQDAVMSEADECNKIVINKFMFNIADGGFTELHTIWQNEQRALVEGHEQDIWHRKHDYWLLAGVVAHGYGRWQDIHNDVRFAIVNEPFRNEQQKPNYLEIKNRFLARRFKLLEQALTIEEQLRRAAQLNLTYAPNDQVQNLNRRFTELECLATSQQNVYTEAVQGNKTLVPVLHRVLTQLEDLLSDMKQDXXXXXXXXXXXXXXSQRLNLTQTNLIQKLTVQMQQTKPQPPAICESDLPEIPNNGTSSIDQSINKVLDLKSNEAPVPAVISMVELK 4861
            LVVGSNDTSDEEFERQLQEADIAAAQEEERLRQRKLVTKGKRSHPEDPIVLDQEQEEANKKKTLHHRTTSKYPLMSGYDTDHQDYCEVCQQGGEIMLCDTCPRAFHLVCLDPELEEAPEGSWSCPHCEKEGVVAASRSTTPATGGDMSQNPQNIRKSAQPNEEEKDEHQEFCNECKDGGDLICCAKCPVSYHPECLYPPLSEIPEGPWLCPRCGCGPLKAKVHKILTWRWMEPPKGKDELDHTHKSTEVEKNPTGGHGRQRAPMREFFVKFRDLSYWNCEWLTELQLDVHHPILLRNYFKKNDMDEPPAPEDGSTYKGRAREKVADPHNLEERFYKWSVRPEWMQIHRIIDHMTHRNNSIWYLIKWRDLAYDECTWEQLDGEYEVIDMKHLVEEYHIMRKLFTGDIYKKKFKNSSIPKEIILKKIPPEHPTTDLKKRMSKQPDYIEETGGKLHQYQLEGLNWLRFSFGNVVDTILADEMGLGKTIQTITFLYSLYKEGHSKGPFLVAAPLSTVINWEREFEFWAPDFYVVTYVGDKDSRAVVREHEFSYEEGAMRTSKHACRMRQGTRTKFHVLLTSYELISIDQALLGSISWEVLVVDEAHRLKNNQSKFFRILSSYKINYKLLLTGTPLQNNLEELFHLLHFMTPEKFNDMQGFLDEFADISKEEQVKRLHEILGEHLLRRLKADVLTDMPSKGEFIVRVELSPMQAKFYKYILTRNFDALSVKGGGSQISLINIVMDLKKCCNHPYLFPSGSDEAPKLRNGAYEGLALIKASGKLELLYKMLPKLKTGGHRVLIFSQMTRLLDILEDFMDYMGYKFERIDGAVTGQQRQDSIDRFNAPDSVSFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQSNKVMIYRFVTRNTVEERVTQVAKKKMMLTHLVVRPGLGGKGGASMSKKELDEILKFGTEDLFKEKDEN DDHKIVYDDGAIDRLIDRSQQGIEEKEDMMTDYLSSFKVAHYSKREVSVNEDDEDDDDEETRGEIIKQDLDPADPTYWEKLLRHHYEQDQEDLSKSLGKGKRIRKQVNYSATQQEDDNWNDAVGDSDHESGSINKEEDDEEYDESRGEIIGTRRSKRERDGTKMPPLLVKVNGQLEVLGFNVRQRKAFINAVMRYGLPPMDFINSHWMVRELRCKSDRVMRAYINLFLRHLCEPESDNTDCYSDQVPREGVSRQHVLTRIGIMAVVRKKVQEFEKINGQYSMPEYAPKEEMEEPMKVEMEAEPKLEPTAITTITSIGTVTAIAAATATAEPIITTPIAVAGVEQQQQQQQQDAVMSEADECNKIVINKFMFNIADGGFTELHTIWQNEQRALVEGHEQDIWHRKHDYWLLAGVVAHGYGRWQDIHNDVRFAIVNEPFRNEQQKPNYLEIKNRFLARRFKLLEQALTIEEQLRRAAQLNLTYAPNDQVQNLNRRFTELECLATSQQNVYTEAVQGNKTLVPVLHRVLTQLEDLLSDMKQDVARLPASLARLAPVSQRLNLTQTNLIQKLTVQMQQTKPQPPAICESDLPEIPNNGTSSIDQSINKVLDLKSNEAPVPAVISMVELK
Sbjct:  283 LVVGSNDTSDEEFERQLQEADIAAAQEEERLRQRKLVTKGKRSHPEDPIVLDQEQEEANKKKTLHHRTTSKYPLMSGYDTDHQDYCEVCQQGGEIMLCDTCPRAFHLVCLDPELEEAPEGSWSCPHCEKEGVVAASRSTTPATGGDMSQNPQNIRKSAQPNEEEKDEHQEFCNECKDGGDLICCAKCPVSYHPECLYPPLSEIPEGPWLCPRCGCGPLKAKVHKILTWRWMEPPKGKDELDHTHKSTEVEKNPTGGHGRQRAPMREFFVKFRDLSYWNCEWLTELQLDVHHPILLRNYFKKNDMDEPPAPEDGSTYKGRAREKVADPHNLEERFYKWSVRPEWMQIHRIIDHMTHRNNSIWYLIKWRDLAYDECTWEQLDGEYEVIDMKHLVEEYHIMRKLFTGDIYKKKFKNSSIPKEIILKKIPPEHPTTDLKKRMSKQPDYIEETGGKLHQYQLEGLNWLRFSFGNVVDTILADEMGLGKTIQTITFLYSLYKEGHSKGPFLVAAPLSTVINWEREFEFWAPDFYVVTYVGDKDSRAVVREHEFSYEEGAMRTSKHACRMRQGTRTKFHVLLTSYELISIDQALLGSISWEVLVVDEAHRLKNNQSKFFRILSSYKINYKLLLTGTPLQNNLEELFHLLHFMTPEKFNDMQGFLDEFADISKEEQVKRLHEILGEHLLRRLKADVLTDMPSKGEFIVRVELSPMQAKFYKYILTRNFDALSVKGGGSQISLINIVMDLKKCCNHPYLFPSGSDEAPKLRNGAYEGLALIKASGKLELLYKMLPKLKTGGHRVLIFSQMTRLLDILEDFMDYMGYKFERIDGAVTGQQRQDSIDRFNAPDSVSFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQSNKVMIYRFVTRNTVEERVTQVAKKKMMLTHLVVRPGLGGKGGASMSKKELDEILKFGTEDLFKEKDEN-DDHKIVYDDGAIDRLIDRSQQGIEEKEDMMTDYLSSFKVAHYSKREVSVNEDDEDDDDEETRGEIIKQDLDPADPTYWEKLLRHHYEQDQEDLSKSLGKGKRIRKQVNYSATQQEDDNWNDAVGDSDHESGSINKEEDDEEYDESRGEIIGTRRSKRERDGTKMPPLLVKVNGQLEVLGFNVRQRKAFINAVMRYGLPPMDFINSHWMVRELRCKSDRVMRAYINLFLRHLCEPESDNTDCYSDQVPREGVSRQHVLTRIGIMAVVRKKVQEFEKINGQYSMPEYAPKEEMEEPMKVEMEAEPKLEPTAITTITSIGTVTAIAAATATAEPIITTPIAVAGVEQQQQQQQQDAVMSEADECNKIVINKFMFNIADGGFTELHTIWQNEQRALVEGHEQDIWHRKHDYWLLAGVVAHGYGRWQDIHNDVRFAIVNEPFRNEQQKPNYLEIKNRFLARRFKLLEQALTIEEQLRRAAQLNLTYAPNDQVQNLNRRFTELECLATSQQNVYTEAVQGNKTLVPVLHRVLTQLEDLLSDMKQDVARLPASLARLAPVSQRLNLTQTNLIQKLTVQMQQTKPQPPAICESDLPEIPNNGTSSIDQSINKVLDLKSNEAPVPAVISMVELK 1867          

HSP 2 Score: 330.102 bits (845), Expect = 1.087e-90
Identity = 251/251 (100.00%), Postives = 251/251 (100.00%), Query Frame = -3
Query: 4956 MDDIYDVSNGSEINEEFXXXXXXXXXXXXXXXXXXXXXXXKRGRVKRKKESDDEFITEPPSKRRSSRAIKHKEKTVEGLCEEMGIANVEVSYRMDDFENWTIQRLFDQYMRPKLEEKNPHATSDDIQRVLDAKWKEFALLNPYIPKXXXXXXXXXXXXXXDAESDSIEKMITAEIXXXXXXXXXXXXXXXXXXXXXXXXXXXSKPGKGKEKVEVDISMEVSAGEDEIPTVDIPIESDQEPVASPSSSSNLI 5708
            MDDIYDVSNGSEINEEFDDISIDVKKSKKRKSKSDIKESKKRGRVKRKKESDDEFITEPPSKRRSSRAIKHKEKTVEGLCEEMGIANVEVSYRMDDFENWTIQRLFDQYMRPKLEEKNPHATSDDIQRVLDAKWKEFALLNPYIPKTEDENDENGEETLEDAESDSIEKMITAEISKKARGGKSRGRGRGRGRRTTVTPRGRSKPGKGKEKVEVDISMEVSAGEDEIPTVDIPIESDQEPVASPSSSSNLI
Sbjct:    1 MDDIYDVSNGSEINEEFDDISIDVKKSKKRKSKSDIKESKKRGRVKRKKESDDEFITEPPSKRRSSRAIKHKEKTVEGLCEEMGIANVEVSYRMDDFENWTIQRLFDQYMRPKLEEKNPHATSDDIQRVLDAKWKEFALLNPYIPKTEDENDENGEETLEDAESDSIEKMITAEISKKARGGKSRGRGRGRGRRTTVTPRGRSKPGKGKEKVEVDISMEVSAGEDEIPTVDIPIESDQEPVASPSSSSNLI 251          
BLAST of chromodomain helicase DNA-binding protein 4 vs. Planmine SMEST
Match: SMESG000068193.1 (SMESG000068193.1)

HSP 1 Score: 868.226 bits (2242), Expect = 0.000e+0
Identity = 452/452 (100.00%), Postives = 452/452 (100.00%), Query Frame = 2
Query: 5810 MTNFNEIWNLLEKYSFKIDSHLLQHLKCIICGKLLIDAHESLCGCNYCQNCIESYLENGPKQCPGDSVDCKLTLLELQVNIIRSNSTNRKIVKLIVSCPFNGCNFTGELWELKDHIRICDNRSIYCPYKEIGCSQSQIPIDNISNHLTVEQFQHSQLLINFILNLKNEEVLSNSLKISQPSDMFFINKSNTSQNCKINVENIPNILQNLQEENIKLKNEIVXXXXXXXXXXXXXXXWINSKFERKHNQELSNEINRKVENNFNNGDKIQEITNNKNLKKISLDDLSTFDTSNPIQIGNNTYLKDSPMENPLNPLEVFSNQIPKFAWTISDLSKIIKKNHVVDSEHFFSKNGDLKIWLDLYTTNRKNMRIRIYISTTPVNSSLKWPLKCQVELTIKSIKIPNAFQKFSKNCYFEKPRLNSSYETFELRNLDLDNANVLQGNKILIECSLSIEN 7165
            MTNFNEIWNLLEKYSFKIDSHLLQHLKCIICGKLLIDAHESLCGCNYCQNCIESYLENGPKQCPGDSVDCKLTLLELQVNIIRSNSTNRKIVKLIVSCPFNGCNFTGELWELKDHIRICDNRSIYCPYKEIGCSQSQIPIDNISNHLTVEQFQHSQLLINFILNLKNEEVLSNSLKISQPSDMFFINKSNTSQNCKINVENIPNILQNLQEENIKLKNEIVKNKNNQEEELNKLKQWINSKFERKHNQELSNEINRKVENNFNNGDKIQEITNNKNLKKISLDDLSTFDTSNPIQIGNNTYLKDSPMENPLNPLEVFSNQIPKFAWTISDLSKIIKKNHVVDSEHFFSKNGDLKIWLDLYTTNRKNMRIRIYISTTPVNSSLKWPLKCQVELTIKSIKIPNAFQKFSKNCYFEKPRLNSSYETFELRNLDLDNANVLQGNKILIECSLSIEN
Sbjct:    1 MTNFNEIWNLLEKYSFKIDSHLLQHLKCIICGKLLIDAHESLCGCNYCQNCIESYLENGPKQCPGDSVDCKLTLLELQVNIIRSNSTNRKIVKLIVSCPFNGCNFTGELWELKDHIRICDNRSIYCPYKEIGCSQSQIPIDNISNHLTVEQFQHSQLLINFILNLKNEEVLSNSLKISQPSDMFFINKSNTSQNCKINVENIPNILQNLQEENIKLKNEIVKNKNNQEEELNKLKQWINSKFERKHNQELSNEINRKVENNFNNGDKIQEITNNKNLKKISLDDLSTFDTSNPIQIGNNTYLKDSPMENPLNPLEVFSNQIPKFAWTISDLSKIIKKNHVVDSEHFFSKNGDLKIWLDLYTTNRKNMRIRIYISTTPVNSSLKWPLKCQVELTIKSIKIPNAFQKFSKNCYFEKPRLNSSYETFELRNLDLDNANVLQGNKILIECSLSIEN 452          
BLAST of chromodomain helicase DNA-binding protein 4 vs. Planmine SMEST
Match: SMESG000069740.1 (SMESG000069740.1)

HSP 1 Score: 749.969 bits (1935), Expect = 0.000e+0
Identity = 460/1186 (38.79%), Postives = 667/1186 (56.24%), Query Frame = -1
Query: 1148 SCPHCEKEGVVAASRSTTPATGGDMSQNPQNIRKSAQPNEEEKDEHQEFCNECKDGG-----DLICCAKCPVSYHPECL----------YPPLSEIPEGPWLCPRCGCGPLKAKVHKILTWRWMEPPKGKDELDHTHKSTEVEKNPTGGHGRQRAPMREFFVKFRDLSYWNCEWLTELQLDVHHPILLRNYFKKN-DMDEPPAPEDGSTYKGRAREKVADPH-NLEERFYKWSVRPEWMQIHRIIDHMTHRNNSIWYLIKWRDLAYDECTWEQLDGEYEVIDMKHLVEEYHIMRKLFTGDIYKKKFKNSSXXXXXXXXXXXXXXPTTDLKKRMSKQPDYI----EETGGKLHQYQLEGLNWLRFSFGNVVDTILADEMGLGKTIQTITFLYSLYKEGHSKGPFLVAAPLSTVINWEREFEFWAPDFYVVTYVGDKDSRAVVREHEFSYEEGAMRTSKHACRMRQGTRTKFHVLLTSYELISIDQALLGSISWEVLVVDEAHRLKNNQSKFFRILSSYKINYKLLLTGTPLQNNLEELFHLLHFMTPEKFNDMQGFLDEFADISKEEQVKRLHEILGEHLLRRLKADVLTDMPSKGEFIVRVELSPMQAKFYKYILTRNFDALSVKGGGSQISLINIVMDLKKCCNHPYLFPSGSDEAPKLRNGAYEGLALIKASGKLELLYKMLPKLKTGGHRVLIFSQMTRLLDILEDFMDYMGYKFERIDGAVTGQQRQDSIDRFNAPDSVSFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQSNKVMIYRFVTRNTVEERVTQVAKKKMMLTHLVVRPGLGGKGGASMSKKELDEILKFGTEDLFKEKDENEDDHKIVYDDGAIDRLIDRSQQGIEEKEDMMTDY-LSSFKVAHYSKREVSVNXXXXXXXXXETRGEIIKQDLDPADPTYWEKLLRHHYE--QDQEDLSKSLGKGKRIRKQVNYSATQ---QEDDNWNDAVG------------------DSDHESG-SINKEE----DDEEYDESRGEI---IGTRRSKRERDGTKMPP--------LLVKVNGQLE------VLGFNVRQRKAFINAVMRYGLPPMDFINSH-WMVRELRCKSDRVMRAYINLFLRHLCEPESDNTDCYS--DQVPREGVSRQHVLTRIGIMAVVRKKVQEFEKIN 4495
            SC  CE  G+V   R+       D+++    ++   + ++E  D+  + C +CK+        +  C  C   YH  CL          + P +++      C RC    L  KV  I+TW+W     G               NP     +   P REF + + ++SYW+CEW++E+QL++  P L R Y +K+ D + PP  E         R K+++    L E++++W + PEW+Q H+++       + +   +KWR L Y+  + E L     +  ++  ++ +  + K  T   Y  + K+                       ++ + PDY+          LH YQLEG+NWLR S+ N ++TILADEMGLGKTIQ I+FLYSLYK+  S+GPFL+  PLST+ NWEREFEFWAPDF +V Y GDKD+R V+R+ +  Y+             ++     FHVLLT+YELI +D+  L  I+WE+L+VDEAHRLKNN++K F+ L  Y INY++L++GTPLQNNLEELF+LL+FM P  F D+ GFL +F DISKEEQV +L E+L +  LRRLK+DV  D P+K E I+RVEL+P+Q KFYK ILT+N++ALS K  G ++S  NIVM L+KCCNHPYL    S+ A +  +G+Y+  ALI ASGK ++L KML KL+  GH+VLIFS MT+LLD+LE  +++M  ++ERIDG+V+   RQ++IDRFN P+SVS VFLLST+AGGLGINL++ADTV IYD+DWNP NDIQA SRAHR+GQ  KVMIYRFVTRN++EE++ + +K+K+M+T+LVV+         S +K E  +I+ FGT+DLF E +EN +D KI+YDD AID+L+DR++   +  E    D   S FK+A Y         +D  +   +T    + +  +PAD  YW  LL    +   ++E + +  GKG R +K+VNY  TQ   + D + N++                    + DH S    N +E    +D E     G +       R  +E     + P         LV  N  L       + GF  ++R     A+M +GLPP        W    L  K+   M  ++  F+ +L E     T  +     V ++ +    +++RI I  ++  KV ++E IN
Sbjct:   65 SC-QCETCGLVFIKRTDKKIDEKDVNKCLSCVKAVKELSDEYIDDSNKICEKCKESSLSLDNRMTGCLICMKYYHVNCLLLSDRSTDLKFEP-TQLIRRKLGCIRCAVVHLCYKVSSIVTWKWRSEAIGV-------------TNP----DKYFMP-REFLIHYSNMSYWDCEWVSEVQLEISEPNLYRAYKRKSLDFNSPPPVE---ILSDSHRRKLSEQEVKLHEKYFQWGIDPEWLQPHKVLGM-----DDVGCFVKWRGLGYEFVSTEPLTRVSHINGLQEAIDRHRKLIKEITDKSYVARNKSKLT--------------------KLEESPDYLGPPSTTAKATLHPYQLEGVNWLRSSYSNNINTILADEMGLGKTIQAISFLYSLYKDKVSRGPFLITVPLSTMKNWEREFEFWAPDFCIVPYYGDKDARIVIRDKDMYYQN------------KKKNFPTFHVLLTTYELIFMDEGFLSHINWEILIVDEAHRLKNNETKLFKSLKKYNINYRMLMSGTPLQNNLEELFNLLNFMEPNSFGDISGFLSQFNDISKEEQVIKLQEMLKKRFLRRLKSDVFIDFPTKEEQIIRVELTPLQKKFYKIILTKNYEALSGKFSGVKMS--NIVMQLRKCCNHPYLL--SSEIAEETEDGSYDVPALIAASGKTDILQKMLKKLQESGHKVLIFSGMTKLLDLLEYLLEHMDIQYERIDGSVSSTSRQNAIDRFNDPNSVSMVFLLSTKAGGLGINLSSADTVFIYDADWNPQNDIQALSRAHRLGQKRKVMIYRFVTRNSIEEKIMETSKRKLMVTNLVVK---------SFTKIEFHQIISFGTKDLFDENNEN-NDQKIIYDDAAIDKLLDRNRFTSDNPETSFLDSCFSGFKMAEYQFAVDKAETEDSAEIKNKTDENSVTE--NPAD--YWAALLEPLIKNINEEESVKEEFGKGFRQKKKVNY-ITQDILKHDHHSNNSANGAHDKDPDDTDYDISEGENPDHPSSPDRNSDESFLTNDLEKKAENGRLPSKFNIDRDFKELASYGVSPDLTNQIKCELVNENTILHFKHFALINGFMPKERMEIYEALMNFGLPPKLLKKGDIWWPSALEHKTVDEMEKFLFTFMSNLVEHHESLTQQHDRISGVIKDEIDYDFIISRIAINGLINYKVSQYETIN 1171          

HSP 2 Score: 61.6178 bits (148), Expect = 9.495e-9
Identity = 39/112 (34.82%), Postives = 63/112 (56.25%), Query Frame = -1
Query:  554 FNIADGGFTELHTIW----QNEQRALVEGHEQDIWHRKHDYWLLAGVVAHGYGRWQD-IHNDVRFAIVNEPFR--NEQQKPNYLEIKNRFLARRFKLLEQALTIEEQLRRAA 868
            FNI DGGF+E+H+ W    +   RA ++      W++ HDY+LL+ + +HGY ++ D I  D ++ I+  P R  N     +  +I+  F  R+ +LLE AL IE Q+ +  
Sbjct: 1207 FNIYDGGFSEIHSDWVDYYEKYSRATLKNPTLH-WNKIHDYYLLSSIASHGYDKYIDQIFIDPQYQILFIPLRIANLDLVKDNADIRKCFRNRQ-RLLENALLIEAQIMKVG 1316          
BLAST of chromodomain helicase DNA-binding protein 4 vs. Planmine SMEST
Match: SMESG000033395.1 (SMESG000033395.1)

HSP 1 Score: 502.671 bits (1293), Expect = 2.795e-151
Identity = 294/683 (43.05%), Postives = 408/683 (59.74%), Query Frame = -1
Query: 1847 MQIHRIIDHMTHRN-NSIWYLIKWRDLAYDECTWEQLDGEYEVIDMKHLVEEYHIMRKLFTGDIYKKKFKNSSXXXXXXXXXXXXXXPTTDLKKR-----MSKQPDYIEETGG-KLHQYQLEGLNWLRFSFGNVVDTILADEMGLGKTIQTITFLYSLYKEGHSKGPFLVAAPLSTVINWEREFEFWAPDFYVVTYVGDKDSRAVVREHEFSYEEGAMRTSKHACRMRQGTRTKFHVLLTSYELISIDQALLGSISWEVLVVDEAHRLKNNQSKFFRILSSYKINYKLLLTGTPLQNNLEELFHLLHFMTPEKFNDMQGFLDEFADISKE-----EQVKRLHEILGEHLLRRLKADVLTDMPSKGEFIVRVELSPMQAKFYKYILTRNFDALSVKGGGSQISLINIVMDLKKCCNHPYLFPSGSDEAPKLRNGAYEGLALIKASGKLELLYKMLPKLKTGGHRVLIFSQMTRLLDILEDFMDYMGYKFERIDGAVTGQQRQDSIDRFNAPDSVSFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQSNKVMIYRFVTRNTVEERVTQVAKKKMMLTHLVVR---PGLGGKGGAS----MSKKELDEILKFGTEDLFKEKDENEDDHKIVYDDGAIDRLIDRSQQGI--EEKEDMMTDYLSSFKVAHYSK 3832
            M+  RIID   ++N +S+ YLIKW+ L Y   TWE  D                I++ LF   I + + ++ S+       +         L +R     + +QPDY+  T   KL  YQL+G+NWL  ++      ILADEMGLGKTIQTI FL  L+ +    GPFL+  PLST+ +W+ EF  WAP   ++ Y GD  SR V+RE E+ + +  M               KFHV +T+YEL+  D+  L  ISW  L VDEAHRLKN++S+ +  L ++  N +LL+TGTP+ N+L EL+ LLHF+ P+KFN    F D + +IS E     E V  L+++L   LLRR K DV   +PSK E I+RV +   Q + YK ILT+N++ALS +  G   S +NIVM+LKKCCNH  L     +E     +        IK+SGK+ LL K++ +LK  GHRVLIFSQM R+LDI+ D++   G+ F+R+DG++ G  R+ +ID FNA  S  F FLLSTRAGGLGINLATADTVII+DSDWNP ND+QA +RAHRIGQ  +V +YRFV +N++EE++ + AK+KM+L HLV++     L  K  A+     SK EL+EILKFG  DLF     N+D+      +  I  ++ R++     +E  +   D LS+FKV + ++
Sbjct:  314 MECERIIDAQRNKNSDSLDYLIKWKTLDYRYSTWESGDI---------------IVKNLFPNGIIEFEERSRSVKIPNRKCEA--------LTRRPKFAPIREQPDYLSHTSDMKLRDYQLDGVNWLAHAWTRGNSVILADEMGLGKTIQTIGFLSYLFNQHTIFGPFLLVVPLSTISSWQTEFNIWAPYMNIIIYTGDAVSRQVIRECEWYFPKKKM--------------LKFHVCITTYELLLKDKDWLNKISWAFLGVDEAHRLKNDESQLYNFLITFDTNTRLLITGTPVHNSLRELWALLHFIMPDKFNTWPDFEDRY-NISNENREVEEVVSELYKVLEPFLLRRTKKDVEKSLPSKSEQIIRVPMCRKQTELYKLILTKNYEALSKETRGHTSSFLNIVMELKKCCNHVQLVNPLDEETENKMDPDSHLRYYIKSSGKMMLLDKLMFELKEKGHRVLIFSQMVRMLDIISDYLVLRGWGFQRLDGSIKGSLRKQAIDHFNAEGSTDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAMARAHRIGQKRQVSVYRFVIKNSIEEKIIECAKRKMVLDHLVIQRMDSALHRKTDANKNQPFSKDELNEILKFGAADLF-----NQDEELDEEQELNIQDILQRAETTNHDDESHNPANDLLSAFKVVNITE 953          
The following BLAST results are available for this feature:
BLAST of chromodomain helicase DNA-binding protein 4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CHD42.736e-6560.17chromodomain helicase DNA binding protein 4 [Sourc... [more]
CHD49.802e-6460.17chromodomain helicase DNA binding protein 4 [Sourc... [more]
CHD42.802e-6560.17chromodomain helicase DNA binding protein 4 [Sourc... [more]
CHD42.878e-6560.17chromodomain helicase DNA binding protein 4 [Sourc... [more]
CHD42.907e-6560.17chromodomain helicase DNA binding protein 4 [Sourc... [more]
back to top
BLAST of chromodomain helicase DNA-binding protein 4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chd-31.977e-5154.51Chromodomain-helicase-DNA-binding protein 3 homolo... [more]
let-4184.282e-5253.63pep chromosome:WBcel235:V:5826833:5832866:1 gene:W... [more]
chd-11.635e-14538.12Chromodomain and Helicase Domain protein [Source:... [more]
chd-72.070e-13535.96Chromodomain and Helicase Domain protein [Source:... [more]
isw-15.252e-11740.61Chromatin-remodeling complex ATPase chain isw-1 [... [more]
back to top
BLAST of chromodomain helicase DNA-binding protein 4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mi-22.671e-7058.89gene:FBgn0262519 transcript:FBtr0332152[more]
Mi-22.579e-7058.89gene:FBgn0262519 transcript:FBtr0074919[more]
Mi-22.579e-7058.89gene:FBgn0262519 transcript:FBtr0302046[more]
Mi-23.032e-7058.89gene:FBgn0262519 transcript:FBtr0100394[more]
Chd31.105e-1052.02gene:FBgn0023395 transcript:FBtr0074998[more]
back to top
BLAST of chromodomain helicase DNA-binding protein 4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chd4a2.086e-6561.45chromodomain helicase DNA binding protein 4a [Sour... [more]
chd51.013e-6761.02chromodomain helicase DNA binding protein 5 [Sourc... [more]
chd4b6.071e-6660.56chromodomain helicase DNA binding protein 4b [Sour... [more]
chd4b6.071e-6660.56chromodomain helicase DNA binding protein 4b [Sour... [more]
chd4a5.964e-6660.56chromodomain helicase DNA binding protein 4a [Sour... [more]
back to top
BLAST of chromodomain helicase DNA-binding protein 4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
son9.818e-6660.59SON DNA binding protein [Source:Xenbase;Acc:XB-GEN... [more]
son1.620e-6560.59SON DNA binding protein [Source:Xenbase;Acc:XB-GEN... [more]
son2.211e-6360.51SON DNA binding protein [Source:Xenbase;Acc:XB-GEN... [more]
son1.847e-6560.59SON DNA binding protein [Source:Xenbase;Acc:XB-GEN... [more]
son1.733e-6560.58SON DNA binding protein [Source:Xenbase;Acc:XB-GEN... [more]
back to top
BLAST of chromodomain helicase DNA-binding protein 4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Chd53.545e-6661.25chromodomain helicase DNA binding protein 5 [Sourc... [more]
Chd42.594e-6460.17chromodomain helicase DNA binding protein 4 [Sourc... [more]
Chd42.630e-6460.17chromodomain helicase DNA binding protein 4 [Sourc... [more]
Chd52.624e-6659.39chromodomain helicase DNA binding protein 5 [Sourc... [more]
Chd52.771e-6659.39chromodomain helicase DNA binding protein 5 [Sourc... [more]
back to top
BLAST of chromodomain helicase DNA-binding protein 4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6PDQ2|CHD4_MOUSE1.815e-6360.17Chromodomain-helicase-DNA-binding protein 4 OS=Mus... [more]
sp|Q14839|CHD4_HUMAN1.346e-6460.17Chromodomain-helicase-DNA-binding protein 4 OS=Hom... [more]
sp|Q8TDI0|CHD5_HUMAN9.741e-6559.39Chromodomain-helicase-DNA-binding protein 5 OS=Hom... [more]
sp|A2A8L1|CHD5_MOUSE1.939e-6559.39Chromodomain-helicase-DNA-binding protein 5 OS=Mus... [more]
sp|D3ZD32|CHD5_RAT1.571e-6559.31Chromodomain-helicase-DNA-binding protein 5 OS=Rat... [more]
back to top
BLAST of chromodomain helicase DNA-binding protein 4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
D5LXF24.771e-87100.00Chromodomain helicase DNA-binding protein 4 OS=Sch... [more]
A0A087W0W98.521e-7564.11Chromodomain helicase DNA binding protein 4 OS=Ech... [more]
W6UI631.824e-7463.51Chromodomain-helicase-DNA-binding protein OS=Echin... [more]
A0A564YNJ91.006e-6963.50Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A3P7WDC49.890e-7062.57Uncharacterized protein OS=Rodentolepis nana OX=10... [more]
back to top
BLAST of chromodomain helicase DNA-binding protein 4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chd4a5.339e-6761.22chromodomain helicase DNA binding protein 4a [Sour... [more]
ENSAMXT00000010902.27.385e-6560.02pep primary_assembly:Astyanax_mexicanus-2.0:10:250... [more]
chd53.476e-6661.38chromodomain helicase DNA binding protein 5 [Sourc... [more]
chd24.892e-15441.61chromodomain helicase DNA binding protein 2 [Sourc... [more]
chd29.746e-15441.61chromodomain helicase DNA binding protein 2 [Sourc... [more]
back to top
BLAST of chromodomain helicase DNA-binding protein 4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000004254.11.081e-14847.54pep scaffold:Pmarinus_7.0:GL484668:1435:12215:1 ge... [more]
ENSPMAT00000006729.15.979e-13436.20pep scaffold:Pmarinus_7.0:GL476370:400098:484196:-... [more]
SMARCA51.697e-13342.65SWI/SNF related, matrix associated, actin dependen... [more]
SMARCA52.646e-13342.17SWI/SNF related, matrix associated, actin dependen... [more]
ENSPMAT00000006707.11.603e-11039.30pep scaffold:Pmarinus_7.0:GL476370:281119:459539:-... [more]
back to top
BLAST of chromodomain helicase DNA-binding protein 4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
CHD13.207e-14643.84Chromatin remodeler that regulates various aspects... [more]
ISW21.932e-13043.37ATP-dependent DNA translocase involved in chromati... [more]
ISW11.077e-12145.12ATPase subunit of imitation-switch (ISWI) class ch... [more]
SNF22.917e-11442.42Catalytic subunit of the SWI/SNF chromatin remodel... [more]
STH15.360e-11443.24ATPase component of the RSC chromatin remodeling c... [more]
back to top
BLAST of chromodomain helicase DNA-binding protein 4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO395855.966e-1356.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO472981.943e-14841.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO407617.540e-12342.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO481163.016e-11439.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO319438.261e-11142.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of chromodomain helicase DNA-binding protein 4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chd4a3.043e-6760.66chromodomain-helicase-DNA-binding protein 4 [Sourc... [more]
ENSORLT00000015622.29.936e-6859.59chromodomain helicase DNA binding protein 4 [Sourc... [more]
ENSORLT00000046718.16.449e-6859.56chromodomain helicase DNA binding protein 4 [Sourc... [more]
ENSORLT00000043581.16.449e-6859.56chromodomain helicase DNA binding protein 4 [Sourc... [more]
ENSORLT00000021516.21.181e-6761.15chromodomain helicase DNA binding protein 5 [Sourc... [more]
back to top
BLAST of chromodomain helicase DNA-binding protein 4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000068192.11.089e-90100.00SMESG000068192.1[more]
SMESG000068192.11.087e-9099.94SMESG000068192.1[more]
SMESG000068193.10.000e+0100.00SMESG000068193.1[more]
SMESG000069740.19.495e-938.79SMESG000069740.1[more]
SMESG000033395.12.795e-15143.05SMESG000033395.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30024368
GenBankADE34162.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024368 ID=SMED30024368|Name=chromodomain helicase DNA-binding protein 4|organism=Schmidtea mediterranea sexual|type=transcript|length=7237bp
AAAAATCAATACCGCGCATATATTATACGAAATAAGTAAAGGACAACTAC
TATTCTATAATAATAAATACACAATACACACAGTCGTTTCGATCTCCACA
TCACTTTAATTCCACCATGGAAATAACGGCCGGAACGGGAGCTTCATTTG
ACTTGAGATCGAGAACCTTATTTATTGATTGGTCGATAGATGATGTTCCG
TTGTTTGGTATTTCTGGCAAATCGGATTCACAAATAGCGGGCGGTTGCGG
TTTGGTCTGCTGCATTTGGACTGTGAGTTTTTGGATAAGATTGGTTTGTG
TTAGATTCAATCGCTGGGAAACTGGTGCCAGGCGCGCCAGGGACGCCGGC
AGACGGGCCACGTCTTGCTTCATGTCTGATAGTAGATCTTCCAATTGGGT
TAGCACTCGATGGAGAACTGGGACTAGAGTTTTATTGCCCTGGACGGCCT
CAGTGTAAACATTTTGCTGACTGGTTGCAAGACACTCGAGCTCCGTGAAA
CGTCTATTCAAATTCTGCACCTGATCATTTGGAGCGTAAGTCAGATTGAG
CTGAGCAGCCCGACGTAATTGCTCCTCGATTGTCAAAGCTTGCTCGAGTA
ATTTAAACCGACGCGCCAGAAATCTGTTTTTAATTTCCAAATAATTCGGT
TTCTGTTGTTCATTCCGGAATGGTTCATTAACAATAGCAAAGCGCACATC
ATTGTGAATATCCTGCCATCTACCGTAACCATGGGCAACGACACCAGCCA
GCAGCCAATAGTCATGTTTGCGGTGCCAAATGTCCTGCTCGTGCCCTTCT
ACCAGTGCTCGCTGCTCATTTTGCCAAATTGTATGGAGCTCAGTGAATCC
TCCATCGGCAATATTGAACATGAATTTGTTGATAACGATTTTATTGCACT
CGTCGGCTTCGCTCATCACAGCATCCTGCTGTTGTTGTTGCTGTTGTTGT
TCTACACCAGCAACTGCGATCGGTGTTGTTATAATTGGTTCTGCAGTTGC
TGTTGCTGCTGCTATTGCTGTCACTGTTCCAATTGATGTTATTGTTGTTA
TTGCTGTTGGTTCCAGTTTTGGTTCGGCTTCCATTTCTACTTTCATTGGT
TCTTCCATTTCTTCTTTCGGAGCATACTCAGGCATGCTGTATTGGCCATT
GATTTTCTCGAATTCTTGCACCTTTTTCCTGACAACTGCCATTATGCCGA
TTCTCGTGAGCACATGTTGCCTAGAAACTCCTTCTCTCGGTACCTGGTCA
CTGTAGCAATCGGTATTGTCGGATTCCGGCTCACATAAGTGACGCAAGAA
CAGATTAATGTAGGCTCTCATAACCCGATCACTCTTGCATCGCAACTCCC
GAACCATCCAATGACTGTTGATAAAATCCATAGGAGGCAGTCCATATCTC
ATTACTGCGTTGATAAAGGCTTTCCTTTGTCTCACGTTGAACCCAAGAAC
TTCCAATTGCCCATTAACTTTCACCAACAACGGAGGCATTTTCGTTCCGT
CGCGTTCTCGTTTGCTTCGTCGAGTGCCGATTATTTCTCCACGACTTTCA
TCGTATTCTTCATCATCTTCTTCTTTATTGATGGATCCCGACTCATGGTC
ACTATCACCAACGGCATCATTCCAGTTATCATCCTCCTGCTGTGTAGCTG
AATAATTAACTTGTTTTCGGATTCTTTTTCCTTTTCCGAGACTTTTCGAC
AAATCTTCTTGATCTTGTTCATAGTGATGACGTAGCAATTTCTCCCAGTA
CGTTGGATCTGCTGGATCGAGATCTTGTTTAATAATCTCTCCTCTAGTTT
CTTCATCGTCGTCATCTTCATCATCTTCGTTGACAGAAACTTCTCGTTTG
CTATAATGAGCGACTTTGAATGAACTGAGATAATCTGTCATCATATCTTC
TTTTTCTTCAATGCCTTGTTGACTTCGATCAATTAATCGATCAATAGCGC
CGTCATCATACACAATTTTGTGATCATCTTCGTTTTCGTCCTTTTCTTTA
AACAAATCTTCGGTACCGAATTTCAAAATTTCATCCAATTCCTTTTTAGA
CATAGATGCACCACCTTTACCCCCTAAACCGGGCCTCACAACGAGATGAG
TGAGCATCATTTTTTTCTTAGCAACTTGAGTTACTCTTTCCTCAACAGTA
TTTCTCGTCACAAATCGATAAATCATGACCTTATTCGACTGTCCAATTCT
GTGAGCTCTTGAGAAAGCCTGTATGTCATTGTGAGGATTCCAATCGGAAT
CATATATGATGACAGTGTCTGCTGTTGCCAGATTGATACCTAGACCTCCG
GCTCTAGTTGACAACAGAAACACAAATGAAACTGAATCTGGAGCATTAAA
CCGATCGATTGAATCTTGTCTTTGTTGGCCGGTTACTGCACCATCGATAC
GCTCGAATTTATAGCCCATATAGTCCATAAAATCCTCAAGAATATCTAAC
AGACGGGTCATTTGTGAGAAAATCAACACACGATGTCCTCCTGTCTTTAA
TTTCGGCAACATTTTATATAATAACTCCAGTTTTCCAGATGCTTTAATGA
GTGCTAAACCTTCATAGGCACCATTTCTCAATTTCGGAGCTTCATCACTA
CCCGATGGGAATAAATACGGATGATTGCAACACTTCTTCAAATCCATAAC
GATATTTATCAAAGATATTTGACTTCCGCCGCCTTTAACACTCAACGCGT
CGAAATTTCTTGTTAAAATATATTTGTAGAATTTAGCTTGCATTGGACTG
AGCTCAACACGGACGATAAATTCACCCTTTGACGGCATATCGGTGAGAAC
ATCGGCTTTCAATCGTCTCAGTAAATGTTCGCCGAGAATTTCGTGTAATC
GTTTAACTTGTTCCTCTTTCGAGATATCAGCAAATTCGTCTAGAAATCCT
TGCATGTCATTAAACTTCTCAGGAGTCATAAAATGCAATAAGTGAAACAA
TTCTTCTAGATTATTCTGAAGAGGTGTTCCGGTGAGCAAAAGTTTATAGT
TGATTTTATAGGAACTCAAAATGCGAAAAAATTTGGACTGATTGTTTTTC
AAACGATGGGCTTCATCAACAACAAGAACTTCCCATGAAATAGACCCAAG
CAATGCTTGGTCAATACTGATTAATTCATAACTGGTTAAAAGGACATGAA
ACTTGGTTCTTGTACCTTGTCGCATGCGACAAGCATGTTTAGATGTGCGC
ATTGCTCCTTCCTCGTATGAAAACTCGTGTTCTCTTACTACAGCCCTGGA
ATCTTTATCACCAACATATGTTACAACATAAAAATCAGGAGCCCAAAATT
CAAACTCTCTTTCCCAATTTATAACAGTTGACAATGGAGCTGCTACTAAA
AATGGACCTTTAGAGTGCCCTTCTTTATAAAGAGAATACAAAAAAGTAAT
GGTTTGAATCGTTTTTCCTAGCCCCATTTCGTCTGCCAAAATTGTATCAA
CAACATTGCCAAAGGAAAATCTTAGCCAATTTAGGCCTTCCAGCTGATAT
TGATGTAATTTTCCGCCGGTTTCTTCTATATAATCTGGTTGTTTCGACAT
TCTTTTCTTTAAATCAGTAGTTGGATGTTCTGGTGGTATTTTTTTCAGTA
TGATCTCCTTGGGAATACTACTATTTTTAAATTTCTTCTTATAAATATCT
CCAGTGAAAAGTTTACGCATAATGTGATACTCCTCAACTAAATGCTTCAT
ATCAATGACTTCATATTCTCCATCTAACTGTTCCCATGTGCACTCGTCAT
ATGCCAAATCTCTCCATTTAATTAAATACCAAATGCTATTATTCCTGTGC
GTCATATGATCGATAATTCTATGGATTTGCATCCATTCTGGTCTTACAGA
CCATTTATAGAATCTTTCTTCGAGATTATGAGGATCAGCAACTTTTTCTC
TGGCTCTTCCTTTGTATGTACTTCCGTCTTCTGGTGCTGGAGGTTCATCC
ATATCGTTTTTTTTGAAATAATTTCTCAATAAAATCGGATGGTGAACATC
GAGTTGTAACTCTGTGAGCCATTCACAATTCCAATATGATAAATCGCGAA
ATTTAACGAAAAATTCGCGCATTGGAGCTCTTTGACGACCGTGCCCACCA
GTGGGGTTTTTCTCGACCTCTGTGGATTTATGCGTATGATCTAACTCATC
TTTACCTTTTGGGGGTTCCATCCAACGCCATGTCAATATTTTATGAACTT
TTGCCTTAAGAGGACCGCATCCACATCGTGGACAAAGCCAAGGGCCTTCG
GGTATTTCACTCAAAGGAGGATACAAGCATTCCGGGTGATAACTAACGGG
ACATTTGGCACAGCAGATTAAGTCACCACCATCTTTGCATTCATTACAAA
ACTCCTGATGTTCGTCCTTTTCTTCTTCATTTGGTTGAGCGGATTTTCTG
ATATTTTGAGGATTTTGCGACATATCCCCGCCGGTTGCTGGAGTTGTCGA
ACGACTGGCAGCGACAACTCCTTCTTTTTCACAGTGAGGACAAGACCAAC
TGCCTTCGGGAGCTTCTTCGAGTTCAGGGTCAAGGCATACAAGATGAAAT
GCTCGCGGACAAGTATCACAGAGCATAATTTCACCTCCCTGTTGACACAC
TTCACAATAATCTTGATGATCAGTGTCATAACCACTCATCAATGGATATT
TGGAGGTTGTACGATGGTGGAGAGTTTTTTTCTTATTAGCTTCTTCTTGT
TCTTGATCAAGAACAATTGGATCTTCCGGATGACTACGTTTTCCTTTAGT
AACTAATTTACGCTGACGCAATCGTTCTTCTTCTTGCGCGGCTGCAATAT
CAGCTTCTTGTAATTGCCGCTCGAACTCTTCATCACTGGTATCATTTGAG
CCAACCACTAGGCGATCCTTCTTACGTCCACGTTTCTTTTTTTCGTTTGC
TAATTTTGATTTTTAATGATCCATTATTGTTTCCGTTTGCTGTTGAGGCA
GTTGCTATCAAATTTGATGAGCTAGATGGTGATGCAACTGGTTCTTGGTC
ACTTTCAATAGGAATATCTACAGTAGGAATTTCGTCCTCTCCAGCACTAA
CCTCCATAGAAATATCTACTTCGACTTTTTCCTTTCCCTTTCCAGGTTTA
CTGCGACCTCTCGGGGTAACTGTTGTTCGACGACCTCGTCCTCTTCCACG
GCCTCTGGATTTTCCTCCTCTTGCTTTTTTACTGATTTCTGCAGTAATCA
TTTTTTCAATACTGTCACTTTCAGCATCTTCCAACGTTTCCTCGCCATTT
TCATCGTTTTCATCCTCCGTTTTAGGAATATAAGGATTGAGCAGTGCAAA
TTCTTTCCATTTCGCATCAAGAACTCTTTGAATGTCATCTGACGTTGCAT
GAGGGTTTTTCTCTTCTAATTTTGGACGCATATATTGATCAAACAACCGT
TGAATTGTCCAATTCTCAAAATCATCCATTCTATAAGAAACTTCAACGTT
TGCTATACCCATTTCTTCACACAATCCTTCAACTGTCTTCTCCTTATGTT
TAATAGCACGACTAGAACGTCGTTTTGATGGAGGTTCAGTGATAAACTCA
TCATCACTCTCTTTTTTTCTTTTTACACGTCCTCTTTTTTTGGATTCTTT
AATATCAGATTTAGATTTACGTTTTTTAGATTTTTTTACATCAATTGATA
TGTCATCAAATTCTTCATTAATTTCAGATCCATTACTTACATCGTATATA
TCATCCATCTTAATACATATATTAAAAAAATTAGTTTATCTGAAAGGATT
TAAACAAACTATCCTATCAAGACTTCGGAAAGATTTATAAACATAGCATT
ACAGGAGTGATGACAAATTTCAATGAAATATGGAATCTTTTAGAAAAATA
TTCATTTAAGATCGACTCTCATTTACTTCAGCACTTAAAATGTATAATAT
GCGGCAAGTTATTGATTGATGCTCATGAAAGTCTTTGTGGTTGCAATTAC
TGCCAAAACTGTATCGAATCCTACCTGGAAAACGGACCGAAACAATGTCC
AGGCGATAGTGTCGACTGCAAGCTCACTCTTCTCGAGCTTCAAGTGAATA
TCATTCGGTCTAACAGTACTAATAGAAAAATTGTAAAACTTATAGTCAGC
TGCCCATTTAATGGTTGCAATTTTACAGGGGAATTATGGGAATTAAAAGA
TCATATAAGAATCTGTGATAATCGATCAATATATTGTCCATACAAAGAAA
TTGGTTGTTCTCAATCTCAAATTCCCATAGACAATATTTCCAATCATTTA
ACTGTCGAACAGTTTCAACATTCACAACTCTTAATTAATTTCATTTTAAA
TTTAAAAAATGAAGAAGTTTTGTCGAACAGTCTCAAGATTTCTCAACCTT
CCGACATGTTTTTTATTAATAAATCAAACACATCTCAAAATTGCAAGATT
AATGTCGAAAATATTCCAAATATTTTACAAAATCTACAGGAAGAAAATAT
CAAACTAAAGAACGAAATAGTCAAAAATAAAAATAATCAGGAAGAAGAAC
TTAATAAATTAAAACAATGGATTAACTCAAAATTTGAGCGAAAACACAAT
CAAGAATTATCCAATGAGATTAATCGGAAAGTTGAAAATAATTTCAATAA
TGGAGACAAAATTCAAGAAATTACGAACAATAAAAATTTGAAGAAAATTT
CTTTGGATGATTTGTCGACTTTTGATACTTCAAATCCAATTCAAATCGGC
AATAACACATATTTAAAAGACTCGCCAATGGAAAATCCTCTAAATCCATT
AGAAGTTTTTTCAAACCAAATTCCTAAATTCGCATGGACGATCTCTGATT
TATCCAAGATCATAAAAAAGAATCACGTTGTTGACAGTGAACATTTCTTC
TCGAAAAATGGAGATTTGAAAATATGGCTTGACTTATACACAACTAACAG
AAAAAATATGAGAATTCGGATTTACATTTCGACGACACCTGTTAATTCCT
CATTAAAGTGGCCACTTAAATGTCAGGTGGAACTCACGATAAAGAGCATT
AAAATTCCAAATGCATTTCAAAAATTTTCTAAAAACTGTTATTTTGAAAA
ACCGAGATTAAACTCATCTTATGAAACGTTTGAGCTTCGCAATTTAGATC
TGGATAATGCCAATGTTTTACAAGGTAATAAGATCTTGATAGAATGCTCA
CTGAGTATTGAGAATTAAGTCAAACGATGAAAATTATATATTTCTACCCA
TTAGCAAAAATAAAAATTTGATATTCTTAAAAAACAA
back to top

protein sequence of SMED30024368-orf-1

>SMED30024368-orf-1 ID=SMED30024368-orf-1|Name=SMED30024368-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1513bp
MSGYDTDHQDYCEVCQQGGEIMLCDTCPRAFHLVCLDPELEEAPEGSWSC
PHCEKEGVVAASRSTTPATGGDMSQNPQNIRKSAQPNEEEKDEHQEFCNE
CKDGGDLICCAKCPVSYHPECLYPPLSEIPEGPWLCPRCGCGPLKAKVHK
ILTWRWMEPPKGKDELDHTHKSTEVEKNPTGGHGRQRAPMREFFVKFRDL
SYWNCEWLTELQLDVHHPILLRNYFKKNDMDEPPAPEDGSTYKGRAREKV
ADPHNLEERFYKWSVRPEWMQIHRIIDHMTHRNNSIWYLIKWRDLAYDEC
TWEQLDGEYEVIDMKHLVEEYHIMRKLFTGDIYKKKFKNSSIPKEIILKK
IPPEHPTTDLKKRMSKQPDYIEETGGKLHQYQLEGLNWLRFSFGNVVDTI
LADEMGLGKTIQTITFLYSLYKEGHSKGPFLVAAPLSTVINWEREFEFWA
PDFYVVTYVGDKDSRAVVREHEFSYEEGAMRTSKHACRMRQGTRTKFHVL
LTSYELISIDQALLGSISWEVLVVDEAHRLKNNQSKFFRILSSYKINYKL
LLTGTPLQNNLEELFHLLHFMTPEKFNDMQGFLDEFADISKEEQVKRLHE
ILGEHLLRRLKADVLTDMPSKGEFIVRVELSPMQAKFYKYILTRNFDALS
VKGGGSQISLINIVMDLKKCCNHPYLFPSGSDEAPKLRNGAYEGLALIKA
SGKLELLYKMLPKLKTGGHRVLIFSQMTRLLDILEDFMDYMGYKFERIDG
AVTGQQRQDSIDRFNAPDSVSFVFLLSTRAGGLGINLATADTVIIYDSDW
NPHNDIQAFSRAHRIGQSNKVMIYRFVTRNTVEERVTQVAKKKMMLTHLV
VRPGLGGKGGASMSKKELDEILKFGTEDLFKEKDENEDDHKIVYDDGAID
RLIDRSQQGIEEKEDMMTDYLSSFKVAHYSKREVSVNEDDEDDDDEETRG
EIIKQDLDPADPTYWEKLLRHHYEQDQEDLSKSLGKGKRIRKQVNYSATQ
QEDDNWNDAVGDSDHESGSINKEEDDEEYDESRGEIIGTRRSKRERDGTK
MPPLLVKVNGQLEVLGFNVRQRKAFINAVMRYGLPPMDFINSHWMVRELR
CKSDRVMRAYINLFLRHLCEPESDNTDCYSDQVPREGVSRQHVLTRIGIM
AVVRKKVQEFEKINGQYSMPEYAPKEEMEEPMKVEMEAEPKLEPTAITTI
TSIGTVTAIAAATATAEPIITTPIAVAGVEQQQQQQQQDAVMSEADECNK
IVINKFMFNIADGGFTELHTIWQNEQRALVEGHEQDIWHRKHDYWLLAGV
VAHGYGRWQDIHNDVRFAIVNEPFRNEQQKPNYLEIKNRFLARRFKLLEQ
ALTIEEQLRRAAQLNLTYAPNDQVQNLNRRFTELECLATSQQNVYTEAVQ
GNKTLVPVLHRVLTQLEDLLSDMKQDVARLPASLARLAPVSQRLNLTQTN
LIQKLTVQMQQTKPQPPAICESDLPEIPNNGTSSIDQSINKVLDLKSNEA
PVPAVISMVELK*
back to top

protein sequence of SMED30024368-orf-2

>SMED30024368-orf-2 ID=SMED30024368-orf-2|Name=SMED30024368-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=279bp
MDDIYDVSNGSEINEEFDDISIDVKKSKKRKSKSDIKESKKRGRVKRKKE
SDDEFITEPPSKRRSSRAIKHKEKTVEGLCEEMGIANVEVSYRMDDFENW
TIQRLFDQYMRPKLEEKNPHATSDDIQRVLDAKWKEFALLNPYIPKTEDE
NDENGEETLEDAESDSIEKMITAEISKKARGGKSRGRGRGRGRRTTVTPR
GRSKPGKGKEKVEVDISMEVSAGEDEIPTVDIPIESDQEPVASPSSSSNL
IATASTANGNNNGSLKIKISKRKKETWT*
back to top

protein sequence of SMED30024368-orf-3

>SMED30024368-orf-3 ID=SMED30024368-orf-3|Name=SMED30024368-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=453bp
MTNFNEIWNLLEKYSFKIDSHLLQHLKCIICGKLLIDAHESLCGCNYCQN
CIESYLENGPKQCPGDSVDCKLTLLELQVNIIRSNSTNRKIVKLIVSCPF
NGCNFTGELWELKDHIRICDNRSIYCPYKEIGCSQSQIPIDNISNHLTVE
QFQHSQLLINFILNLKNEEVLSNSLKISQPSDMFFINKSNTSQNCKINVE
NIPNILQNLQEENIKLKNEIVKNKNNQEEELNKLKQWINSKFERKHNQEL
SNEINRKVENNFNNGDKIQEITNNKNLKKISLDDLSTFDTSNPIQIGNNT
YLKDSPMENPLNPLEVFSNQIPKFAWTISDLSKIIKKNHVVDSEHFFSKN
GDLKIWLDLYTTNRKNMRIRIYISTTPVNSSLKWPLKCQVELTIKSIKIP
NAFQKFSKNCYFEKPRLNSSYETFELRNLDLDNANVLQGNKILIECSLSI
EN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000025nervous system
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0000044cephalic ganglia
PLANA:0000097ventral nerve cord
PLANA:0000099neuron
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0002112Xins cell
PLANA:0002142parenchyma
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000953Chromo/chromo_shadow_dom
IPR014001Helicase_ATP-bd
IPR001650Helicase_C
IPR009462DUF1086
IPR001965Znf_PHD
IPR009463DUF1087
IPR023780Chromo_domain
IPR019787Znf_PHD-finger
IPR013083Znf_RING/FYVE/PHD
IPR027417P-loop_NTPase
IPR012957CHD_C2
IPR000330SNF2_N
IPR019786Zinc_finger_PHD-type_CS
IPR016197Chromo-like_dom_sf
IPR011011Znf_FYVE_PHD
IPR001293Znf_TRAF
IPR013323SIAH-type
IPR008974TRAF-like
IPR001841Znf_RING
IPR002083MATH/TRAF_dom
IPR011528NERD
IPR012958CHD_N
Vocabulary: molecular function
TermDefinition
GO:0008270zinc ion binding
GO:0005515protein binding
GO:0005524ATP binding
GO:0016818hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
GO:0003677DNA binding
GO:0004842ubiquitin-protein transferase activity
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO:0016567protein ubiquitination
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR012958CHD, N-terminalPFAMPF08073CHDNTcoord: 89..142
e-value: 3.0E-15
score: 55.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 145..278
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 30..44
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 45..72
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 164..181
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 203..218
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 27..72
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 182..200
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 239..266