SMED30024359

Overview
NameSMED30024359
Smed IDSMED30024359
Length (bp)1245
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30024359 (SMED30024359) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30024359 (SMED30024359) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30024359 (SMED30024359) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30024359 (SMED30024359) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of SMED30024359 vs. TrEMBL
Match: B3S3S4 (UBX domain-containing protein OS=Trichoplax adhaerens OX=10228 GN=TRIADDRAFT_58828 PE=4 SV=1)

HSP 1 Score: 65.0846 bits (157), Expect = 1.334e-7
Identity = 83/323 (25.70%), Postives = 150/323 (46.44%), Query Frame = 3
Query:  171 MTPSF----LKCGFNEAVMSTVANRPATSKPFIVYMHDSKDDMHRLFFKENVCNDIVCEYLIKEDWPIWPIDISNQNEKQQFFNLMSNRLDAKEIFA--------HPLPMLMMCIREGLSTFITEFMCSTDPMMNVGKLF-DCGGAFQTDK-----ELKMNIINSVXXXXXXXXXXXXXXXXXXXXXXXXXXXXILEEQERISKEN--LR------LVKESNRSNAIEFAKSQLVDVSPSPSNFT-----FRIRLPNGQTLNREFNESQTVNDVLYFIESNGHLRSEIKVMFSYPAKNMCEINDKLVTLKDSGASKREAVNVQ 1046
            M P F    LK   +E     V  R    KP  VY+H+SK     +F    +C++ +  YL  +++  W  D++  + +++ F+L ++   A   F+        +P+ +++  ++  L     E        M++ +LF    GAF+  +     ELK       R++    +  +     +  + +  +R A  EE+ R+ KE   LR      L++E  R  A   + +Q +  +P P N T     F IRLP G+ L+R+F    TV D+L ++ SNG L  E KV+ ++P + +  + D  ++L D+G   ++ + VQ
Sbjct:  249 MHPLFFIGPLKDALDECFKGNVNQR----KPLFVYIHNSKSVQVNIFCSNVLCSESIVNYL-NQNYVNWAWDVTLPSNREKCFSLCTSLFGATATFSLERFEDDDYPIMLVITKVKSSL-----EISRVLQAKMSLDELFTGLMGAFEDYRHVLHNELKEEEAREARQRFKKLQDAEYEASLKADRAKAEQRAAEEEERNRLEKEAQLLREHEEQALMEEVKRKEAERQSLAQSIPQAP-PDNCTDDVIKFLIRLPGGERLSRKFYSRNTVKDLLNYVASNGFLDFEFKVVTNFPKREISAL-DPHLSLGDAGFLSQDTLFVQ 559          
BLAST of SMED30024359 vs. TrEMBL
Match: A0A369RZQ7 (FAS-associated factor 1 OS=Trichoplax sp. H2 OX=287889 GN=TrispH2_008101 PE=4 SV=1)

HSP 1 Score: 64.6994 bits (156), Expect = 2.125e-7
Identity = 83/323 (25.70%), Postives = 150/323 (46.44%), Query Frame = 3
Query:  171 MTPSF----LKCGFNEAVMSTVANRPATSKPFIVYMHDSKDDMHRLFFKENVCNDIVCEYLIKEDWPIWPIDISNQNEKQQFFNLMSNRLDAKEIFA--------HPLPMLMMCIREGLSTFITEFMCSTDPMMNVGKLF-DCGGAFQTDK-----ELKMNIINSVXXXXXXXXXXXXXXXXXXXXXXXXXXXXILEEQERISKEN--LR------LVKESNRSNAIEFAKSQLVDVSPSPSNFT-----FRIRLPNGQTLNREFNESQTVNDVLYFIESNGHLRSEIKVMFSYPAKNMCEINDKLVTLKDSGASKREAVNVQ 1046
            M P F    LK   +E     V  R    KP  VY+H+SK     +F    +C++ +  YL  +++  W  D++  + +++ F+L ++   A   F+        +P+ +++  ++  L     E        M++ +LF    GAF+  +     ELK       R++    +  +     +  + +  +R A  EE+ R+ KE   LR      L++E  R  A   + +Q +  +P P N T     F IRLP G+ L+R+F    TV D+L ++ SNG L  E KV+ ++P + +  + D  ++L D+G   ++ + VQ
Sbjct:  311 MHPLFFIGPLKDALDECFKGNVNQR----KPLFVYIHNSKSVQVNIFCSNVLCSESIVNYL-NQNYVNWAWDVTLPSNREKCFSLCTSLFGATATFSLERFEDDDYPIMLVITKVKSSL-----EISRVLQAKMSLDELFTGLMGAFEDYRHVLHNELKEEEAREARQRFKKLQDAEYEASLKADRAKAEQRAAEEEERNRLEKEAQLLREHEEQALMEEVKRKEAERQSLAQSIPQAP-PDNCTDDVIKFLIRLPGGERLSRKFYSRNTVKDLLNYVASNGFLDFEFKVVTNFPKREISAL-DPHLSLGDAGFLSQDTLFVQ 621          
BLAST of SMED30024359 vs. Planmine SMEST
Match: SMESG000077910.1 (SMESG000077910.1)

HSP 1 Score: 594.734 bits (1532), Expect = 0.000e+0
Identity = 319/319 (100.00%), Postives = 319/319 (100.00%), Query Frame = 3
Query:   96 MANENFVDCNLRFFEYLENSIGKNMMTPSFLKCGFNEAVMSTVANRPATSKPFIVYMHDSKDDMHRLFFKENVCNDIVCEYLIKEDWPIWPIDISNQNEKQQFFNLMSNRLDAKEIFAHPLPMLMMCIREGLSTFITEFMCSTDPMMNVGKLFDCGGAFQTDKELKMNIINSVXXXXXXXXXXXXXXXXXXXXXXXXXXXXILEEQERISKENLRLVKESNRSNAIEFAKSQLVDVSPSPSNFTFRIRLPNGQTLNREFNESQTVNDVLYFIESNGHLRSEIKVMFSYPAKNMCEINDKLVTLKDSGASKREAVNVQKL 1052
            MANENFVDCNLRFFEYLENSIGKNMMTPSFLKCGFNEAVMSTVANRPATSKPFIVYMHDSKDDMHRLFFKENVCNDIVCEYLIKEDWPIWPIDISNQNEKQQFFNLMSNRLDAKEIFAHPLPMLMMCIREGLSTFITEFMCSTDPMMNVGKLFDCGGAFQTDKELKMNIINSVREKSLIAKKKKESELEEKRQKQELERKAILEEQERISKENLRLVKESNRSNAIEFAKSQLVDVSPSPSNFTFRIRLPNGQTLNREFNESQTVNDVLYFIESNGHLRSEIKVMFSYPAKNMCEINDKLVTLKDSGASKREAVNVQKL
Sbjct:    1 MANENFVDCNLRFFEYLENSIGKNMMTPSFLKCGFNEAVMSTVANRPATSKPFIVYMHDSKDDMHRLFFKENVCNDIVCEYLIKEDWPIWPIDISNQNEKQQFFNLMSNRLDAKEIFAHPLPMLMMCIREGLSTFITEFMCSTDPMMNVGKLFDCGGAFQTDKELKMNIINSVREKSLIAKKKKESELEEKRQKQELERKAILEEQERISKENLRLVKESNRSNAIEFAKSQLVDVSPSPSNFTFRIRLPNGQTLNREFNESQTVNDVLYFIESNGHLRSEIKVMFSYPAKNMCEINDKLVTLKDSGASKREAVNVQKL 319          
BLAST of SMED30024359 vs. Planmine SMEST
Match: SMESG000077914.1 (SMESG000077914.1)

HSP 1 Score: 533.487 bits (1373), Expect = 0.000e+0
Identity = 272/319 (85.27%), Postives = 296/319 (92.79%), Query Frame = 3
Query:   96 MANENFVDCNLRFFEYLENSIGKNMMTPSFLKCGFNEAVMSTVANRPATSKPFIVYMHDSKDDMHRLFFKENVCNDIVCEYLIKEDWPIWPIDISNQNEKQQFFNLMSNRLDAKEIFAHPLPMLMMCIREGLSTFITEFMCSTDPMMNVGKLFDCGGAFQTDKELKMNIINSVXXXXXXXXXXXXXXXXXXXXXXXXXXXXILEEQERISKENLRLVKESNRSNAIEFAKSQLVDVSPSPSNFTFRIRLPNGQTLNREFNESQTVNDVLYFIESNGHLRSEIKVMFSYPAKNMCEINDKLVTLKDSGASKREAVNVQKL 1052
            M NENFVDCNLRFFEYLENSIGK+MMTPSFLKCGFNEAVMSTVANRPATSKPFIVYMHDSKDDMHRLFFKEN+CN+IVCEYLIKEDWPIWPIDISNQNEKQQFFNLMSNRLDAKEIFA+PLPMLMMCIREGLST I E+M S DP MNV KLFDCG  FQT+KELKMN+INS  +KS I++K K +E+E+  +  EL++KA+LE+ ER+ KENL+ V+ESNRSNAIEFAKSQLVDVSPSPSNFTFRIRLPNGQTLNREF+ESQTVNDVLYFIESNGHLRSEIKVMFSYPAKNMCEINDKL+ LKDSGASK EA+NVQKL
Sbjct:    1 MTNENFVDCNLRFFEYLENSIGKDMMTPSFLKCGFNEAVMSTVANRPATSKPFIVYMHDSKDDMHRLFFKENICNEIVCEYLIKEDWPIWPIDISNQNEKQQFFNLMSNRLDAKEIFAYPLPMLMMCIREGLSTVIREYMWSPDPTMNVRKLFDCGVTFQTNKELKMNMINSSSKKSSISRKIKNAEIEKDLKDLELKKKALLEQLERLDKENLQTVEESNRSNAIEFAKSQLVDVSPSPSNFTFRIRLPNGQTLNREFSESQTVNDVLYFIESNGHLRSEIKVMFSYPAKNMCEINDKLMALKDSGASKHEALNVQKL 319          
BLAST of SMED30024359 vs. Planmine SMEST
Match: SMESG000039424.1 (SMESG000039424.1)

HSP 1 Score: 498.434 bits (1282), Expect = 4.937e-177
Identity = 256/305 (83.93%), Postives = 272/305 (89.18%), Query Frame = 3
Query:  138 EYLENSIGKNMMTPSFLKCGFNEAVMSTVANRPATSKPFIVYMHDSKDDMHRLFFKENVCNDIVCEYLIKEDWPIWPIDISNQNEKQQFFNLMSNRLDAKEIFAHPLPMLMMCIREGLSTFITEFMCSTDPMMNVGKLFDCGGAFQTDKELKMNIINSVXXXXXXXXXXXXXXXXXXXXXXXXXXXXILEEQERISKENLRLVKESNRSNAIEFAKSQLVDVSPSPSNFTFRIRLPNGQTLNREFNESQTVNDVLYFIESNGHLRSEIKVMFSYPAKNMCEINDKLVTLKDSGASKREAVNVQKL 1052
            E   NSIGK+MMTPSFLKC F+EA+MSTVANRPATSKPFIVYMHDS DDMH LFF ENVCN+IVCEYLIKEDWPIWPID+SNQNEKQQFFNLMSNRL+AKEIFA+PLPMLMMCIREGLSTFITE+MCS DPMMNVGKLFDCGGAFQTDKELK+N+IN                  EKRQK+ELERKAILEEQERI KENLRLV+ESNR+NAIEFAK QLVD SPS SNF FRIRLPNGQ LNR+F+E+QTVNDVLYFIES GHLRSEIKVMFSYPAKNMCEINDKLVTLKDSGASKREAVNVQKL
Sbjct:   78 EECTNSIGKDMMTPSFLKCDFDEALMSTVANRPATSKPFIVYMHDSNDDMHSLFFMENVCNEIVCEYLIKEDWPIWPIDLSNQNEKQQFFNLMSNRLEAKEIFAYPLPMLMMCIREGLSTFITEYMCSPDPMMNVGKLFDCGGAFQTDKELKINMINK-----------------EKRQKEELERKAILEEQERIEKENLRLVEESNRNNAIEFAKGQLVDASPSHSNFIFRIRLPNGQILNRQFSETQTVNDVLYFIESTGHLRSEIKVMFSYPAKNMCEINDKLVTLKDSGASKREAVNVQKL 365          
BLAST of SMED30024359 vs. Planmine SMEST
Match: SMESG000055685.1 (SMESG000055685.1)

HSP 1 Score: 202.216 bits (513), Expect = 6.754e-63
Identity = 98/129 (75.97%), Postives = 110/129 (85.27%), Query Frame = 3
Query:   78 LLSNLSMANENFVDCNLRFFEYLENSIGKNMMTPSFLKCGFNEAVMSTVANRPATSKPFIVYMHDSKDDMHRLFFKENVCNDIVCEYLIKEDWPIWPIDISNQNEKQQFF---NLMSNRLDAKEIFAHP 455
             +S+L + NENFVDCNLRFFEYLENSIGK+MMTPSFLKCGF+EA+MSTVANRPATSKPFIVYMHDS DDMH LFF ENVCN+IVCEYLIKE WPI PID+SNQNEKQQ F   N+  N +D ++   HP
Sbjct:    5 FISDLIVTNENFVDCNLRFFEYLENSIGKDMMTPSFLKCGFDEALMSTVANRPATSKPFIVYMHDSNDDMHSLFFMENVCNEIVCEYLIKEYWPIRPIDLSNQNEKQQLFSIKNMYRNLIDNQQPI-HP 132          
BLAST of SMED30024359 vs. Planmine SMEST
Match: SMESG000055685.1 (SMESG000055685.1)

HSP 1 Score: 154.836 bits (390), Expect = 3.899e-45
Identity = 75/99 (75.76%), Postives = 83/99 (83.84%), Query Frame = 3
Query:  168 MMTPSFLKCGFNEAVMSTVANRPATSKPFIVYMHDSKDDMHRLFFKENVCNDIVCEYLIKEDWPIWPIDISNQNEKQQFF---NLMSNRLDAKEIFAHP 455
            MMTPSFLKCGF+EA+MSTVANRPATSKPFIVYMHDS DDMH LFF ENVCN+IVCEYLIKE WPI PID+SNQNEKQQ F   N+  N +D ++   HP
Sbjct:    1 MMTPSFLKCGFDEALMSTVANRPATSKPFIVYMHDSNDDMHSLFFMENVCNEIVCEYLIKEYWPIRPIDLSNQNEKQQLFSIKNMYRNLIDNQQPI-HP 98          
The following BLAST results are available for this feature:
BLAST of SMED30024359 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30024359 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30024359 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30024359 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30024359 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30024359 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30024359 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30024359 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 2
Match NameE-valueIdentityDescription
B3S3S41.334e-725.70UBX domain-containing protein OS=Trichoplax adhaer... [more]
A0A369RZQ72.125e-725.70FAS-associated factor 1 OS=Trichoplax sp. H2 OX=28... [more]
back to top
BLAST of SMED30024359 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30024359 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30024359 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30024359 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30024359 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30024359 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000077910.10.000e+0100.00SMESG000077910.1[more]
SMESG000077914.10.000e+085.27SMESG000077914.1[more]
SMESG000039424.14.937e-17783.93SMESG000039424.1[more]
SMESG000055685.16.754e-6375.97SMESG000055685.1[more]
SMESG000055685.13.899e-4575.76SMESG000055685.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024359 ID=SMED30024359|Name=SMED30024359|organism=Schmidtea mediterranea sexual|type=transcript|length=1245bp
ATTTGGTATTGCAATATTTCTAGCAAATTATTTCATTCAATATTTTGTAT
CAAATATACACTGTTAAGCTTTTTGTGTTACTGTCAAACTTATCAATGGC
TAATGAAAACTTCGTTGATTGTAACCTAAGGTTCTTTGAATATTTAGAAA
ACTCAATTGGAAAAAATATGATGACACCTTCATTCTTGAAATGTGGTTTT
AATGAAGCAGTTATGTCTACGGTTGCCAATAGACCTGCAACATCAAAGCC
ATTCATCGTTTATATGCATGATTCCAAAGATGATATGCATAGATTATTTT
TCAAGGAAAATGTTTGCAATGATATCGTTTGTGAATATCTTATCAAAGAA
GATTGGCCAATTTGGCCGATAGATATCTCCAATCAAAATGAAAAACAACA
ATTTTTCAATTTGATGAGCAATCGTCTCGACGCCAAGGAAATATTTGCGC
ACCCCTTACCAATGTTGATGATGTGTATAAGAGAAGGATTGAGTACTTTC
ATAACAGAATTTATGTGCAGTACTGATCCAATGATGAATGTTGGAAAATT
ATTCGACTGTGGTGGTGCATTTCAAACAGATAAAGAATTAAAAATGAATA
TTATTAATAGTGTTAGAGAAAAATCGTTGATAGCCAAAAAGAAGAAAGAA
TCTGAATTAGAAGAAAAGAGACAGAAGCAAGAACTAGAGAGAAAAGCCAT
CTTGGAAGAACAAGAAAGAATATCGAAAGAAAATCTTCGATTGGTTAAAG
AATCCAATCGAAGCAATGCCATTGAATTCGCAAAAAGCCAACTTGTTGAT
GTTTCTCCATCTCCTTCCAATTTCACATTTAGAATACGTCTACCTAACGG
ACAAACCCTTAACCGAGAATTCAATGAATCACAAACTGTAAATGATGTTC
TGTATTTCATTGAATCGAATGGTCATTTGAGATCTGAAATAAAGGTCATG
TTTTCTTATCCAGCTAAAAACATGTGCGAGATAAATGATAAATTGGTGAC
ATTGAAAGATTCCGGGGCAAGTAAACGTGAAGCTGTGAATGTTCAGAAAT
TATAGGAAAATGCTTTGTAGATGAAAATTGGTTAATATCATTCGTTGAAT
AAATTTTTTCTTTTGATAATTATAATTATTTACTATAACTAAATTATGAA
TATATGCTGAACAATAAAACTCAGAAACAAGAATAGAACTATTTAAAAAT
ATTAAAGATTCATTGATGTTCTAAGAACTTTAGGCAATTTTCTGC
back to top

protein sequence of SMED30024359-orf-1

>SMED30024359-orf-1 ID=SMED30024359-orf-1|Name=SMED30024359-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=320bp
MANENFVDCNLRFFEYLENSIGKNMMTPSFLKCGFNEAVMSTVANRPATS
KPFIVYMHDSKDDMHRLFFKENVCNDIVCEYLIKEDWPIWPIDISNQNEK
QQFFNLMSNRLDAKEIFAHPLPMLMMCIREGLSTFITEFMCSTDPMMNVG
KLFDCGGAFQTDKELKMNIINSVREKSLIAKKKKESELEEKRQKQELERK
AILEEQERISKENLRLVKESNRSNAIEFAKSQLVDVSPSPSNFTFRIRLP
NGQTLNREFNESQTVNDVLYFIESNGHLRSEIKVMFSYPAKNMCEINDKL
VTLKDSGASKREAVNVQKL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000231vitelline gland
Vocabulary: INTERPRO
TermDefinition
IPR036249Thioredoxin-like_sf
IPR001012UBX_dom
IPR029071Ubiquitin-like_domsf
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003674molecular_function
GO:0008289lipid binding
GO:0043130ubiquitin binding
Vocabulary: cellular component
TermDefinition
GO:0005575cellular_component
GO:0005634nucleus
GO:0005794Golgi apparatus
GO:0005795Golgi stack
GO:0005829cytosol
Vocabulary: biological process
TermDefinition
GO:0007030Golgi organization
GO:0008150biological_process
GO:0031468nuclear envelope reassembly
GO:0043161proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0061025membrane fusion
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 174..212
NoneNo IPR availableGENE3DG3DSA:3.10.20.90coord: 242..318
e-value: 1.1E-14
score: 56.1
NoneNo IPR availablePANTHERPTHR23322:SF77coord: 175..312
NoneNo IPR availablePANTHERPTHR23322FAS-ASSOCIATED PROTEINcoord: 175..312
NoneNo IPR availableCDDcd01767UBXcoord: 244..317
e-value: 1.27178E-11
score: 57.6584
IPR036249Thioredoxin-like superfamilyGENE3DG3DSA:3.40.30.10coord: 3..166
e-value: 2.6E-13
score: 51.9
IPR001012UBX domainPFAMPF00789UBXcoord: 242..317
e-value: 1.2E-8
score: 35.0
IPR001012UBX domainPROSITEPS50033UBXcoord: 238..316
score: 15.208
IPR029071Ubiquitin-like domain superfamilySUPERFAMILYSSF54236Ubiquitin-likecoord: 191..318