Protein 4.1

Overview
NameProtein 4.1
Smed IDSMED30024358
Length (bp)3544
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein 4.1 (SMED30024358) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein 4.1 (SMED30024358) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein 4.1 (SMED30024358) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein 4.1 (SMED30024358) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024358

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30024358SMESG000029732.1 dd_Smed_v4_2825_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30024358SMESG000029732.1 dd_Smed_v4_2825_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30024358SMESG000029732.1 dd_Smed_v4_2825_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30024358SMESG000029732.1 dd_Smed_v4_2825_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parapharyngeal cellSMED30024358SMESG000029732.1 dd_Smed_v4_2825_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30024358SMESG000029732.1 dd_Smed_v4_2825_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
pharynxSMED30024358SMESG000029732.1 dd_Smed_v4_5331_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30024358SMESG000029732.1 dd_Smed_v4_5331_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30024358SMESG000029732.1 dd_Smed_v4_5331_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30024358SMESG000029732.1 dd_Smed_v4_5331_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
testisSMED30024358SMESG000029732.1 HO005628.1ncbi_smed_estsPMID:22074376
Chong et al., 2011
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
epidermisSMED30024358SMESG000029732.1 dd_Smed_v4_2825_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30024358SMESG000029732.1 dd_Smed_v4_5331_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein 4.1 vs. Ensembl Human
Match: EPB41L3 (erythrocyte membrane protein band 4.1 like 3 [Source:HGNC Symbol;Acc:HGNC:3380])

HSP 1 Score: 347.821 bits (891), Expect = 2.403e-106
Identity = 171/337 (50.74%), Postives = 239/337 (70.92%), Query Frame = 2
Query:  842 KAHIILLDGMEVEFDVDQKMLGKYLFDEVCSYLDLIEKDFFGMTYVNSKLQTWFWLEMDKKISKQLSSADDWAFNFQVKFYPPEPVLLQEDITRYLLSLQVRQDVFTGKLPCSWITQALLGSFMVQSELGDFDELEHEEGIDYLREFEFVLNQSDQLLEKIAELHKKHIGMSPDKADVKYLETAKRLEQYGVDLHPARDNDDVEILIGVCYQGVLIYRDRIRIGRFAWPKVLRISYKKNYFYLKIRSDRYDDSVAIVGFKLFNHNLAKRLWKNAVEQHTFFRMKEPQNQKPTQRYMVSGSSTYGYTGKTLHQYRSMNIARNEPLK-FDRALTKRRTI 1849
            +  +ILLDG E   DV+++  G+ LFD+VC +L+L+EKD+FG+TY +++ Q   WL+  K+I KQ+ S   W F+F VKFYPP+P  L EDITRY L LQ+R D+ +G+LPCS++T ALLGS+ VQSELGD+D    E G DY+ EF F  N + +L +K+ ELHK H GM+P +A++ +LE AK+L  YGVDLH A+D++ VEI++GVC  G+LIYRDR+RI RFAWPKVL+ISYK+N FY+KIR   ++   + +GFKL NH  AKRLWK  VE HTFFR+  P  + P ++++  GS  + Y+G+T  Q R  +   + P   F+R+ +KR T+
Sbjct:    2 QCKVILLDGSEYTCDVEKRSRGQVLFDKVCEHLNLLEKDYFGLTYRDAENQK-NWLDPAKEIKKQVRSGA-WHFSFNVKFYPPDPAQLSEDITRYYLCLQLRDDIVSGRLPCSFVTLALLGSYTVQSELGDYDP--DECGSDYISEFRFAPNHTKELEDKVIELHKSHRGMTPAEAEMHFLENAKKLSMYGVDLHHAKDSEGVEIMLGVCASGLLIYRDRLRINRFAWPKVLKISYKRNNFYIKIRPGEFEQFESTIGFKLPNHRAAKRLWKVCVEHHTFFRLLLP--EAPPKKFLTLGSK-FRYSGRTQAQTRRASALIDRPAPYFERSSSKRYTM 331          
BLAST of Protein 4.1 vs. Ensembl Human
Match: EPB41L3 (erythrocyte membrane protein band 4.1 like 3 [Source:HGNC Symbol;Acc:HGNC:3380])

HSP 1 Score: 353.214 bits (905), Expect = 3.142e-106
Identity = 171/337 (50.74%), Postives = 239/337 (70.92%), Query Frame = 2
Query:  842 KAHIILLDGMEVEFDVDQKMLGKYLFDEVCSYLDLIEKDFFGMTYVNSKLQTWFWLEMDKKISKQLSSADDWAFNFQVKFYPPEPVLLQEDITRYLLSLQVRQDVFTGKLPCSWITQALLGSFMVQSELGDFDELEHEEGIDYLREFEFVLNQSDQLLEKIAELHKKHIGMSPDKADVKYLETAKRLEQYGVDLHPARDNDDVEILIGVCYQGVLIYRDRIRIGRFAWPKVLRISYKKNYFYLKIRSDRYDDSVAIVGFKLFNHNLAKRLWKNAVEQHTFFRMKEPQNQKPTQRYMVSGSSTYGYTGKTLHQYRSMNIARNEPLK-FDRALTKRRTI 1849
            +  +ILLDG E   DV+++  G+ LFD+VC +L+L+EKD+FG+TY +++ Q   WL+  K+I KQ+ S   W F+F VKFYPP+P  L EDITRY L LQ+R D+ +G+LPCS++T ALLGS+ VQSELGD+D    E G DY+ EF F  N + +L +K+ ELHK H GM+P +A++ +LE AK+L  YGVDLH A+D++ VEI++GVC  G+LIYRDR+RI RFAWPKVL+ISYK+N FY+KIR   ++   + +GFKL NH  AKRLWK  VE HTFFR+  P  + P ++++  GS  + Y+G+T  Q R  +   + P   F+R+ +KR T+
Sbjct:    2 QCKVILLDGSEYTCDVEKRSRGQVLFDKVCEHLNLLEKDYFGLTYRDAENQK-NWLDPAKEIKKQVRSGA-WHFSFNVKFYPPDPAQLSEDITRYYLCLQLRDDIVSGRLPCSFVTLALLGSYTVQSELGDYDP--DECGSDYISEFRFAPNHTKELEDKVIELHKSHRGMTPAEAEMHFLENAKKLSMYGVDLHHAKDSEGVEIMLGVCASGLLIYRDRLRINRFAWPKVLKISYKRNNFYIKIRPGEFEQFESTIGFKLPNHRAAKRLWKVCVEHHTFFRLLLP--EAPPKKFLTLGSK-FRYSGRTQAQTRRASALIDRPAPYFERSSSKRYTM 331          
BLAST of Protein 4.1 vs. Ensembl Human
Match: EPB41L3 (erythrocyte membrane protein band 4.1 like 3 [Source:HGNC Symbol;Acc:HGNC:3380])

HSP 1 Score: 355.525 bits (911), Expect = 5.596e-106
Identity = 174/346 (50.29%), Postives = 242/346 (69.94%), Query Frame = 2
Query:  815 KSAKHLSSNKAHIILLDGMEVEFDVDQKMLGKYLFDEVCSYLDLIEKDFFGMTYVNSKLQTWFWLEMDKKISKQLSSADDWAFNFQVKFYPPEPVLLQEDITRYLLSLQVRQDVFTGKLPCSWITQALLGSFMVQSELGDFDELEHEEGIDYLREFEFVLNQSDQLLEKIAELHKKHIGMSPDKADVKYLETAKRLEQYGVDLHPARDNDDVEILIGVCYQGVLIYRDRIRIGRFAWPKVLRISYKKNYFYLKIRSDRYDDSVAIVGFKLFNHNLAKRLWKNAVEQHTFFRMKEPQNQKPTQRYMVSGSSTYGYTGKTLHQYRSMNIARNEPLK-FDRALTKRRTI 1849
            K  K   S +  +ILLDG E   DV+++  G+ LFD+VC +L+L+EKD+FG+TY +++ Q   WL+  K+I KQ+ S   W F+F VKFYPP+P  L EDITRY L LQ+R D+ +G+LPCS++T ALLGS+ VQSELGD+D    E G DY+ EF F  N + +L +K+ ELHK H GM+P +A++ +LE AK+L  YGVDLH A+D++ VEI++GVC  G+LIYRDR+RI RFAWPKVL+ISYK+N FY+KIR   ++   + +GFKL NH  AKRLWK  VE HTFFR+  P  + P ++++  GS  + Y+G+T  Q R  +   + P   F+R+ +KR T+
Sbjct:  102 KIVKKPKSMQCKVILLDGSEYTCDVEKRSRGQVLFDKVCEHLNLLEKDYFGLTYRDAENQK-NWLDPAKEIKKQVRSGA-WHFSFNVKFYPPDPAQLSEDITRYYLCLQLRDDIVSGRLPCSFVTLALLGSYTVQSELGDYDP--DECGSDYISEFRFAPNHTKELEDKVIELHKSHRGMTPAEAEMHFLENAKKLSMYGVDLHHAKDSEGVEIMLGVCASGLLIYRDRLRINRFAWPKVLKISYKRNNFYIKIRPGEFEQFESTIGFKLPNHRAAKRLWKVCVEHHTFFRLLLP--EAPPKKFLTLGSK-FRYSGRTQAQTRRASALIDRPAPYFERSSSKRYTM 440          
BLAST of Protein 4.1 vs. Ensembl Human
Match: EPB41L3 (erythrocyte membrane protein band 4.1 like 3 [Source:HGNC Symbol;Acc:HGNC:3380])

HSP 1 Score: 355.91 bits (912), Expect = 6.449e-106
Identity = 174/346 (50.29%), Postives = 242/346 (69.94%), Query Frame = 2
Query:  815 KSAKHLSSNKAHIILLDGMEVEFDVDQKMLGKYLFDEVCSYLDLIEKDFFGMTYVNSKLQTWFWLEMDKKISKQLSSADDWAFNFQVKFYPPEPVLLQEDITRYLLSLQVRQDVFTGKLPCSWITQALLGSFMVQSELGDFDELEHEEGIDYLREFEFVLNQSDQLLEKIAELHKKHIGMSPDKADVKYLETAKRLEQYGVDLHPARDNDDVEILIGVCYQGVLIYRDRIRIGRFAWPKVLRISYKKNYFYLKIRSDRYDDSVAIVGFKLFNHNLAKRLWKNAVEQHTFFRMKEPQNQKPTQRYMVSGSSTYGYTGKTLHQYRSMNIARNEPLK-FDRALTKRRTI 1849
            K  K   S +  +ILLDG E   DV+++  G+ LFD+VC +L+L+EKD+FG+TY +++ Q   WL+  K+I KQ+ S   W F+F VKFYPP+P  L EDITRY L LQ+R D+ +G+LPCS++T ALLGS+ VQSELGD+D    E G DY+ EF F  N + +L +K+ ELHK H GM+P +A++ +LE AK+L  YGVDLH A+D++ VEI++GVC  G+LIYRDR+RI RFAWPKVL+ISYK+N FY+KIR   ++   + +GFKL NH  AKRLWK  VE HTFFR+  P  + P ++++  GS  + Y+G+T  Q R  +   + P   F+R+ +KR T+
Sbjct:  102 KIVKKPKSMQCKVILLDGSEYTCDVEKRSRGQVLFDKVCEHLNLLEKDYFGLTYRDAENQK-NWLDPAKEIKKQVRSGA-WHFSFNVKFYPPDPAQLSEDITRYYLCLQLRDDIVSGRLPCSFVTLALLGSYTVQSELGDYDP--DECGSDYISEFRFAPNHTKELEDKVIELHKSHRGMTPAEAEMHFLENAKKLSMYGVDLHHAKDSEGVEIMLGVCASGLLIYRDRLRINRFAWPKVLKISYKRNNFYIKIRPGEFEQFESTIGFKLPNHRAAKRLWKVCVEHHTFFRLLLP--EAPPKKFLTLGSK-FRYSGRTQAQTRRASALIDRPAPYFERSSSKRYTM 440          
BLAST of Protein 4.1 vs. Ensembl Human
Match: EPB41L3 (erythrocyte membrane protein band 4.1 like 3 [Source:HGNC Symbol;Acc:HGNC:3380])

HSP 1 Score: 355.91 bits (912), Expect = 1.254e-105
Identity = 174/346 (50.29%), Postives = 242/346 (69.94%), Query Frame = 2
Query:  815 KSAKHLSSNKAHIILLDGMEVEFDVDQKMLGKYLFDEVCSYLDLIEKDFFGMTYVNSKLQTWFWLEMDKKISKQLSSADDWAFNFQVKFYPPEPVLLQEDITRYLLSLQVRQDVFTGKLPCSWITQALLGSFMVQSELGDFDELEHEEGIDYLREFEFVLNQSDQLLEKIAELHKKHIGMSPDKADVKYLETAKRLEQYGVDLHPARDNDDVEILIGVCYQGVLIYRDRIRIGRFAWPKVLRISYKKNYFYLKIRSDRYDDSVAIVGFKLFNHNLAKRLWKNAVEQHTFFRMKEPQNQKPTQRYMVSGSSTYGYTGKTLHQYRSMNIARNEPLK-FDRALTKRRTI 1849
            K  K   S +  +ILLDG E   DV+++  G+ LFD+VC +L+L+EKD+FG+TY +++ Q   WL+  K+I KQ+ S   W F+F VKFYPP+P  L EDITRY L LQ+R D+ +G+LPCS++T ALLGS+ VQSELGD+D    E G DY+ EF F  N + +L +K+ ELHK H GM+P +A++ +LE AK+L  YGVDLH A+D++ VEI++GVC  G+LIYRDR+RI RFAWPKVL+ISYK+N FY+KIR   ++   + +GFKL NH  AKRLWK  VE HTFFR+  P  + P ++++  GS  + Y+G+T  Q R  +   + P   F+R+ +KR T+
Sbjct:  102 KIVKKPKSMQCKVILLDGSEYTCDVEKRSRGQVLFDKVCEHLNLLEKDYFGLTYRDAENQK-NWLDPAKEIKKQVRSGA-WHFSFNVKFYPPDPAQLSEDITRYYLCLQLRDDIVSGRLPCSFVTLALLGSYTVQSELGDYDP--DECGSDYISEFRFAPNHTKELEDKVIELHKSHRGMTPAEAEMHFLENAKKLSMYGVDLHHAKDSEGVEIMLGVCASGLLIYRDRLRINRFAWPKVLKISYKRNNFYIKIRPGEFEQFESTIGFKLPNHRAAKRLWKVCVEHHTFFRLLLP--EAPPKKFLTLGSK-FRYSGRTQAQTRRASALIDRPAPYFERSSSKRYTM 440          
BLAST of Protein 4.1 vs. Ensembl Celegans
Match: frm-3 (FERM domain (Protein4.1-ezrin-radixin-moesin) family [Source:UniProtKB/TrEMBL;Acc:G5EDC0])

HSP 1 Score: 220.32 bits (560), Expect = 2.252e-58
Identity = 121/362 (33.43%), Postives = 198/362 (54.70%), Query Frame = 2
Query:  851 IILLDGMEVEFDVDQKMLGKYLFDEVCSYLDLIEKDFFGMTYVNSKLQTWFWLEMDKKISKQLSS-ADDWAFNFQVKFYPPEPVLLQEDITRYLLSLQVRQDVFTGKLPCSWITQALLGSFMVQSELGDFDELEHEEGIDYLREFEFVLNQSDQLLEKIAELHKKHIGMSPDKADVKYLETAKRLEQYGVDLHPARDNDDVEILIGVCYQGVLIYRDRIRIGRFAWPKVLRISYKKNYFYLKIRSDRYDDSVAIVGFKLFNHNLAKRLWKNAVEQHTFFRMKEPQNQKPTQRYMVSGSSTYGYTGKTLHQ---YRSMNIARNEPLKFDRALTKRRTIGSMPAGLEKAGMLYSSMHSLNRSHP 1924
            + +LD     F +  K +G+ L DEVC +L+L+E D+FG+++++       WL+ +K I +Q+++ + D  F F VKFY P P+ L+E+ TRYL ++Q+++D+  G+L CS  T +LL +++VQSE GDF   ++ +   YL    FV NQ+ +  +K+ + H+  IGM+P ++D+  LE A+R + YGV LH A+D D  +  + V + G+ ++R       F+W ++ ++S+K+    +K+  D Y      V F     +  K  WK  VE H FFR  + +  K   R+ +S  S++ Y G+T  Q   Y   +  R EP  F R L   R+  S   G       YSS + L    P
Sbjct:   29 VRMLDDTVAVFHLGHKAIGQTLLDEVCRHLNLLECDYFGLSFIDIN-GNHCWLDREKTILRQITNGSTDAKFYFVVKFYTPNPIDLEEEYTRYLFTMQIKRDLALGELHCSDNTASLLSAYLVQSECGDFSSEDYPDAT-YLSHTRFVPNQTLEFQKKVMDNHRNFIGMTPGESDLAMLEVARRCDFYGVKLHAAKDIDGNDAALSVMHLGIKVFRQLQLDTTFSWARIRKLSFKRKKLLVKLHPDSYQYLKETVEFSFETRDECKNFWKKCVEHHAFFRCVQAEEPKKETRFFISKGSSFRYHGRTQKQLIDYVREHHKRREP--FTRPL---RSAASTRKG------TYSSTYGLVTDRP 377          
BLAST of Protein 4.1 vs. Ensembl Celegans
Match: frm-3 (FERM domain (Protein4.1-ezrin-radixin-moesin) family [Source:UniProtKB/TrEMBL;Acc:G5EDC0])

HSP 1 Score: 211.846 bits (538), Expect = 9.484e-56
Identity = 121/360 (33.61%), Postives = 197/360 (54.72%), Query Frame = 2
Query:  857 LLDGMEVEFDVDQKMLGKYLFDEVCSYLDLIEKDFFGMTYVNSKLQTWFWLEMDKKISKQLSS-ADDWAFNFQVKFYPPEPVLLQEDITRYLLSLQVRQDVFTGKLPCSWITQALLGSFMVQSELGDFDELEHEEGIDYLREFEFVLNQSDQLLEKIAELHKKHIGMSPDKADVKYLETAKRLEQYGVDLHPARDNDDVEILIGVCYQGVLIYRDRIRIGRFAWPKVLRISYKKNYFYLKIRSDRYDDSVAIVGFKLFNHNLAKRLWKNAVEQHTFFRMKEPQNQKPTQRYMVSGSSTYGYTGKT---LHQYRSMNIARNEPLKFDRALTKRRTIGSMPAGLEKAGMLYSSMHSLNRSHP 1924
            +LD     F +  K +G+ L DEVC +L+L+E D+FG+++++       WL+ +K I +Q+++ + D  F F VKFY P P+ L+E+ TRYL ++Q+++D+  G+L CS  T +LL +++VQSE GDF   ++ +   YL    FV NQ+ +  +K+ + H+  IGM+P ++D+  LE A+R + YGV LH A+D D  +  + V + G+ ++R       F+W ++ ++S+K+    +K+  D Y      V F     +  K  WK  VE H FFR  + +  K   R+ +S  S++ Y G+T   L  Y   +  R EP  F R L   R+  S   G       YSS + L    P
Sbjct:   43 MLDDTVAVFHLGHKAIGQTLLDEVCRHLNLLECDYFGLSFIDIN-GNHCWLDREKTILRQITNGSTDAKFYFVVKFYTPNPIDLEEEYTRYLFTMQIKRDLALGELHCSDNTASLLSAYLVQSECGDFSSEDYPDAT-YLSHTRFVPNQTLEFQKKVMDNHRNFIGMTPGESDLAMLEVARRCDFYGVKLHAAKDIDGNDAALSVMHLGIKVFRQLQLDTTFSWARIRKLSFKRKKLLVKLHPDSYQYLKETVEFSFETRDECKNFWKKCVEHHAFFRCVQAEEPKKETRFFISKGSSFRYHGRTQKQLIDYVREHHKRREP--FTRPL---RSAASTRKG------TYSSTYGLVTDRP 389          
BLAST of Protein 4.1 vs. Ensembl Celegans
Match: frm-1 (FERM domain (Protein4.1-ezrin-radixin-moesin) family [Source:UniProtKB/TrEMBL;Acc:G5EFD6])

HSP 1 Score: 204.912 bits (520), Expect = 1.977e-55
Identity = 111/331 (33.53%), Postives = 189/331 (57.10%), Query Frame = 2
Query:  845 AHIILLDGMEVEFDVDQKMLGKYLFDEVCSYLDLIEKDFFGMTYVNSKLQTWFWLEMDKKISKQLSSADDWAFNFQVKFYPPEPVLLQEDITRYLLSLQVRQDVFTGKLPCSWITQALLGSFMVQSELGDFDELEHEEGIDYLREFEFV--LNQSDQLLEKIAELHKKHIGMSPDKADVKYLETAKRLEQYGVDLHPA-RDNDDVEILIGVCYQGVLIYRDRIRIGRFAWPKVLRISYKKNYFYLKIRSDRYDDSVAIVGFKLFNHNLAKRLWKNAVEQHTFFRMKEPQNQKPTQRYMVSGSSTYGYTGKTLHQYRSMNIARNEPLKFDRA 1828
            A ++L DG++ EF+V++   G+ LF +V   L + E+++F + + +    T  WL  DK I+KQ+     W F+F+VKFYP  P  + +D  RY + LQ+R+D+ TG+LP +  T +LLGSF+ Q E GD      +    ++   + V     + +  +KI +LH++  G +P +A+ ++L+  K L  YG+ L  A  D D   + +G+   G+ IY+D  +   F+W  +++I Y++ YF +K+++   + +   + FKL NH  AKR WK AVE HTFFR+ +P++ K  + +   GS  + Y G+T  Q +  +   ++P   DRA
Sbjct:   27 AKVLLPDGVQKEFEVNKNSEGEALFRQVTRDLSIEEREYFSLCFYDKDEGTRHWLYNDKNIAKQIKGLP-WEFSFEVKFYPTTPTTIVDDHARYYVFLQLRRDLLTGRLPATADTHSLLGSFVAQIEFGDAPAEMTDAYEQFIVASKLVPSAQANPETYKKIVDLHREMRGQTPSEAENQFLDHCKHLALYGIHLFKAISDKDKKPVDVGIGAAGINIYQDEQKTHSFSWQNIIKIGYRRTYFSIKLKAGTVEKNEKTLYFKLPNHVAAKRTWKCAVEHHTFFRLIQPED-KTHKSFFNFGSQRFRYQGRTQFQTKIASQMFDKPSTVDRA 355          
BLAST of Protein 4.1 vs. Ensembl Celegans
Match: frm-1 (FERM domain (Protein4.1-ezrin-radixin-moesin) family [Source:UniProtKB/TrEMBL;Acc:G5EFD6])

HSP 1 Score: 204.912 bits (520), Expect = 1.977e-55
Identity = 111/331 (33.53%), Postives = 189/331 (57.10%), Query Frame = 2
Query:  845 AHIILLDGMEVEFDVDQKMLGKYLFDEVCSYLDLIEKDFFGMTYVNSKLQTWFWLEMDKKISKQLSSADDWAFNFQVKFYPPEPVLLQEDITRYLLSLQVRQDVFTGKLPCSWITQALLGSFMVQSELGDFDELEHEEGIDYLREFEFV--LNQSDQLLEKIAELHKKHIGMSPDKADVKYLETAKRLEQYGVDLHPA-RDNDDVEILIGVCYQGVLIYRDRIRIGRFAWPKVLRISYKKNYFYLKIRSDRYDDSVAIVGFKLFNHNLAKRLWKNAVEQHTFFRMKEPQNQKPTQRYMVSGSSTYGYTGKTLHQYRSMNIARNEPLKFDRA 1828
            A ++L DG++ EF+V++   G+ LF +V   L + E+++F + + +    T  WL  DK I+KQ+     W F+F+VKFYP  P  + +D  RY + LQ+R+D+ TG+LP +  T +LLGSF+ Q E GD      +    ++   + V     + +  +KI +LH++  G +P +A+ ++L+  K L  YG+ L  A  D D   + +G+   G+ IY+D  +   F+W  +++I Y++ YF +K+++   + +   + FKL NH  AKR WK AVE HTFFR+ +P++ K  + +   GS  + Y G+T  Q +  +   ++P   DRA
Sbjct:   27 AKVLLPDGVQKEFEVNKNSEGEALFRQVTRDLSIEEREYFSLCFYDKDEGTRHWLYNDKNIAKQIKGLP-WEFSFEVKFYPTTPTTIVDDHARYYVFLQLRRDLLTGRLPATADTHSLLGSFVAQIEFGDAPAEMTDAYEQFIVASKLVPSAQANPETYKKIVDLHREMRGQTPSEAENQFLDHCKHLALYGIHLFKAISDKDKKPVDVGIGAAGINIYQDEQKTHSFSWQNIIKIGYRRTYFSIKLKAGTVEKNEKTLYFKLPNHVAAKRTWKCAVEHHTFFRLIQPED-KTHKSFFNFGSQRFRYQGRTQFQTKIASQMFDKPSTVDRA 355          
BLAST of Protein 4.1 vs. Ensembl Celegans
Match: ptp-1 (Tyrosine-protein phosphatase 1 [Source:UniProtKB/Swiss-Prot;Acc:P28191])

HSP 1 Score: 209.534 bits (532), Expect = 4.352e-55
Identity = 120/352 (34.09%), Postives = 204/352 (57.95%), Query Frame = 2
Query:  842 KAHIILLDGMEVEFDVDQKMLGKYLFDEVCSYLDLIEKDFFGMTYV---NSKLQTWFWLEMDKKISKQLSSADDWAFNFQVKFYPPEPVLLQEDITRYLLSLQVRQDVFTGKLPCSWITQALLGSFMVQSELGDFDELEH---EEGIDYLREFEFVLNQSDQLLEKIAELHKKHIGMSPDKADVKYLETAKRLEQYGVDLHPARDNDDVEILIGVCYQGVLIYRDRIRIGRFAWPKVLRISYKKNYFYLKIRSDRYDDSVA--IVGFKLFNHNLAKRLWKNAVEQHTFFRMKEPQNQKPTQRYMVSGSSTYGYTGKTLHQYRSMNIARNEP--LKFDRALTKRRTIGSMPAG 1867
            +  +  LD     F++++  LG  L ++V +YL++IEKD+FG+ ++   NS  Q   WL+  K + KQ+       F F+VKFY  +P  L+++ TR+    QVRQ++  G+LPC+  + ALL S++VQ+E+GDF+E  H      + Y  +F  +    D   +++AELH+ HIG +PD A+  +L+ A+RLE YG+D++   D + + I IGV   G+ ++ + I++  +AW ++ ++S+KK  F + + +   +D V+  I+ F + +  + K LWK  +EQHTFFR+K P   K  QR + +  S + Y+G+T +Q    N  R       F R+L+K   + S  +G
Sbjct:   30 RCTVTFLDSTSYHFEIEKNSLGIVLLEKVFNYLEIIEKDYFGLVFIAVDNSSAQQKKWLDPSKNLRKQMICPPYHLF-FRVKFYVRDPNRLRDEFTRFQFYQQVRQNLEEGRLPCNEGSLALLASYVVQAEVGDFEEKTHGMSRTCLCYKIQFATL---PDDFSDRVAELHQLHIGQTPDVAEQNFLDHARRLEMYGMDVYDGVDANHLPIEIGVGAVGIKVFHEGIKMNEYAWVRIRKLSFKKKQFQVLVAN---EDGVSETIMIFNIMSAKICKLLWKCCIEQHTFFRLKTP--PKTPQRKVFNFGSKFRYSGRTEYQTLEENEHRKSAGHRNFHRSLSKSSFLRSTFSG 372          
BLAST of Protein 4.1 vs. Ensembl Fly
Match: cora (gene:FBgn0010434 transcript:FBtr0301279)

HSP 1 Score: 341.658 bits (875), Expect = 7.107e-103
Identity = 158/333 (47.45%), Postives = 233/333 (69.97%), Query Frame = 2
Query:  845 AHIILLDGMEVEFDVDQKMLGKYLFDEVCSYLDLIEKDFFGMTYVNSKLQTWFWLEMDKKISKQLSSADDWAFNFQVKFYPPEPVLLQEDITRYLLSLQVRQDVFTGKLPCSWITQALLGSFMVQSELGDFDELEHEEGIDYLREFEFVLNQSDQLLEKIAELHKKHIGMSPDKADVKYLETAKRLEQYGVDLHPARDNDDVEILIGVCYQGVLIYRDRIRIGRFAWPKVLRISYKKNYFYLKIRSDRYDDSVAIVGFKLFNHNLAKRLWKNAVEQHTFFRMKEPQNQKPTQRYMVSGSSTYGYTGKTLHQYRSMNIARNEPLKFDRALTKRR 1843
            A + LLDG  ++  +D+K +G+ + + +C+ L+LIEKD+FG+TY  +      WL+++K +SK   + D W   F VKFYPPEP  L+EDITRY L LQVR D+  G+LPC+++T ALLGS++VQSE+GD+D  E      YL++F+   NQ+ +L +K+ +LHK H G SP +A++ YLE AK+L  YGVDLHPA+D++ V+I++GVC  G+L+YRD++RI RFAWPK+L+ISYK+++FY+KIR   ++   + +GFKL NH  AK+LWK+ VE HTFFR+  P+    ++ + V G STY Y G+T  +  +  + R  P KF+R L+  R
Sbjct:   34 ARVTLLDGSLLDVSIDRKAIGRDVINSICAGLNLIEKDYFGLTY-ETPTDPRTWLDLEKPVSKFFRT-DTWPLTFAVKFYPPEPSQLKEDITRYHLCLQVRNDILEGRLPCTFVTHALLGSYLVQSEMGDYDAEEMPTRA-YLKDFKIAPNQTAELEDKVMDLHKTHKGQSPAEAELHYLENAKKLAMYGVDLHPAKDSEGVDIMLGVCASGLLVYRDKLRINRFAWPKILKISYKRHHFYIKIRPGEFEQYESTIGFKLANHRAAKKLWKSCVEHHTFFRLMTPEPVSKSKMFPVFG-STYRYKGRTQAESTNTPVDRTPP-KFNRTLSGAR 361          
BLAST of Protein 4.1 vs. Ensembl Fly
Match: cora (gene:FBgn0010434 transcript:FBtr0086506)

HSP 1 Score: 341.658 bits (875), Expect = 8.532e-103
Identity = 158/333 (47.45%), Postives = 233/333 (69.97%), Query Frame = 2
Query:  845 AHIILLDGMEVEFDVDQKMLGKYLFDEVCSYLDLIEKDFFGMTYVNSKLQTWFWLEMDKKISKQLSSADDWAFNFQVKFYPPEPVLLQEDITRYLLSLQVRQDVFTGKLPCSWITQALLGSFMVQSELGDFDELEHEEGIDYLREFEFVLNQSDQLLEKIAELHKKHIGMSPDKADVKYLETAKRLEQYGVDLHPARDNDDVEILIGVCYQGVLIYRDRIRIGRFAWPKVLRISYKKNYFYLKIRSDRYDDSVAIVGFKLFNHNLAKRLWKNAVEQHTFFRMKEPQNQKPTQRYMVSGSSTYGYTGKTLHQYRSMNIARNEPLKFDRALTKRR 1843
            A + LLDG  ++  +D+K +G+ + + +C+ L+LIEKD+FG+TY  +      WL+++K +SK   + D W   F VKFYPPEP  L+EDITRY L LQVR D+  G+LPC+++T ALLGS++VQSE+GD+D  E      YL++F+   NQ+ +L +K+ +LHK H G SP +A++ YLE AK+L  YGVDLHPA+D++ V+I++GVC  G+L+YRD++RI RFAWPK+L+ISYK+++FY+KIR   ++   + +GFKL NH  AK+LWK+ VE HTFFR+  P+    ++ + V G STY Y G+T  +  +  + R  P KF+R L+  R
Sbjct:   34 ARVTLLDGSLLDVSIDRKAIGRDVINSICAGLNLIEKDYFGLTY-ETPTDPRTWLDLEKPVSKFFRT-DTWPLTFAVKFYPPEPSQLKEDITRYHLCLQVRNDILEGRLPCTFVTHALLGSYLVQSEMGDYDA-EEMPTRAYLKDFKIAPNQTAELEDKVMDLHKTHKGQSPAEAELHYLENAKKLAMYGVDLHPAKDSEGVDIMLGVCASGLLVYRDKLRINRFAWPKILKISYKRHHFYIKIRPGEFEQYESTIGFKLANHRAAKKLWKSCVEHHTFFRLMTPEPVSKSKMFPVFG-STYRYKGRTQAESTNTPVDRTPP-KFNRTLSGAR 361          
BLAST of Protein 4.1 vs. Ensembl Fly
Match: cora (gene:FBgn0010434 transcript:FBtr0086508)

HSP 1 Score: 342.813 bits (878), Expect = 2.433e-101
Identity = 158/333 (47.45%), Postives = 233/333 (69.97%), Query Frame = 2
Query:  845 AHIILLDGMEVEFDVDQKMLGKYLFDEVCSYLDLIEKDFFGMTYVNSKLQTWFWLEMDKKISKQLSSADDWAFNFQVKFYPPEPVLLQEDITRYLLSLQVRQDVFTGKLPCSWITQALLGSFMVQSELGDFDELEHEEGIDYLREFEFVLNQSDQLLEKIAELHKKHIGMSPDKADVKYLETAKRLEQYGVDLHPARDNDDVEILIGVCYQGVLIYRDRIRIGRFAWPKVLRISYKKNYFYLKIRSDRYDDSVAIVGFKLFNHNLAKRLWKNAVEQHTFFRMKEPQNQKPTQRYMVSGSSTYGYTGKTLHQYRSMNIARNEPLKFDRALTKRR 1843
            A + LLDG  ++  +D+K +G+ + + +C+ L+LIEKD+FG+TY  +      WL+++K +SK   + D W   F VKFYPPEP  L+EDITRY L LQVR D+  G+LPC+++T ALLGS++VQSE+GD+D  E      YL++F+   NQ+ +L +K+ +LHK H G SP +A++ YLE AK+L  YGVDLHPA+D++ V+I++GVC  G+L+YRD++RI RFAWPK+L+ISYK+++FY+KIR   ++   + +GFKL NH  AK+LWK+ VE HTFFR+  P+    ++ + V G STY Y G+T  +  +  + R  P KF+R L+  R
Sbjct:   34 ARVTLLDGSLLDVSIDRKAIGRDVINSICAGLNLIEKDYFGLTY-ETPTDPRTWLDLEKPVSKFFRT-DTWPLTFAVKFYPPEPSQLKEDITRYHLCLQVRNDILEGRLPCTFVTHALLGSYLVQSEMGDYDAEEMPTRA-YLKDFKIAPNQTAELEDKVMDLHKTHKGQSPAEAELHYLENAKKLAMYGVDLHPAKDSEGVDIMLGVCASGLLVYRDKLRINRFAWPKILKISYKRHHFYIKIRPGEFEQYESTIGFKLANHRAAKKLWKSCVEHHTFFRLMTPEPVSKSKMFPVFG-STYRYKGRTQAESTNTPVDRTPP-KFNRTLSGAR 361          
BLAST of Protein 4.1 vs. Ensembl Fly
Match: cora (gene:FBgn0010434 transcript:FBtr0340468)

HSP 1 Score: 343.969 bits (881), Expect = 5.985e-98
Identity = 158/333 (47.45%), Postives = 233/333 (69.97%), Query Frame = 2
Query:  845 AHIILLDGMEVEFDVDQKMLGKYLFDEVCSYLDLIEKDFFGMTYVNSKLQTWFWLEMDKKISKQLSSADDWAFNFQVKFYPPEPVLLQEDITRYLLSLQVRQDVFTGKLPCSWITQALLGSFMVQSELGDFDELEHEEGIDYLREFEFVLNQSDQLLEKIAELHKKHIGMSPDKADVKYLETAKRLEQYGVDLHPARDNDDVEILIGVCYQGVLIYRDRIRIGRFAWPKVLRISYKKNYFYLKIRSDRYDDSVAIVGFKLFNHNLAKRLWKNAVEQHTFFRMKEPQNQKPTQRYMVSGSSTYGYTGKTLHQYRSMNIARNEPLKFDRALTKRR 1843
            A + LLDG  ++  +D+K +G+ + + +C+ L+LIEKD+FG+TY  +      WL+++K +SK   + D W   F VKFYPPEP  L+EDITRY L LQVR D+  G+LPC+++T ALLGS++VQSE+GD+D  E      YL++F+   NQ+ +L +K+ +LHK H G SP +A++ YLE AK+L  YGVDLHPA+D++ V+I++GVC  G+L+YRD++RI RFAWPK+L+ISYK+++FY+KIR   ++   + +GFKL NH  AK+LWK+ VE HTFFR+  P+    ++ + V G STY Y G+T  +  +  + R  P KF+R L+  R
Sbjct:   34 ARVTLLDGSLLDVSIDRKAIGRDVINSICAGLNLIEKDYFGLTY-ETPTDPRTWLDLEKPVSKFFRT-DTWPLTFAVKFYPPEPSQLKEDITRYHLCLQVRNDILEGRLPCTFVTHALLGSYLVQSEMGDYDAEEMPTRA-YLKDFKIAPNQTAELEDKVMDLHKTHKGQSPAEAELHYLENAKKLAMYGVDLHPAKDSEGVDIMLGVCASGLLVYRDKLRINRFAWPKILKISYKRHHFYIKIRPGEFEQYESTIGFKLANHRAAKKLWKSCVEHHTFFRLMTPEPVSKSKMFPVFG-STYRYKGRTQAESTNTPVDRTPP-KFNRTLSGAR 361          
BLAST of Protein 4.1 vs. Ensembl Fly
Match: cora (gene:FBgn0010434 transcript:FBtr0340469)

HSP 1 Score: 344.354 bits (882), Expect = 6.675e-98
Identity = 158/333 (47.45%), Postives = 233/333 (69.97%), Query Frame = 2
Query:  845 AHIILLDGMEVEFDVDQKMLGKYLFDEVCSYLDLIEKDFFGMTYVNSKLQTWFWLEMDKKISKQLSSADDWAFNFQVKFYPPEPVLLQEDITRYLLSLQVRQDVFTGKLPCSWITQALLGSFMVQSELGDFDELEHEEGIDYLREFEFVLNQSDQLLEKIAELHKKHIGMSPDKADVKYLETAKRLEQYGVDLHPARDNDDVEILIGVCYQGVLIYRDRIRIGRFAWPKVLRISYKKNYFYLKIRSDRYDDSVAIVGFKLFNHNLAKRLWKNAVEQHTFFRMKEPQNQKPTQRYMVSGSSTYGYTGKTLHQYRSMNIARNEPLKFDRALTKRR 1843
            A + LLDG  ++  +D+K +G+ + + +C+ L+LIEKD+FG+TY  +      WL+++K +SK   + D W   F VKFYPPEP  L+EDITRY L LQVR D+  G+LPC+++T ALLGS++VQSE+GD+D  E      YL++F+   NQ+ +L +K+ +LHK H G SP +A++ YLE AK+L  YGVDLHPA+D++ V+I++GVC  G+L+YRD++RI RFAWPK+L+ISYK+++FY+KIR   ++   + +GFKL NH  AK+LWK+ VE HTFFR+  P+    ++ + V G STY Y G+T  +  +  + R  P KF+R L+  R
Sbjct:   34 ARVTLLDGSLLDVSIDRKAIGRDVINSICAGLNLIEKDYFGLTY-ETPTDPRTWLDLEKPVSKFFRT-DTWPLTFAVKFYPPEPSQLKEDITRYHLCLQVRNDILEGRLPCTFVTHALLGSYLVQSEMGDYDAEEMPTRA-YLKDFKIAPNQTAELEDKVMDLHKTHKGQSPAEAELHYLENAKKLAMYGVDLHPAKDSEGVDIMLGVCASGLLVYRDKLRINRFAWPKILKISYKRHHFYIKIRPGEFEQYESTIGFKLANHRAAKKLWKSCVEHHTFFRLMTPEPVSKSKMFPVFG-STYRYKGRTQAESTNTPVDRTPP-KFNRTLSGAR 361          
BLAST of Protein 4.1 vs. Ensembl Zebrafish
Match: EPB41L2 (si:ch73-18b11.1 [Source:ZFIN;Acc:ZDB-GENE-070912-332])

HSP 1 Score: 347.051 bits (889), Expect = 4.672e-104
Identity = 163/342 (47.66%), Postives = 239/342 (69.88%), Query Frame = 2
Query:  845 AHIILLDGMEVEFDVDQKMLGKYLFDEVCSYLDLIEKDFFGMTYVNSKLQTWFWLEMDKKISKQLSSADDWAFNFQVKFYPPEPVLLQEDITRYLLSLQVRQDVFTGKLPCSWITQALLGSFMVQSELGDFDELEHEEGIDYLREFEFVLNQSDQLLEKIAELHKKHIGMSPDKADVKYLETAKRLEQYGVDLHPARDNDDVEILIGVCYQGVLIYRDRIRIGRFAWPKVLRISYKKNYFYLKIRSDRYDDSVAIVGFKLFNHNLAKRLWKNAVEQHTFFRMKEPQNQKPTQRYMVSGSSTYGYTGKTLHQYRSMNIARNEPLK-FDRALTKR--RTIGSMP 1861
             H+ LLDG +   +V+++  G+YLF EVC +L+L+EKD+F +++ ++  Q   WL+  K+I +Q+ ++  W F F VKFYPP+P  L ED+TRYLL LQ+RQD+ +G+LPCS++T ALLGS+ +Q+ELGD D  EH   +DY+ +F+F  NQ+ +L EK+ ELHK H GM+P +AD ++LE AK+L  YGVDLH A+D++ V+I++GVC  G+LIY+DR+RI RFAWPK+L+ISYK++ FY+KIR    +   + VGFKL NH  AKR+WK  VE HTFFR+  P  ++PT+   ++  S + Y+G+T  Q R  +   + P   F R  +KR  R++   P
Sbjct:    6 CHVTLLDGSQFSCEVEKRAKGQYLFFEVCEHLNLVEKDYFALSFKDNAEQRC-WLDPTKEIKRQIRNSQ-WQFAFSVKFYPPDPSQLTEDLTRYLLCLQLRQDIASGRLPCSFVTHALLGSYALQAELGDQDPDEHR--LDYISDFQFAPNQTKELEEKVMELHKSHRGMTPAQADAQFLENAKKLSMYGVDLHHAKDSEGVDIMLGVCANGLLIYKDRLRINRFAWPKILKISYKRSNFYIKIRPGEAEQFESTVGFKLPNHRAAKRVWKVCVEHHTFFRLTSP--EQPTKSKFLTLGSKFRYSGRTQAQARQASTLIDRPTPYFQRTSSKRISRSLDGAP 341          
BLAST of Protein 4.1 vs. Ensembl Zebrafish
Match: si:dkey-178k16.1 (si:dkey-178k16.1 [Source:ZFIN;Acc:ZDB-GENE-090312-61])

HSP 1 Score: 338.191 bits (866), Expect = 1.225e-103
Identity = 158/331 (47.73%), Postives = 236/331 (71.30%), Query Frame = 2
Query:  851 IILLDGMEVEFDVDQKMLGKYLFDEVCSYLDLIEKDFFGMTYVNSKLQTWFWLEMDKKISKQLSSADDWAFNFQVKFYPPEPVLLQEDITRYLLSLQVRQDVFTGKLPCSWITQALLGSFMVQSELGDFDELEHEEGIDYLREFEFVLNQSDQLLEKIAELHKKHIGMSPDKADVKYLETAKRLEQYGVDLHPARDNDDVEILIGVCYQGVLIYRDRIRIGRFAWPKVLRISYKKNYFYLKIRSDRYDDSVAIVGFKLFNHNLAKRLWKNAVEQHTFFRMKEPQNQKPTQRYMVSGSSTYGYTGKTLHQYRSMNIARNEPL-KFDRALTKR 1840
            ++LLDG   E  V++   G+ L D VC +L+L+EKD+FG+++ +++ Q   WL+  K+I KQ+     W F+F VKFYPP+P  L EDITRY L LQ+R+D+ +G+LPCS++T ALLGS+ +Q+ELGD+D  EH  G DY+ EF F  NQ+ +L E++ ELH+ + GMSP +A++ +LE AK+L  YGVDLH A+D++ ++I++GVC  G+LIYRDR+RI RFAWPK+L+ISYK++ FY+KIR   Y+   + +GFKL NH  +KRLWK  +E HTFFR+  P  + P + ++V GS  + Y+G+T  Q R  +   + P  +F+R++++R
Sbjct:   58 VLLLDGSAYESGVEKLCKGQVLLDMVCEHLNLLEKDYFGLSFSDTECQK-NWLDPSKEIKKQIRVGP-WHFSFAVKFYPPDPSQLIEDITRYYLCLQLREDILSGRLPCSFVTHALLGSYAIQAELGDYDPEEH--GPDYINEFRFAPNQTRELEERVMELHRTYRGMSPAEAEINFLENAKKLSMYGVDLHHAKDSEGIDIMLGVCASGLLIYRDRLRINRFAWPKILKISYKRSNFYIKIRPGEYEQFESTIGFKLPNHRASKRLWKVCIEHHTFFRLVSP--EPPPKGFLVIGSK-FRYSGRTQAQSRQASALIDRPAPQFERSISRR 381          
BLAST of Protein 4.1 vs. Ensembl Zebrafish
Match: si:dkey-178k16.1 (si:dkey-178k16.1 [Source:ZFIN;Acc:ZDB-GENE-090312-61])

HSP 1 Score: 341.658 bits (875), Expect = 3.763e-101
Identity = 158/331 (47.73%), Postives = 236/331 (71.30%), Query Frame = 2
Query:  851 IILLDGMEVEFDVDQKMLGKYLFDEVCSYLDLIEKDFFGMTYVNSKLQTWFWLEMDKKISKQLSSADDWAFNFQVKFYPPEPVLLQEDITRYLLSLQVRQDVFTGKLPCSWITQALLGSFMVQSELGDFDELEHEEGIDYLREFEFVLNQSDQLLEKIAELHKKHIGMSPDKADVKYLETAKRLEQYGVDLHPARDNDDVEILIGVCYQGVLIYRDRIRIGRFAWPKVLRISYKKNYFYLKIRSDRYDDSVAIVGFKLFNHNLAKRLWKNAVEQHTFFRMKEPQNQKPTQRYMVSGSSTYGYTGKTLHQYRSMNIARNEPL-KFDRALTKR 1840
            ++LLDG   E  V++   G+ L D VC +L+L+EKD+FG+++ +++ Q   WL+  K+I KQ+     W F+F VKFYPP+P  L EDITRY L LQ+R+D+ +G+LPCS++T ALLGS+ +Q+ELGD+D  EH  G DY+ EF F  NQ+ +L E++ ELH+ + GMSP +A++ +LE AK+L  YGVDLH A+D++ ++I++GVC  G+LIYRDR+RI RFAWPK+L+ISYK++ FY+KIR   Y+   + +GFKL NH  +KRLWK  +E HTFFR+  P  + P + ++V GS  + Y+G+T  Q R  +   + P  +F+R++++R
Sbjct:   58 VLLLDGSAYESGVEKLCKGQVLLDMVCEHLNLLEKDYFGLSFSDTECQK-NWLDPSKEIKKQIRVGP-WHFSFAVKFYPPDPSQLIEDITRYYLCLQLREDILSGRLPCSFVTHALLGSYAIQAELGDYDPEEH--GPDYINEFRFAPNQTRELEERVMELHRTYRGMSPAEAEINFLENAKKLSMYGVDLHHAKDSEGIDIMLGVCASGLLIYRDRLRINRFAWPKILKISYKRSNFYIKIRPGEYEQFESTIGFKLPNHRASKRLWKVCIEHHTFFRLVSP--EPPPKGFLVIGSK-FRYSGRTQAQSRQASALIDRPAPQFERSISRR 381          
BLAST of Protein 4.1 vs. Ensembl Zebrafish
Match: epb41l3a (erythrocyte membrane protein band 4.1-like 3a [Source:ZFIN;Acc:ZDB-GENE-040822-8])

HSP 1 Score: 337.421 bits (864), Expect = 6.600e-100
Identity = 176/373 (47.18%), Postives = 244/373 (65.42%), Query Frame = 2
Query:  806 KISKSAKHLSSNKAHIILLDGMEVEFDVDQKMLGKYLFDEVCSYLDLIEKDFFGMTYVNSKLQTWFWLEMDKKISKQLSSADDWAFNFQVKFYPPEPVLLQEDITRYLLSLQVRQDVFTGKLPCSWITQALLGSFMVQSELGDFDELEHEEGIDYLREFEFVLNQSDQLLEKIAELHKKHIGMSPDKADVKYLETAKRLEQYGVDLHPARDNDDVEILIGVCYQGVLIYRDRIRIGRFAWPKVLRISYKKNYFYLKIRSDRYDDSVAIVGFKLFNHNLAKRLWKNAVEQHTFFRMKEPQNQKPTQRYMVSGSSTYGYTGKTLHQYR--SMNIARNEPLKFDRALTKRRTIGSMPAGLEKAGMLYSSMHSLNRS 1918
            KISK  K++   +  I LLDG +    V+++  G+ LFD+VC +L+L+EKD+FG+T+ + + Q   WL+  K + KQ+     W F+F VKFYPPEP LL EDITRY L LQ+R D+ +G+LPCS+ T  +LGS+ VQSELGD D    E G +Y  EF F   Q+ ++ EKI +LHK + GM+P +A++ +LE  K+L  YGVDLH A+D++ VEI++GVC  G+LIYRDR+RI RFAWPKVL+ISYK+N FY+KIR   ++   + +GFKL NH  AKRLWK  VE HTFFR+  P+   P ++++  GS  + Y+G+T  Q R  S  I R  P  F R+ +KR T+     G E    LY +   +  S
Sbjct:   82 KISKKPKNM---QCKITLLDGSDYTCVVEKRDKGQVLFDKVCEHLNLLEKDYFGITFRDVENQK-NWLDPAKDMKKQIRGVA-WNFSFNVKFYPPEPALLSEDITRYYLCLQLRDDISSGRLPCSFATHTVLGSYTVQSELGDHDP--EECGSEYTSEFRFAPQQTKEMEEKIIDLHKNYKGMTPAEAEMHFLENVKKLSMYGVDLHHAKDSEGVEIMLGVCSSGLLIYRDRLRINRFAWPKVLKISYKRNNFYIKIRPGEFEQFESTIGFKLPNHRAAKRLWKVCVEHHTFFRLVLPET--PPKKFLTLGSK-FRYSGRTQAQTRRASSQIVRPAPY-FQRSSSKRYTMSRSLDG-EMGTALYGAAKGIAMS 442          
BLAST of Protein 4.1 vs. Ensembl Zebrafish
Match: epb41l3a (erythrocyte membrane protein band 4.1-like 3a [Source:ZFIN;Acc:ZDB-GENE-040822-8])

HSP 1 Score: 337.421 bits (864), Expect = 6.600e-100
Identity = 176/373 (47.18%), Postives = 244/373 (65.42%), Query Frame = 2
Query:  806 KISKSAKHLSSNKAHIILLDGMEVEFDVDQKMLGKYLFDEVCSYLDLIEKDFFGMTYVNSKLQTWFWLEMDKKISKQLSSADDWAFNFQVKFYPPEPVLLQEDITRYLLSLQVRQDVFTGKLPCSWITQALLGSFMVQSELGDFDELEHEEGIDYLREFEFVLNQSDQLLEKIAELHKKHIGMSPDKADVKYLETAKRLEQYGVDLHPARDNDDVEILIGVCYQGVLIYRDRIRIGRFAWPKVLRISYKKNYFYLKIRSDRYDDSVAIVGFKLFNHNLAKRLWKNAVEQHTFFRMKEPQNQKPTQRYMVSGSSTYGYTGKTLHQYR--SMNIARNEPLKFDRALTKRRTIGSMPAGLEKAGMLYSSMHSLNRS 1918
            KISK  K++   +  I LLDG +    V+++  G+ LFD+VC +L+L+EKD+FG+T+ + + Q   WL+  K + KQ+     W F+F VKFYPPEP LL EDITRY L LQ+R D+ +G+LPCS+ T  +LGS+ VQSELGD D    E G +Y  EF F   Q+ ++ EKI +LHK + GM+P +A++ +LE  K+L  YGVDLH A+D++ VEI++GVC  G+LIYRDR+RI RFAWPKVL+ISYK+N FY+KIR   ++   + +GFKL NH  AKRLWK  VE HTFFR+  P+   P ++++  GS  + Y+G+T  Q R  S  I R  P  F R+ +KR T+     G E    LY +   +  S
Sbjct:   82 KISKKPKNM---QCKITLLDGSDYTCVVEKRDKGQVLFDKVCEHLNLLEKDYFGITFRDVENQK-NWLDPAKDMKKQIRGVA-WNFSFNVKFYPPEPALLSEDITRYYLCLQLRDDISSGRLPCSFATHTVLGSYTVQSELGDHDP--EECGSEYTSEFRFAPQQTKEMEEKIIDLHKNYKGMTPAEAEMHFLENVKKLSMYGVDLHHAKDSEGVEIMLGVCSSGLLIYRDRLRINRFAWPKVLKISYKRNNFYIKIRPGEFEQFESTIGFKLPNHRAAKRLWKVCVEHHTFFRLVLPET--PPKKFLTLGSK-FRYSGRTQAQTRRASSQIVRPAPY-FQRSSSKRYTMSRSLDG-EMGTALYGAAKGIAMS 442          
BLAST of Protein 4.1 vs. Ensembl Xenopus
Match: dcx (doublecortin [Source:Xenbase;Acc:XB-GENE-992092])

HSP 1 Score: 350.132 bits (897), Expect = 1.512e-104
Identity = 172/346 (49.71%), Postives = 244/346 (70.52%), Query Frame = 2
Query:  815 KSAKHLSSNKAHIILLDGMEVEFDVDQKMLGKYLFDEVCSYLDLIEKDFFGMTYVNSKLQTWFWLEMDKKISKQLSSADDWAFNFQVKFYPPEPVLLQEDITRYLLSLQVRQDVFTGKLPCSWITQALLGSFMVQSELGDFDELEHEEGIDYLREFEFVLNQSDQLLEKIAELHKKHIGMSPDKADVKYLETAKRLEQYGVDLHPARDNDDVEILIGVCYQGVLIYRDRIRIGRFAWPKVLRISYKKNYFYLKIRSDRYDDSVAIVGFKLFNHNLAKRLWKNAVEQHTFFRMKEPQNQKPTQRYMVSGSSTYGYTGKTLHQYRSMNIARNEPLK-FDRALTKRRTI 1849
            KSA+   + +A ++LLDG E   +V+++  G+ LFD+VC +L+L+EKD+FG+ Y +S+ Q   WL+  K+I KQ  +   W F+F VKFYPP+P  L EDITRY L LQ+R D+  G+LPCS++T ALLGS+ VQSELGD+D  E+  G DY+ EF F  NQ+ +L +K+ ELHK + GM+P +A++ +LE AK+L  YGVDLH A+D++ VEI++GVC  G+LIYRDR+RI RFAWPKVL+ISYK+N FY+KIR   ++   + +GFKL NH  AKRLWK  VE HTFFR+  P  + P ++++  GS  + Y+G+T  Q R  +   + P   F+R+ +KR T+
Sbjct:  102 KSARRPKNMQAKVMLLDGSEYSCEVEKRSKGQILFDKVCEHLNLLEKDYFGLVYRDSENQK-NWLDPAKEIKKQTRNGA-WHFSFNVKFYPPDPSQLSEDITRYYLCLQLRDDIVCGRLPCSFVTLALLGSYSVQSELGDYDPEEY--GSDYVTEFRFAPNQTKELEDKVVELHKSYRGMTPAEAEMHFLENAKKLSMYGVDLHHAKDSEGVEIMLGVCASGLLIYRDRLRINRFAWPKVLKISYKRNNFYIKIRPGEFEQFESTIGFKLPNHRAAKRLWKVCVEHHTFFRLLMP--EAPPKKFLTLGSK-FRYSGRTQAQTRRASALIDRPAPYFERSSSKRYTM 440          
BLAST of Protein 4.1 vs. Ensembl Xenopus
Match: dcx (doublecortin [Source:Xenbase;Acc:XB-GENE-992092])

HSP 1 Score: 350.132 bits (897), Expect = 2.639e-104
Identity = 172/346 (49.71%), Postives = 244/346 (70.52%), Query Frame = 2
Query:  815 KSAKHLSSNKAHIILLDGMEVEFDVDQKMLGKYLFDEVCSYLDLIEKDFFGMTYVNSKLQTWFWLEMDKKISKQLSSADDWAFNFQVKFYPPEPVLLQEDITRYLLSLQVRQDVFTGKLPCSWITQALLGSFMVQSELGDFDELEHEEGIDYLREFEFVLNQSDQLLEKIAELHKKHIGMSPDKADVKYLETAKRLEQYGVDLHPARDNDDVEILIGVCYQGVLIYRDRIRIGRFAWPKVLRISYKKNYFYLKIRSDRYDDSVAIVGFKLFNHNLAKRLWKNAVEQHTFFRMKEPQNQKPTQRYMVSGSSTYGYTGKTLHQYRSMNIARNEPLK-FDRALTKRRTI 1849
            KSA+   + +A ++LLDG E   +V+++  G+ LFD+VC +L+L+EKD+FG+ Y +S+ Q   WL+  K+I KQ  +   W F+F VKFYPP+P  L EDITRY L LQ+R D+  G+LPCS++T ALLGS+ VQSELGD+D  E+  G DY+ EF F  NQ+ +L +K+ ELHK + GM+P +A++ +LE AK+L  YGVDLH A+D++ VEI++GVC  G+LIYRDR+RI RFAWPKVL+ISYK+N FY+KIR   ++   + +GFKL NH  AKRLWK  VE HTFFR+  P  + P ++++  GS  + Y+G+T  Q R  +   + P   F+R+ +KR T+
Sbjct:  102 KSARRPKNMQAKVMLLDGSEYSCEVEKRSKGQILFDKVCEHLNLLEKDYFGLVYRDSENQK-NWLDPAKEIKKQTRNGA-WHFSFNVKFYPPDPSQLSEDITRYYLCLQLRDDIVCGRLPCSFVTLALLGSYSVQSELGDYDPEEY--GSDYVTEFRFAPNQTKELEDKVVELHKSYRGMTPAEAEMHFLENAKKLSMYGVDLHHAKDSEGVEIMLGVCASGLLIYRDRLRINRFAWPKVLKISYKRNNFYIKIRPGEFEQFESTIGFKLPNHRAAKRLWKVCVEHHTFFRLLMP--EAPPKKFLTLGSK-FRYSGRTQAQTRRASALIDRPAPYFERSSSKRYTM 440          
BLAST of Protein 4.1 vs. Ensembl Xenopus
Match: dcx (doublecortin [Source:Xenbase;Acc:XB-GENE-992092])

HSP 1 Score: 350.903 bits (899), Expect = 3.293e-104
Identity = 172/346 (49.71%), Postives = 244/346 (70.52%), Query Frame = 2
Query:  815 KSAKHLSSNKAHIILLDGMEVEFDVDQKMLGKYLFDEVCSYLDLIEKDFFGMTYVNSKLQTWFWLEMDKKISKQLSSADDWAFNFQVKFYPPEPVLLQEDITRYLLSLQVRQDVFTGKLPCSWITQALLGSFMVQSELGDFDELEHEEGIDYLREFEFVLNQSDQLLEKIAELHKKHIGMSPDKADVKYLETAKRLEQYGVDLHPARDNDDVEILIGVCYQGVLIYRDRIRIGRFAWPKVLRISYKKNYFYLKIRSDRYDDSVAIVGFKLFNHNLAKRLWKNAVEQHTFFRMKEPQNQKPTQRYMVSGSSTYGYTGKTLHQYRSMNIARNEPLK-FDRALTKRRTI 1849
            KSA+   + +A ++LLDG E   +V+++  G+ LFD+VC +L+L+EKD+FG+ Y +S+ Q   WL+  K+I KQ  +   W F+F VKFYPP+P  L EDITRY L LQ+R D+  G+LPCS++T ALLGS+ VQSELGD+D  E+  G DY+ EF F  NQ+ +L +K+ ELHK + GM+P +A++ +LE AK+L  YGVDLH A+D++ VEI++GVC  G+LIYRDR+RI RFAWPKVL+ISYK+N FY+KIR   ++   + +GFKL NH  AKRLWK  VE HTFFR+  P  + P ++++  GS  + Y+G+T  Q R  +   + P   F+R+ +KR T+
Sbjct:  102 KSARRPKNMQAKVMLLDGSEYSCEVEKRSKGQILFDKVCEHLNLLEKDYFGLVYRDSENQK-NWLDPAKEIKKQTRNGA-WHFSFNVKFYPPDPSQLSEDITRYYLCLQLRDDIVCGRLPCSFVTLALLGSYSVQSELGDYDPEEY--GSDYVTEFRFAPNQTKELEDKVVELHKSYRGMTPAEAEMHFLENAKKLSMYGVDLHHAKDSEGVEIMLGVCASGLLIYRDRLRINRFAWPKVLKISYKRNNFYIKIRPGEFEQFESTIGFKLPNHRAAKRLWKVCVEHHTFFRLLMP--EAPPKKFLTLGSK-FRYSGRTQAQTRRASALIDRPAPYFERSSSKRYTM 440          
BLAST of Protein 4.1 vs. Ensembl Xenopus
Match: dcx (doublecortin [Source:Xenbase;Acc:XB-GENE-992092])

HSP 1 Score: 350.132 bits (897), Expect = 4.466e-104
Identity = 172/346 (49.71%), Postives = 244/346 (70.52%), Query Frame = 2
Query:  815 KSAKHLSSNKAHIILLDGMEVEFDVDQKMLGKYLFDEVCSYLDLIEKDFFGMTYVNSKLQTWFWLEMDKKISKQLSSADDWAFNFQVKFYPPEPVLLQEDITRYLLSLQVRQDVFTGKLPCSWITQALLGSFMVQSELGDFDELEHEEGIDYLREFEFVLNQSDQLLEKIAELHKKHIGMSPDKADVKYLETAKRLEQYGVDLHPARDNDDVEILIGVCYQGVLIYRDRIRIGRFAWPKVLRISYKKNYFYLKIRSDRYDDSVAIVGFKLFNHNLAKRLWKNAVEQHTFFRMKEPQNQKPTQRYMVSGSSTYGYTGKTLHQYRSMNIARNEPLK-FDRALTKRRTI 1849
            KSA+   + +A ++LLDG E   +V+++  G+ LFD+VC +L+L+EKD+FG+ Y +S+ Q   WL+  K+I KQ  +   W F+F VKFYPP+P  L EDITRY L LQ+R D+  G+LPCS++T ALLGS+ VQSELGD+D  E+  G DY+ EF F  NQ+ +L +K+ ELHK + GM+P +A++ +LE AK+L  YGVDLH A+D++ VEI++GVC  G+LIYRDR+RI RFAWPKVL+ISYK+N FY+KIR   ++   + +GFKL NH  AKRLWK  VE HTFFR+  P  + P ++++  GS  + Y+G+T  Q R  +   + P   F+R+ +KR T+
Sbjct:  102 KSARRPKNMQAKVMLLDGSEYSCEVEKRSKGQILFDKVCEHLNLLEKDYFGLVYRDSENQK-NWLDPAKEIKKQTRNGA-WHFSFNVKFYPPDPSQLSEDITRYYLCLQLRDDIVCGRLPCSFVTLALLGSYSVQSELGDYDPEEY--GSDYVTEFRFAPNQTKELEDKVVELHKSYRGMTPAEAEMHFLENAKKLSMYGVDLHHAKDSEGVEIMLGVCASGLLIYRDRLRINRFAWPKVLKISYKRNNFYIKIRPGEFEQFESTIGFKLPNHRAAKRLWKVCVEHHTFFRLLMP--EAPPKKFLTLGSK-FRYSGRTQAQTRRASALIDRPAPYFERSSSKRYTM 440          
BLAST of Protein 4.1 vs. Ensembl Xenopus
Match: dcx (doublecortin [Source:Xenbase;Acc:XB-GENE-992092])

HSP 1 Score: 350.517 bits (898), Expect = 1.178e-102
Identity = 172/346 (49.71%), Postives = 244/346 (70.52%), Query Frame = 2
Query:  815 KSAKHLSSNKAHIILLDGMEVEFDVDQKMLGKYLFDEVCSYLDLIEKDFFGMTYVNSKLQTWFWLEMDKKISKQLSSADDWAFNFQVKFYPPEPVLLQEDITRYLLSLQVRQDVFTGKLPCSWITQALLGSFMVQSELGDFDELEHEEGIDYLREFEFVLNQSDQLLEKIAELHKKHIGMSPDKADVKYLETAKRLEQYGVDLHPARDNDDVEILIGVCYQGVLIYRDRIRIGRFAWPKVLRISYKKNYFYLKIRSDRYDDSVAIVGFKLFNHNLAKRLWKNAVEQHTFFRMKEPQNQKPTQRYMVSGSSTYGYTGKTLHQYRSMNIARNEPLK-FDRALTKRRTI 1849
            KSA+   + +A ++LLDG E   +V+++  G+ LFD+VC +L+L+EKD+FG+ Y +S+ Q   WL+  K+I KQ  +   W F+F VKFYPP+P  L EDITRY L LQ+R D+  G+LPCS++T ALLGS+ VQSELGD+D  E+  G DY+ EF F  NQ+ +L +K+ ELHK + GM+P +A++ +LE AK+L  YGVDLH A+D++ VEI++GVC  G+LIYRDR+RI RFAWPKVL+ISYK+N FY+KIR   ++   + +GFKL NH  AKRLWK  VE HTFFR+  P  + P ++++  GS  + Y+G+T  Q R  +   + P   F+R+ +KR T+
Sbjct:  102 KSARRPKNMQAKVMLLDGSEYSCEVEKRSKGQILFDKVCEHLNLLEKDYFGLVYRDSENQK-NWLDPAKEIKKQTRNGA-WHFSFNVKFYPPDPSQLSEDITRYYLCLQLRDDIVCGRLPCSFVTLALLGSYSVQSELGDYDPEEY--GSDYVTEFRFAPNQTKELEDKVVELHKSYRGMTPAEAEMHFLENAKKLSMYGVDLHHAKDSEGVEIMLGVCASGLLIYRDRLRINRFAWPKVLKISYKRNNFYIKIRPGEFEQFESTIGFKLPNHRAAKRLWKVCVEHHTFFRLLMP--EAPPKKFLTLGSK-FRYSGRTQAQTRRASALIDRPAPYFERSSSKRYTM 440          
BLAST of Protein 4.1 vs. Ensembl Mouse
Match: Epb41l3 (erythrocyte membrane protein band 4.1 like 3 [Source:MGI Symbol;Acc:MGI:103008])

HSP 1 Score: 356.681 bits (914), Expect = 4.747e-107
Identity = 174/346 (50.29%), Postives = 241/346 (69.65%), Query Frame = 2
Query:  815 KSAKHLSSNKAHIILLDGMEVEFDVDQKMLGKYLFDEVCSYLDLIEKDFFGMTYVNSKLQTWFWLEMDKKISKQLSSADDWAFNFQVKFYPPEPVLLQEDITRYLLSLQVRQDVFTGKLPCSWITQALLGSFMVQSELGDFDELEHEEGIDYLREFEFVLNQSDQLLEKIAELHKKHIGMSPDKADVKYLETAKRLEQYGVDLHPARDNDDVEILIGVCYQGVLIYRDRIRIGRFAWPKVLRISYKKNYFYLKIRSDRYDDSVAIVGFKLFNHNLAKRLWKNAVEQHTFFRMKEPQNQKPTQRYMVSGSSTYGYTGKTLHQYRSMNIARNEPLK-FDRALTKRRTI 1849
            K  K   S +  + LLDG E   DVD++  G+ LFD+VC +L+L+EKD+FG+TY +++ Q   WL+  K+I KQ+ S   W F+F VKFYPP+P  L EDITRY L LQ+R D+ +G+LPCS++T ALLGS+ VQSELGD+D    E G DY+ EF F  N + +L +K+ ELHK H GM+P +A++ +LE AK+L  YGVDLH A+D++ VEI++GVC  G+LIYRDR+RI RFAWPKVL+ISYK+N FY+KIR   ++   + +GFKL NH  AKRLWK  VE HTFFR+  P  + P ++++  GS  + Y+G+T  Q R  +   + P   F+R+ +KR T+
Sbjct:  110 KIVKRPKSMQCKVTLLDGSEYGCDVDKRSRGQVLFDKVCEHLNLLEKDYFGLTYRDAENQK-NWLDPAKEIKKQIRSGA-WHFSFNVKFYPPDPAQLSEDITRYYLCLQLRDDIVSGRLPCSFVTLALLGSYTVQSELGDYDP--DECGNDYISEFRFAPNHTKELEDKVIELHKSHRGMTPAEAEMHFLENAKKLSMYGVDLHHAKDSEGVEIMLGVCASGLLIYRDRLRINRFAWPKVLKISYKRNNFYIKIRPGEFEQFESTIGFKLPNHRAAKRLWKVCVEHHTFFRLLLP--EAPPKKFLTLGSK-FRYSGRTQAQTRRASALIDRPAPYFERSSSKRYTM 448          
BLAST of Protein 4.1 vs. Ensembl Mouse
Match: Epb41l3 (erythrocyte membrane protein band 4.1 like 3 [Source:MGI Symbol;Acc:MGI:103008])

HSP 1 Score: 356.295 bits (913), Expect = 8.309e-107
Identity = 174/346 (50.29%), Postives = 241/346 (69.65%), Query Frame = 2
Query:  815 KSAKHLSSNKAHIILLDGMEVEFDVDQKMLGKYLFDEVCSYLDLIEKDFFGMTYVNSKLQTWFWLEMDKKISKQLSSADDWAFNFQVKFYPPEPVLLQEDITRYLLSLQVRQDVFTGKLPCSWITQALLGSFMVQSELGDFDELEHEEGIDYLREFEFVLNQSDQLLEKIAELHKKHIGMSPDKADVKYLETAKRLEQYGVDLHPARDNDDVEILIGVCYQGVLIYRDRIRIGRFAWPKVLRISYKKNYFYLKIRSDRYDDSVAIVGFKLFNHNLAKRLWKNAVEQHTFFRMKEPQNQKPTQRYMVSGSSTYGYTGKTLHQYRSMNIARNEPLK-FDRALTKRRTI 1849
            K  K   S +  + LLDG E   DVD++  G+ LFD+VC +L+L+EKD+FG+TY +++ Q   WL+  K+I KQ+ S   W F+F VKFYPP+P  L EDITRY L LQ+R D+ +G+LPCS++T ALLGS+ VQSELGD+D    E G DY+ EF F  N + +L +K+ ELHK H GM+P +A++ +LE AK+L  YGVDLH A+D++ VEI++GVC  G+LIYRDR+RI RFAWPKVL+ISYK+N FY+KIR   ++   + +GFKL NH  AKRLWK  VE HTFFR+  P  + P ++++  GS  + Y+G+T  Q R  +   + P   F+R+ +KR T+
Sbjct:  106 KIVKRPKSMQCKVTLLDGSEYGCDVDKRSRGQVLFDKVCEHLNLLEKDYFGLTYRDAENQK-NWLDPAKEIKKQIRSGA-WHFSFNVKFYPPDPAQLSEDITRYYLCLQLRDDIVSGRLPCSFVTLALLGSYTVQSELGDYDP--DECGNDYISEFRFAPNHTKELEDKVIELHKSHRGMTPAEAEMHFLENAKKLSMYGVDLHHAKDSEGVEIMLGVCASGLLIYRDRLRINRFAWPKVLKISYKRNNFYIKIRPGEFEQFESTIGFKLPNHRAAKRLWKVCVEHHTFFRLLLP--EAPPKKFLTLGSK-FRYSGRTQAQTRRASALIDRPAPYFERSSSKRYTM 444          
BLAST of Protein 4.1 vs. Ensembl Mouse
Match: Epb41l3 (erythrocyte membrane protein band 4.1 like 3 [Source:MGI Symbol;Acc:MGI:103008])

HSP 1 Score: 356.681 bits (914), Expect = 2.200e-106
Identity = 174/346 (50.29%), Postives = 241/346 (69.65%), Query Frame = 2
Query:  815 KSAKHLSSNKAHIILLDGMEVEFDVDQKMLGKYLFDEVCSYLDLIEKDFFGMTYVNSKLQTWFWLEMDKKISKQLSSADDWAFNFQVKFYPPEPVLLQEDITRYLLSLQVRQDVFTGKLPCSWITQALLGSFMVQSELGDFDELEHEEGIDYLREFEFVLNQSDQLLEKIAELHKKHIGMSPDKADVKYLETAKRLEQYGVDLHPARDNDDVEILIGVCYQGVLIYRDRIRIGRFAWPKVLRISYKKNYFYLKIRSDRYDDSVAIVGFKLFNHNLAKRLWKNAVEQHTFFRMKEPQNQKPTQRYMVSGSSTYGYTGKTLHQYRSMNIARNEPLK-FDRALTKRRTI 1849
            K  K   S +  + LLDG E   DVD++  G+ LFD+VC +L+L+EKD+FG+TY +++ Q   WL+  K+I KQ+ S   W F+F VKFYPP+P  L EDITRY L LQ+R D+ +G+LPCS++T ALLGS+ VQSELGD+D    E G DY+ EF F  N + +L +K+ ELHK H GM+P +A++ +LE AK+L  YGVDLH A+D++ VEI++GVC  G+LIYRDR+RI RFAWPKVL+ISYK+N FY+KIR   ++   + +GFKL NH  AKRLWK  VE HTFFR+  P  + P ++++  GS  + Y+G+T  Q R  +   + P   F+R+ +KR T+
Sbjct:  110 KIVKRPKSMQCKVTLLDGSEYGCDVDKRSRGQVLFDKVCEHLNLLEKDYFGLTYRDAENQK-NWLDPAKEIKKQIRSGA-WHFSFNVKFYPPDPAQLSEDITRYYLCLQLRDDIVSGRLPCSFVTLALLGSYTVQSELGDYDP--DECGNDYISEFRFAPNHTKELEDKVIELHKSHRGMTPAEAEMHFLENAKKLSMYGVDLHHAKDSEGVEIMLGVCASGLLIYRDRLRINRFAWPKVLKISYKRNNFYIKIRPGEFEQFESTIGFKLPNHRAAKRLWKVCVEHHTFFRLLLP--EAPPKKFLTLGSK-FRYSGRTQAQTRRASALIDRPAPYFERSSSKRYTM 448          
BLAST of Protein 4.1 vs. Ensembl Mouse
Match: Epb41l3 (erythrocyte membrane protein band 4.1 like 3 [Source:MGI Symbol;Acc:MGI:103008])

HSP 1 Score: 357.066 bits (915), Expect = 3.452e-106
Identity = 174/346 (50.29%), Postives = 241/346 (69.65%), Query Frame = 2
Query:  815 KSAKHLSSNKAHIILLDGMEVEFDVDQKMLGKYLFDEVCSYLDLIEKDFFGMTYVNSKLQTWFWLEMDKKISKQLSSADDWAFNFQVKFYPPEPVLLQEDITRYLLSLQVRQDVFTGKLPCSWITQALLGSFMVQSELGDFDELEHEEGIDYLREFEFVLNQSDQLLEKIAELHKKHIGMSPDKADVKYLETAKRLEQYGVDLHPARDNDDVEILIGVCYQGVLIYRDRIRIGRFAWPKVLRISYKKNYFYLKIRSDRYDDSVAIVGFKLFNHNLAKRLWKNAVEQHTFFRMKEPQNQKPTQRYMVSGSSTYGYTGKTLHQYRSMNIARNEPLK-FDRALTKRRTI 1849
            K  K   S +  + LLDG E   DVD++  G+ LFD+VC +L+L+EKD+FG+TY +++ Q   WL+  K+I KQ+ S   W F+F VKFYPP+P  L EDITRY L LQ+R D+ +G+LPCS++T ALLGS+ VQSELGD+D    E G DY+ EF F  N + +L +K+ ELHK H GM+P +A++ +LE AK+L  YGVDLH A+D++ VEI++GVC  G+LIYRDR+RI RFAWPKVL+ISYK+N FY+KIR   ++   + +GFKL NH  AKRLWK  VE HTFFR+  P  + P ++++  GS  + Y+G+T  Q R  +   + P   F+R+ +KR T+
Sbjct:  110 KIVKRPKSMQCKVTLLDGSEYGCDVDKRSRGQVLFDKVCEHLNLLEKDYFGLTYRDAENQK-NWLDPAKEIKKQIRSGA-WHFSFNVKFYPPDPAQLSEDITRYYLCLQLRDDIVSGRLPCSFVTLALLGSYTVQSELGDYDP--DECGNDYISEFRFAPNHTKELEDKVIELHKSHRGMTPAEAEMHFLENAKKLSMYGVDLHHAKDSEGVEIMLGVCASGLLIYRDRLRINRFAWPKVLKISYKRNNFYIKIRPGEFEQFESTIGFKLPNHRAAKRLWKVCVEHHTFFRLLLP--EAPPKKFLTLGSK-FRYSGRTQAQTRRASALIDRPAPYFERSSSKRYTM 448          
BLAST of Protein 4.1 vs. Ensembl Mouse
Match: Epb41l3 (erythrocyte membrane protein band 4.1 like 3 [Source:MGI Symbol;Acc:MGI:103008])

HSP 1 Score: 357.066 bits (915), Expect = 4.782e-106
Identity = 174/346 (50.29%), Postives = 241/346 (69.65%), Query Frame = 2
Query:  815 KSAKHLSSNKAHIILLDGMEVEFDVDQKMLGKYLFDEVCSYLDLIEKDFFGMTYVNSKLQTWFWLEMDKKISKQLSSADDWAFNFQVKFYPPEPVLLQEDITRYLLSLQVRQDVFTGKLPCSWITQALLGSFMVQSELGDFDELEHEEGIDYLREFEFVLNQSDQLLEKIAELHKKHIGMSPDKADVKYLETAKRLEQYGVDLHPARDNDDVEILIGVCYQGVLIYRDRIRIGRFAWPKVLRISYKKNYFYLKIRSDRYDDSVAIVGFKLFNHNLAKRLWKNAVEQHTFFRMKEPQNQKPTQRYMVSGSSTYGYTGKTLHQYRSMNIARNEPLK-FDRALTKRRTI 1849
            K  K   S +  + LLDG E   DVD++  G+ LFD+VC +L+L+EKD+FG+TY +++ Q   WL+  K+I KQ+ S   W F+F VKFYPP+P  L EDITRY L LQ+R D+ +G+LPCS++T ALLGS+ VQSELGD+D    E G DY+ EF F  N + +L +K+ ELHK H GM+P +A++ +LE AK+L  YGVDLH A+D++ VEI++GVC  G+LIYRDR+RI RFAWPKVL+ISYK+N FY+KIR   ++   + +GFKL NH  AKRLWK  VE HTFFR+  P  + P ++++  GS  + Y+G+T  Q R  +   + P   F+R+ +KR T+
Sbjct:  110 KIVKRPKSMQCKVTLLDGSEYGCDVDKRSRGQVLFDKVCEHLNLLEKDYFGLTYRDAENQK-NWLDPAKEIKKQIRSGA-WHFSFNVKFYPPDPAQLSEDITRYYLCLQLRDDIVSGRLPCSFVTLALLGSYTVQSELGDYDP--DECGNDYISEFRFAPNHTKELEDKVIELHKSHRGMTPAEAEMHFLENAKKLSMYGVDLHHAKDSEGVEIMLGVCASGLLIYRDRLRINRFAWPKVLKISYKRNNFYIKIRPGEFEQFESTIGFKLPNHRAAKRLWKVCVEHHTFFRLLLP--EAPPKKFLTLGSK-FRYSGRTQAQTRRASALIDRPAPYFERSSSKRYTM 448          
BLAST of Protein 4.1 vs. UniProt/SwissProt
Match: sp|Q9WV92|E41L3_MOUSE (Band 4.1-like protein 3 OS=Mus musculus OX=10090 GN=Epb41l3 PE=1 SV=1)

HSP 1 Score: 357.066 bits (915), Expect = 3.345e-105
Identity = 174/346 (50.29%), Postives = 241/346 (69.65%), Query Frame = 2
Query:  815 KSAKHLSSNKAHIILLDGMEVEFDVDQKMLGKYLFDEVCSYLDLIEKDFFGMTYVNSKLQTWFWLEMDKKISKQLSSADDWAFNFQVKFYPPEPVLLQEDITRYLLSLQVRQDVFTGKLPCSWITQALLGSFMVQSELGDFDELEHEEGIDYLREFEFVLNQSDQLLEKIAELHKKHIGMSPDKADVKYLETAKRLEQYGVDLHPARDNDDVEILIGVCYQGVLIYRDRIRIGRFAWPKVLRISYKKNYFYLKIRSDRYDDSVAIVGFKLFNHNLAKRLWKNAVEQHTFFRMKEPQNQKPTQRYMVSGSSTYGYTGKTLHQYRSMNIARNEPLK-FDRALTKRRTI 1849
            K  K   S +  + LLDG E   DVD++  G+ LFD+VC +L+L+EKD+FG+TY +++ Q   WL+  K+I KQ+ S   W F+F VKFYPP+P  L EDITRY L LQ+R D+ +G+LPCS++T ALLGS+ VQSELGD+D    E G DY+ EF F  N + +L +K+ ELHK H GM+P +A++ +LE AK+L  YGVDLH A+D++ VEI++GVC  G+LIYRDR+RI RFAWPKVL+ISYK+N FY+KIR   ++   + +GFKL NH  AKRLWK  VE HTFFR+  P  + P ++++  GS  + Y+G+T  Q R  +   + P   F+R+ +KR T+
Sbjct:  110 KIVKRPKSMQCKVTLLDGSEYGCDVDKRSRGQVLFDKVCEHLNLLEKDYFGLTYRDAENQK-NWLDPAKEIKKQIRSGA-WHFSFNVKFYPPDPAQLSEDITRYYLCLQLRDDIVSGRLPCSFVTLALLGSYTVQSELGDYDP--DECGNDYISEFRFAPNHTKELEDKVIELHKSHRGMTPAEAEMHFLENAKKLSMYGVDLHHAKDSEGVEIMLGVCASGLLIYRDRLRINRFAWPKVLKISYKRNNFYIKIRPGEFEQFESTIGFKLPNHRAAKRLWKVCVEHHTFFRLLLP--EAPPKKFLTLGSK-FRYSGRTQAQTRRASALIDRPAPYFERSSSKRYTM 448          
BLAST of Protein 4.1 vs. UniProt/SwissProt
Match: sp|Q9Y2J2|E41L3_HUMAN (Band 4.1-like protein 3 OS=Homo sapiens OX=9606 GN=EPB41L3 PE=1 SV=2)

HSP 1 Score: 357.066 bits (915), Expect = 7.308e-104
Identity = 174/346 (50.29%), Postives = 242/346 (69.94%), Query Frame = 2
Query:  815 KSAKHLSSNKAHIILLDGMEVEFDVDQKMLGKYLFDEVCSYLDLIEKDFFGMTYVNSKLQTWFWLEMDKKISKQLSSADDWAFNFQVKFYPPEPVLLQEDITRYLLSLQVRQDVFTGKLPCSWITQALLGSFMVQSELGDFDELEHEEGIDYLREFEFVLNQSDQLLEKIAELHKKHIGMSPDKADVKYLETAKRLEQYGVDLHPARDNDDVEILIGVCYQGVLIYRDRIRIGRFAWPKVLRISYKKNYFYLKIRSDRYDDSVAIVGFKLFNHNLAKRLWKNAVEQHTFFRMKEPQNQKPTQRYMVSGSSTYGYTGKTLHQYRSMNIARNEPLK-FDRALTKRRTI 1849
            K  K   S +  +ILLDG E   DV+++  G+ LFD+VC +L+L+EKD+FG+TY +++ Q   WL+  K+I KQ+ S   W F+F VKFYPP+P  L EDITRY L LQ+R D+ +G+LPCS++T ALLGS+ VQSELGD+D    E G DY+ EF F  N + +L +K+ ELHK H GM+P +A++ +LE AK+L  YGVDLH A+D++ VEI++GVC  G+LIYRDR+RI RFAWPKVL+ISYK+N FY+KIR   ++   + +GFKL NH  AKRLWK  VE HTFFR+  P  + P ++++  GS  + Y+G+T  Q R  +   + P   F+R+ +KR T+
Sbjct:  102 KIVKKPKSMQCKVILLDGSEYTCDVEKRSRGQVLFDKVCEHLNLLEKDYFGLTYRDAENQK-NWLDPAKEIKKQVRSGA-WHFSFNVKFYPPDPAQLSEDITRYYLCLQLRDDIVSGRLPCSFVTLALLGSYTVQSELGDYDP--DECGSDYISEFRFAPNHTKELEDKVIELHKSHRGMTPAEAEMHFLENAKKLSMYGVDLHHAKDSEGVEIMLGVCASGLLIYRDRLRINRFAWPKVLKISYKRNNFYIKIRPGEFEQFESTIGFKLPNHRAAKRLWKVCVEHHTFFRLLLP--EAPPKKFLTLGSK-FRYSGRTQAQTRRASALIDRPAPYFERSSSKRYTM 440          
BLAST of Protein 4.1 vs. UniProt/SwissProt
Match: sp|Q9Z2H5|E41L1_MOUSE (Band 4.1-like protein 1 OS=Mus musculus OX=10090 GN=Epb41l1 PE=1 SV=2)

HSP 1 Score: 348.591 bits (893), Expect = 1.252e-102
Identity = 173/355 (48.73%), Postives = 241/355 (67.89%), Query Frame = 2
Query:  815 KSAKHLSSNKAHIILLDGMEVEFDVDQKMLGKYLFDEVCSYLDLIEKDFFGMTYVNSKLQTWFWLEMDKKISKQLSSADDWAFNFQVKFYPPEPVLLQEDITRYLLSLQVRQDVFTGKLPCSWITQALLGSFMVQSELGDFDELEHEEGIDYLREFEFVLNQSDQLLEKIAELHKKHIGMSPDKADVKYLETAKRLEQYGVDLHPARDNDDVEILIGVCYQGVLIYRDRIRIGRFAWPKVLRISYKKNYFYLKIRSDRYDDSVAIVGFKLFNHNLAKRLWKNAVEQHTFFRMKEPQNQKPTQRYMVSGSSTYGYTGKTLHQYR--SMNIARNEPLKFDRALTKRRTIGSMPAGLE 1873
            K AK   S    + LLD  E E +V++   G+ LFD VC +L+L+EKD+FG+T+ ++  Q   WL+  K+I KQ+ S+  W F F VKFYPP+P  L EDITRY L LQ+R D+ TG+LPCS++T ALLGS+ VQ+ELGD+D  EH    +Y+ E  F  NQ+ +L E+I ELHK + GM+P +A++ +LE AK+L  YGVDLH A+D++ ++I++GVC  G+LIYRDR+RI RFAWPK+L+ISYK++ FY+KIR   Y+   + +GFKL NH  AKRLWK  +E HTFFR+  P  + P + ++V GS  + Y+G+T  Q R  S  I R  P  F+R+ +KR T+     G E
Sbjct:   89 KIAKKFKSAICRVTLLDASEYECEVEKHGRGQVLFDLVCEHLNLLEKDYFGLTFCDADSQKN-WLDPSKEIKKQIRSSP-WNFAFTVKFYPPDPAQLTEDITRYYLCLQLRADIITGRLPCSFVTHALLGSYAVQAELGDYDAEEHVG--NYVSELRFAPNQTRELEERIMELHKTYRGMTPGEAEIHFLENAKKLSMYGVDLHHAKDSEGIDIMLGVCANGLLIYRDRLRINRFAWPKILKISYKRSNFYIKIRPGEYEQFESTIGFKLPNHRSAKRLWKVCIEHHTFFRLVSP--EPPPKGFLVMGSK-FRYSGRTQAQTRQASALIDRPAPF-FERSSSKRYTMSRSLDGAE 435          
BLAST of Protein 4.1 vs. UniProt/SwissProt
Match: sp|Q9WTP0|E41L1_RAT (Band 4.1-like protein 1 OS=Rattus norvegicus OX=10116 GN=Epb41l1 PE=1 SV=1)

HSP 1 Score: 348.206 bits (892), Expect = 1.782e-102
Identity = 173/355 (48.73%), Postives = 240/355 (67.61%), Query Frame = 2
Query:  815 KSAKHLSSNKAHIILLDGMEVEFDVDQKMLGKYLFDEVCSYLDLIEKDFFGMTYVNSKLQTWFWLEMDKKISKQLSSADDWAFNFQVKFYPPEPVLLQEDITRYLLSLQVRQDVFTGKLPCSWITQALLGSFMVQSELGDFDELEHEEGIDYLREFEFVLNQSDQLLEKIAELHKKHIGMSPDKADVKYLETAKRLEQYGVDLHPARDNDDVEILIGVCYQGVLIYRDRIRIGRFAWPKVLRISYKKNYFYLKIRSDRYDDSVAIVGFKLFNHNLAKRLWKNAVEQHTFFRMKEPQNQKPTQRYMVSGSSTYGYTGKTLHQYR--SMNIARNEPLKFDRALTKRRTIGSMPAGLE 1873
            K AK   S    + LLD  E E +V++   G+ LFD VC +L+L+EKD+FG+T+ ++  Q   WL+  K+I KQ+ S+  W F F VKFYPP+P  L EDITRY L LQ+R D+ TG+LPCS++T ALLGS+ VQ+ELGD D  EH    +Y+ E  F  NQ+ +L E+I ELHK + GM+P +A++ +LE AK+L  YGVDLH A+D++ ++I++GVC  G+LIYRDR+RI RFAWPK+L+ISYK++ FY+KIR   Y+   + +GFKL NH  AKRLWK  +E HTFFR+  P  + P + ++V GS  + Y+G+T  Q R  S  I R  P  F+R+ +KR T+     G E
Sbjct:   89 KIAKKFKSATCRVTLLDASEYECEVEKHGRGQVLFDLVCEHLNLLEKDYFGLTFCDADSQKN-WLDPSKEIKKQIRSSP-WNFAFTVKFYPPDPAQLTEDITRYYLCLQLRADIITGRLPCSFVTHALLGSYAVQAELGDHDTEEHVG--NYVSELRFAPNQTRELEERIMELHKTYRGMTPGEAEIHFLENAKKLSMYGVDLHHAKDSEGIDIMLGVCANGLLIYRDRLRINRFAWPKILKISYKRSNFYIKIRPGEYEQFESTIGFKLPNHRSAKRLWKVCIEHHTFFRLVSP--EPPPKGFLVMGSK-FRYSGRTQAQTRQASALIDRPAPF-FERSSSKRYTMSRSLDGAE 435          
BLAST of Protein 4.1 vs. UniProt/SwissProt
Match: sp|Q9H4G0|E41L1_HUMAN (Band 4.1-like protein 1 OS=Homo sapiens OX=9606 GN=EPB41L1 PE=1 SV=2)

HSP 1 Score: 346.665 bits (888), Expect = 7.468e-102
Identity = 173/355 (48.73%), Postives = 241/355 (67.89%), Query Frame = 2
Query:  815 KSAKHLSSNKAHIILLDGMEVEFDVDQKMLGKYLFDEVCSYLDLIEKDFFGMTYVNSKLQTWFWLEMDKKISKQLSSADDWAFNFQVKFYPPEPVLLQEDITRYLLSLQVRQDVFTGKLPCSWITQALLGSFMVQSELGDFDELEHEEGIDYLREFEFVLNQSDQLLEKIAELHKKHIGMSPDKADVKYLETAKRLEQYGVDLHPARDNDDVEILIGVCYQGVLIYRDRIRIGRFAWPKVLRISYKKNYFYLKIRSDRYDDSVAIVGFKLFNHNLAKRLWKNAVEQHTFFRMKEPQNQKPTQRYMVSGSSTYGYTGKTLHQYR--SMNIARNEPLKFDRALTKRRTIGSMPAGLE 1873
            K AK   S    + LLD  E E +V++   G+ LFD VC +L+L+EKD+FG+T+ ++  Q   WL+  K+I KQ+ S+  W F F VKFYPP+P  L EDITRY L LQ+R D+ TG+LPCS++T ALLGS+ VQ+ELGD+D  EH    +Y+ E  F  NQ+ +L E+I ELHK + GM+P +A++ +LE AK+L  YGVDLH A+D++ ++I++GVC  G+LIYRDR+RI RFAWPK+L+ISYK++ FY+KIR   Y+   + +GFKL NH  AKRLWK  +E HTFFR+  P  + P + ++V GS  + Y+G+T  Q R  S  I R  P  F+R+ +KR T+     G E
Sbjct:   89 KIAKKYKSAICRVTLLDASEYECEVEKHGRGQVLFDLVCEHLNLLEKDYFGLTFCDADSQKN-WLDPSKEIKKQIRSSP-WNFAFTVKFYPPDPAQLTEDITRYYLCLQLRADIITGRLPCSFVTHALLGSYAVQAELGDYDAEEHVG--NYVSELRFAPNQTRELEERIMELHKTYRGMTPGEAEIHFLENAKKLSMYGVDLHHAKDSEGIDIMLGVCANGLLIYRDRLRINRFAWPKILKISYKRSNFYIKIRPGEYEQFESTIGFKLPNHRSAKRLWKVCIEHHTFFRLVSP--EPPPKGFLVMGSK-FRYSGRTQAQTRQASALIDRPAPF-FERSSSKRYTMSRSLDGAE 435          
BLAST of Protein 4.1 vs. TrEMBL
Match: A0A4S2M115 (FERM domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_004743 PE=4 SV=1)

HSP 1 Score: 501.13 bits (1289), Expect = 3.937e-160
Identity = 233/380 (61.32%), Postives = 294/380 (77.37%), Query Frame = 2
Query:  845 AHIILLDGMEVEFDVDQKMLGKYLFDEVCSYLDLIEKDFFGMTYVNSKLQTWFWLEMDKKISKQLSSADDWAFNFQVKFYPPEPVLLQEDITRYLLSLQVRQDVFTGKLPCSWITQALLGSFMVQSELGDFDELEHEEGIDYLREFEFVLNQSDQLLEKIAELHKKHIGMSPDKADVKYLETAKRLEQYGVDLHPARDNDDVEILIGVCYQGVLIYRDRIRIGRFAWPKVLRISYKKNYFYLKIRSDRYDDSVAIVGFKLFNHNLAKRLWKNAVEQHTFFRMKEPQN-QKPTQRYMVSGSSTYGYTGKTLHQYRSMNIARNEPLKFDRALTKRRTIGSMPAGLEKAGMLYSSMHSLNRSHPRDMTLGKTKSIEYLSAKRP 1981
            A +I+LDG E+ F +D+   G+ LF  VC + D++E D+FG+TYV++KL+TWFWL+ +KK++KQL + + W F+FQVKFY PEP LLQEDITRY L+LQVRQD++TGKLPCSW+TQALLGSFMVQ+ELGD+DE EH    DYL+EFEFV + + QLL+KIAELHK H+GM P++AD+KYLETAKRLE YGVDLHP RD ++VEI +GV + G++IYRDR+RIGRFAWPKVLRISYKKN FYLKIR D  +    I+GF+L NH++A RLWK AVE H FFR+KE ++   P+      GS    YTG T  QYR+MNI R  P  FDR+L KRRT  SMP GL KAG    SMH+LNR+HPRDMT+G+T+  + L + +P
Sbjct:   10 ARVIMLDGEEISFQLDRNDTGQSLFSRVCQHADIVETDYFGLTYVSNKLRTWFWLDPEKKVNKQLRNGEQWLFSFQVKFYAPEPTLLQEDITRYQLALQVRQDIYTGKLPCSWVTQALLGSFMVQAELGDYDEREHGGSTDYLKEFEFVPSPTPQLLQKIAELHKTHVGMKPNQADIKYLETAKRLELYGVDLHPVRDTENVEIYLGVGFHGIVIYRDRLRIGRFAWPKVLRISYKKNNFYLKIRPDNAEPVETIIGFRLLNHHMANRLWKAAVEHHAFFRLKEARSPHGPSAPLSSKGS----YTGHTFFQYRTMNINRPHP-HFDRSLMKRRT-ASMPMGLNKAG----SMHTLNRAHPRDMTVGRTQDTDSLGSVQP 379          
BLAST of Protein 4.1 vs. TrEMBL
Match: A0A504YNY9 (Neuronal acetylcholine receptor subunit alpha-2 OS=Fasciola gigantica OX=46835 GN=FGIG_07739 PE=4 SV=1)

HSP 1 Score: 505.753 bits (1301), Expect = 2.373e-158
Identity = 239/402 (59.45%), Postives = 309/402 (76.87%), Query Frame = 2
Query:  782 QPATLERKKISKSAKHLSSNKAHIILLDGMEVEFDVDQKMLGKYLFDEVCSYLDLIEKDFFGMTYVNSKLQTWFWLEMDKKISKQLSSADDWAFNFQVKFYPPEPVLLQEDITRYLLSLQVRQDVFTGKLPCSWITQALLGSFMVQSELGDFDELEHEEGIDYLREFEFVLNQSDQLLEKIAELHKKHIGMSPDKADVKYLETAKRLEQYGVDLHPARDNDDVEILIGVCYQGVLIYRDRIRIGRFAWPKVLRISYKKNYFYLKIRSDRYDDSVAIVGFKLFNHNLAKRLWKNAVEQHTFFRMKEPQNQKPTQRYMVSGSSTYGYTGKTLHQYRSMNIARNEPLKFDRALTKRRTIGSMPAGLEKAGMLYSSMHSLNRSHPRDMTLGKTKSIEYLSAKRPGS 1987
            +P +L+R +   +    S N A +I+LDG EV + +D+  LG  LF++VC  LDL+E D+FG+TYV++KL+TWFWL+MDKKISKQL + + W F+FQV+FYPPEP LLQEDITRYLL+LQVRQD++TGKLPCSW+TQALLGSFMVQ+ELGD++E +     DYL EFEF+ + + QLL+KIAELHK HIGM P++AD+KYLETAKRLE YGVDLHP RD ++V+I +GV + G++IYRDR+RIGRFAWPKVLRIS+KKN FYLKIR D  +   A++GF+L NH LA RLWK AVE H FFR+KE +  K     +   + T+ YTG+T  QYR+MNI+R  P +F+R+L KRRT  SMP GL K G    SMH+L+R+HPRDMT+G+T+  +    +R GS
Sbjct:  283 KPKSLQRPEPQTTDSSGSLN-ARVIMLDGEEVSYPLDKNDLGLALFNKVCETLDLLETDYFGLTYVSNKLRTWFWLDMDKKISKQLRNDEQWIFSFQVRFYPPEPTLLQEDITRYLLTLQVRQDIYTGKLPCSWVTQALLGSFMVQAELGDYEERQFGGSTDYLNEFEFIPSPTPQLLQKIAELHKTHIGMKPNQADIKYLETAKRLELYGVDLHPVRDMENVDIYLGVGFHGIVIYRDRLRIGRFAWPKVLRISFKKNNFYLKIRPDNTEPVEAVIGFRLLNHYLANRLWKAAVEHHAFFRLKEARLPKGPSTPL---NPTHTYTGRTFFQYRTMNISRPHP-QFNRSLMKRRT-SSMPTGLNKTG----SMHTLSRAHPRDMTVGRTQETDGFGKRRSGS 674          
BLAST of Protein 4.1 vs. TrEMBL
Match: A0A4E0RAY6 (Septate junction protein OS=Fasciola hepatica OX=6192 GN=D915_005391 PE=4 SV=1)

HSP 1 Score: 504.212 bits (1297), Expect = 9.432e-158
Identity = 239/404 (59.16%), Postives = 310/404 (76.73%), Query Frame = 2
Query:  782 QPATLERK--KISKSAKHLSSNKAHIILLDGMEVEFDVDQKMLGKYLFDEVCSYLDLIEKDFFGMTYVNSKLQTWFWLEMDKKISKQLSSADDWAFNFQVKFYPPEPVLLQEDITRYLLSLQVRQDVFTGKLPCSWITQALLGSFMVQSELGDFDELEHEEGIDYLREFEFVLNQSDQLLEKIAELHKKHIGMSPDKADVKYLETAKRLEQYGVDLHPARDNDDVEILIGVCYQGVLIYRDRIRIGRFAWPKVLRISYKKNYFYLKIRSDRYDDSVAIVGFKLFNHNLAKRLWKNAVEQHTFFRMKEPQNQKPTQRYMVSGSSTYGYTGKTLHQYRSMNIARNEPLKFDRALTKRRTIGSMPAGLEKAGMLYSSMHSLNRSHPRDMTLGKTKSIEYLSAKRPGS 1987
            +P +L+R   + + S+  LS   A +I+LDG E  + +D+  LG  LF++VC  LDL+E D+FG+TYV++KL+TWFWL+MDKKISKQL + + W F+FQV+FYPPEP LLQEDITRYLL+LQVRQD++TGKLPCSW+TQALLGSFMVQ+ELGD++E +     DYL EFEF+ + + QLL+KIAELHK HIGM P++AD+KYLETAKRLE YGVDLHP RD ++V+I +GV + G++IYRDR+RIGRFAWPKVLRIS+KKN FYLKIR D  +   A++GF+L NH LA RLWK AVE H FFR+KE +  K     +   + T+ YTG+T  QYR+MNI+R  P +F+R+L KRRT  SMP GL K G    SMH+L+R+HPRDMT+G+T+  +    +R GS
Sbjct:  283 KPKSLQRPEPQTTDSSGSLS---ARVIMLDGEEASYPLDKNDLGLALFNKVCETLDLLETDYFGLTYVSNKLRTWFWLDMDKKISKQLRNDEQWIFSFQVRFYPPEPTLLQEDITRYLLTLQVRQDIYTGKLPCSWVTQALLGSFMVQAELGDYEERQFGGSTDYLNEFEFIPSPTPQLLQKIAELHKTHIGMKPNQADIKYLETAKRLELYGVDLHPVRDMENVDIYLGVGFHGIVIYRDRLRIGRFAWPKVLRISFKKNNFYLKIRPDNTEPVEAVIGFRLLNHYLANRLWKAAVEHHAFFRLKEARLPKGPSTPL---NPTHTYTGRTFFQYRTMNISRPHP-QFNRSLMKRRT-SSMPTGLNKTG----SMHTLSRAHPRDMTVGRTQETDGFGKRRSGS 674          
BLAST of Protein 4.1 vs. TrEMBL
Match: A0A419PEF4 (Band 4.1-like protein 2 OS=Clonorchis sinensis OX=79923 GN=EPB41L2 PE=4 SV=1)

HSP 1 Score: 503.442 bits (1295), Expect = 4.129e-157
Identity = 234/380 (61.58%), Postives = 294/380 (77.37%), Query Frame = 2
Query:  845 AHIILLDGMEVEFDVDQKMLGKYLFDEVCSYLDLIEKDFFGMTYVNSKLQTWFWLEMDKKISKQLSSADDWAFNFQVKFYPPEPVLLQEDITRYLLSLQVRQDVFTGKLPCSWITQALLGSFMVQSELGDFDELEHEEGIDYLREFEFVLNQSDQLLEKIAELHKKHIGMSPDKADVKYLETAKRLEQYGVDLHPARDNDDVEILIGVCYQGVLIYRDRIRIGRFAWPKVLRISYKKNYFYLKIRSDRYDDSVAIVGFKLFNHNLAKRLWKNAVEQHTFFRMKEPQN-QKPTQRYMVSGSSTYGYTGKTLHQYRSMNIARNEPLKFDRALTKRRTIGSMPAGLEKAGMLYSSMHSLNRSHPRDMTLGKTKSIEYLSAKRP 1981
            A +I+LDG E+ F +D+   G+ LF  VC + D++E D+FG+TYV++KL+TWFWL+ +KKI+KQL + + W F+FQVKFY PEP LLQEDITRY L+LQVRQD++TGKLPCSW+TQALLGSFMVQ+ELGD+DE EH    DYL+EFEFV + + QLL+KIAELHK H+GM P++AD+KYLETAKRLE YGVDLHP RD ++VEI +GV + G++IYRDR+RIGRFAWPKVLRISYKKN FYLKIR D  +    I+GF+L NH++A RLWK AVE H FFR+KE ++   P+      GS    YTG T  QYR+MNI R  P  FDR+L KRRT  SMP GL KAG    SMH+LNR+HPRDMT+G+T+  + L + +P
Sbjct:  279 ARVIMLDGEEISFQLDRNDTGQSLFSRVCQHADIVETDYFGLTYVSNKLRTWFWLDPEKKINKQLRNGEQWLFSFQVKFYAPEPTLLQEDITRYQLALQVRQDIYTGKLPCSWVTQALLGSFMVQAELGDYDEREHGGSTDYLKEFEFVPSPTPQLLQKIAELHKTHVGMKPNQADIKYLETAKRLELYGVDLHPVRDTENVEIYLGVGFHGIVIYRDRLRIGRFAWPKVLRISYKKNNFYLKIRPDNAEPVETIIGFRLLNHHMANRLWKAAVEHHAFFRLKEARSPHGPSAPLSSKGS----YTGHTFFQYRTMNINRPHP-HFDRSLMKRRT-ASMPMGLNKAG----SMHTLNRAHPRDMTVGRTQDTDSLGSVQP 648          
BLAST of Protein 4.1 vs. TrEMBL
Match: A0A068WP30 (Protein 4.1 OS=Echinococcus granulosus OX=6210 GN=EgrG_000468600.2 PE=4 SV=1)

HSP 1 Score: 483.411 bits (1243), Expect = 2.098e-152
Identity = 236/422 (55.92%), Postives = 295/422 (69.91%), Query Frame = 2
Query:  773 YDSQPATLERKKISKSAKHLSSNK------------------AHIILLDGMEVEFDVDQKMLGKYLFDEVCSYLDLIEKDFFGMTYVNSKLQTWFWLEMDKKISKQLSSADDWAFNFQVKFYPPEPVLLQEDITRYLLSLQVRQDVFTGKLPCSWITQALLGSFMVQSELGDFDELEHEEGIDYLREFEFVLNQSDQLLEKIAELHKKHIGMSPDKADVKYLETAKRLEQYGVDLHPARDNDDVEILIGVCYQGVLIYRDRIRIGRFAWPKVLRISYKKNYFYLKIRSDRYDDSVAIVGFKLFNHNLAKRLWKNAVEQHTFFRMKEPQNQKPTQRYMVSGSSTYGYTGKTLHQYRSMNIARNEPL---KFDRAL--TKRRTIGSMPAGLEKAGMLYSSMHSLNRSHPRDMTLGKTKSIEYLS 1969
            YD   A+  RKKI K+A    S K                  A I+LLDG EV   + ++ LG  L + +C   D+IE D+FG+TY + KL TWFWL++DKKI KQ+++  DW F FQVKFYPPEP +LQ++ TRY L LQVRQDV+TGKLPCSW+TQALLGSF+ QSELGD+D      GIDYLR+ EFV + +DQLL+KI ELHK H GM P +AD+KYLETAKRL+ YG+DLHPARD ++VEI IGV Y G+++YRDR+RIGRFAWPKVLRISYKKNYFYLKIR D  +   A+VGF + N  LAKRLWK AVE HTFFR+KEP+  K      + GSS + Y+GKT  QYR+  I   + +     D  L  +  RT  S+P  L +AG+ Y+S+HSLNR+HPRDMT+GK +S +YL 
Sbjct:   93 YDKFLASFRRKKIQKAASAPVSVKKVASVSEKPPKPISESVTARILLLDGEEVSMRLSKRALGLELLERICDGQDIIETDYFGITYTDKKLGTWFWLDVDKKIIKQVTNVADWQFYFQVKFYPPEPTMLQDETTRYQLVLQVRQDVYTGKLPCSWVTQALLGSFLAQSELGDYDSTAQGPGIDYLRQLEFVRSPTDQLLQKILELHKTHKGMRPGQADIKYLETAKRLDLYGLDLHPARDMENVEIYIGVGYSGIVVYRDRVRIGRFAWPKVLRISYKKNYFYLKIRPDYTEPEEAVVGFLMLNPQLAKRLWKTAVEHHTFFRLKEPRPPKRGPIGFLGGSSRFQYSGKTFFQYRTTQIDHPKAMADDALDEGLRPSHHRT-ASVPVALNRAGIRYNSVHSLNRTHPRDMTIGKAQSSDYLG 513          
BLAST of Protein 4.1 vs. Ensembl Cavefish
Match: ENSAMXT00000039790.1 (pep primary_assembly:Astyanax_mexicanus-2.0:22:7632957:7740250:1 gene:ENSAMXG00000003001.2 transcript:ENSAMXT00000039790.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 338.191 bits (866), Expect = 2.317e-101
Identity = 157/334 (47.01%), Postives = 234/334 (70.06%), Query Frame = 2
Query:  851 IILLDGMEVEFDVDQKMLGKYLFDEVCSYLDLIEKDFFGMTYVNSKLQTWFWLEMDKKISKQLSSADDWAFNFQVKFYPPEPVLLQEDITRYLLSLQVRQDVFTGKLPCSWITQALLGSFMVQSELGDFDELEHEEGIDYLREFEFVLNQSDQLLEKIAELHKKHIGMSPDKADVKYLETAKRLEQYGVDLHPARDNDDVEILIGVCYQGVLIYRDRIRIGRFAWPKVLRISYKKNYFYLKIRSDRYDDSVAIVGFKLFNHNLAKRLWKNAVEQHTFFRMKEPQNQKPTQRYMVSGSSTYGYTGKTLHQYRSMNIARNEPL-KFDRALTKRRTI 1849
            + L+D  + E ++++   G+ L D VC +L+L+EKD+FG+T+ +S  Q   WL+  K+I KQ+ ++  W F F VKFYPP+P  L EDITRY L LQ+R D+ +G+LPCS++T ALLGS+ VQ+ELGD+D+ EH  G DY+ +  F  NQ+ +L E++ ELH+ + GM+P +A++ +LE AK+L  YGVDLH A+D++ ++I++GVC  G+LIYRDR+RI RFAWPK+L+ISYK++ FY+KIR   Y+   + +GFKL NH  AKRLWK  +E HTFFR+  P  + P + ++V GS  + Y+G+T  Q R  +   + P   F+R+ +KR  +
Sbjct:   80 VTLMDSSDYEANIEKHCKGQALVDLVCEHLNLLEKDYFGLTFRDSDTQK-NWLDPSKEIKKQMRTSP-WHFAFAVKFYPPDPSQLMEDITRYYLCLQLRDDMLSGRLPCSFVTHALLGSYTVQAELGDYDQDEH--GSDYISDLRFAPNQTRELEERVMELHRTYRGMTPAEAEMNFLENAKKLSMYGVDLHHAKDSEGIDIMLGVCANGLLIYRDRLRINRFAWPKILKISYKRSNFYIKIRPGEYEQFESTIGFKLPNHRAAKRLWKVCIEHHTFFRLVSP--EPPPKGFLVMGSK-FRYSGRTQAQTRQASALIDRPAPHFERSTSKRHLL 406          
BLAST of Protein 4.1 vs. Ensembl Cavefish
Match: ENSAMXT00000046054.1 (pep primary_assembly:Astyanax_mexicanus-2.0:22:7632974:7740250:1 gene:ENSAMXG00000003001.2 transcript:ENSAMXT00000046054.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 338.961 bits (868), Expect = 2.878e-101
Identity = 157/334 (47.01%), Postives = 234/334 (70.06%), Query Frame = 2
Query:  851 IILLDGMEVEFDVDQKMLGKYLFDEVCSYLDLIEKDFFGMTYVNSKLQTWFWLEMDKKISKQLSSADDWAFNFQVKFYPPEPVLLQEDITRYLLSLQVRQDVFTGKLPCSWITQALLGSFMVQSELGDFDELEHEEGIDYLREFEFVLNQSDQLLEKIAELHKKHIGMSPDKADVKYLETAKRLEQYGVDLHPARDNDDVEILIGVCYQGVLIYRDRIRIGRFAWPKVLRISYKKNYFYLKIRSDRYDDSVAIVGFKLFNHNLAKRLWKNAVEQHTFFRMKEPQNQKPTQRYMVSGSSTYGYTGKTLHQYRSMNIARNEPL-KFDRALTKRRTI 1849
            + L+D  + E ++++   G+ L D VC +L+L+EKD+FG+T+ +S  Q   WL+  K+I KQ+ ++  W F F VKFYPP+P  L EDITRY L LQ+R D+ +G+LPCS++T ALLGS+ VQ+ELGD+D+ EH  G DY+ +  F  NQ+ +L E++ ELH+ + GM+P +A++ +LE AK+L  YGVDLH A+D++ ++I++GVC  G+LIYRDR+RI RFAWPK+L+ISYK++ FY+KIR   Y+   + +GFKL NH  AKRLWK  +E HTFFR+  P  + P + ++V GS  + Y+G+T  Q R  +   + P   F+R+ +KR  +
Sbjct:   80 VTLMDSSDYEANIEKHCKGQALVDLVCEHLNLLEKDYFGLTFRDSDTQK-NWLDPSKEIKKQMRTSP-WHFAFAVKFYPPDPSQLMEDITRYYLCLQLRDDMLSGRLPCSFVTHALLGSYTVQAELGDYDQDEH--GSDYISDLRFAPNQTRELEERVMELHRTYRGMTPAEAEMNFLENAKKLSMYGVDLHHAKDSEGIDIMLGVCANGLLIYRDRLRINRFAWPKILKISYKRSNFYIKIRPGEYEQFESTIGFKLPNHRAAKRLWKVCIEHHTFFRLVSP--EPPPKGFLVMGSK-FRYSGRTQAQTRQASALIDRPAPHFERSTSKRHLL 406          
BLAST of Protein 4.1 vs. Ensembl Cavefish
Match: si:dkey-178k16.1 (band 4.1-like protein 1 [Source:NCBI gene;Acc:103040989])

HSP 1 Score: 342.043 bits (876), Expect = 3.842e-101
Identity = 173/391 (44.25%), Postives = 259/391 (66.24%), Query Frame = 2
Query:  815 KSAKHLSSNKAHIILLDGMEVEFDVDQKMLGKYLFDEVCSYLDLIEKDFFGMTYVNSKLQTWFWLEMDKKISKQLSSADDWAFNFQVKFYPPEPVLLQEDITRYLLSLQVRQDVFTGKLPCSWITQALLGSFMVQSELGDFDELEHEEGIDYLREFEFVLNQSDQLLEKIAELHKKHIGMSPDKADVKYLETAKRLEQYGVDLHPARDNDDVEILIGVCYQGVLIYRDRIRIGRFAWPKVLRISYKKNYFYLKIR----SDRYDDSVAIVGFKLFNHNLAKRLWKNAVEQHTFFRMKEPQNQKPTQRYMVSGSSTYGYTGKTLHQYRSMNIARNEPL-KFDRALTKRRTIGSMPAGLEKAGMLYSSMHSLNRSHPRDMTLGKTKSIEYLSA 1972
            KS+K   +    + LLDG + E  V++   G+ L D VC +L+L+EKD+FG+ + ++  Q   WL+  K+I KQ+     W F+F VKFYPP+P  L EDITRY L LQ+R+D+ +G+LPCS++T ALLGS+ VQ+ELGD+D  EH  G DY+ EF F  +Q+ +L E++ ELH+ + GMSP +A+V +LE AK+L  YGVDLH A+D++ ++I++GVC  G+LIYRDR+RI RFAWPK+L+ISYK++ FY+KIR      +Y+   + +GFKL NH  +KRLWK  +E HTFFR+  P  + P + ++V GS  + Y+G+T  Q R  +   + P  +F+R++++R  +      L+ A  L  +M  L++  P +     T S+EY+ A
Sbjct:   53 KSSKRPKTVPVKVSLLDGSDYEVGVEKACKGQTLLDMVCEHLNLLEKDYFGLLFYDTDSQK-NWLDPSKEIKKQIR-VGSWQFSFSVKFYPPDPSQLIEDITRYYLCLQLREDMLSGRLPCSFVTHALLGSYAVQAELGDYDPEEH--GPDYVSEFRFAPSQTRELEERVMELHRTYRGMSPAEAEVNFLENAKKLSMYGVDLHHAKDSEGIDIMLGVCASGLLIYRDRLRINRFAWPKILKISYKRSNFYIKIRPGEVEKKYEQFESTIGFKLPNHRASKRLWKVCIEHHTFFRLVSP--EPPPKGFLVIGSK-FRYSGRTQAQTRQASALIDRPAPQFERSISRRYMLSR---SLDGASALGDTMDRLSQHTPSE----PTPSMEYMEA 429          
BLAST of Protein 4.1 vs. Ensembl Cavefish
Match: si:dkey-178k16.1 (band 4.1-like protein 1 [Source:NCBI gene;Acc:103040989])

HSP 1 Score: 341.273 bits (874), Expect = 5.827e-101
Identity = 173/391 (44.25%), Postives = 259/391 (66.24%), Query Frame = 2
Query:  815 KSAKHLSSNKAHIILLDGMEVEFDVDQKMLGKYLFDEVCSYLDLIEKDFFGMTYVNSKLQTWFWLEMDKKISKQLSSADDWAFNFQVKFYPPEPVLLQEDITRYLLSLQVRQDVFTGKLPCSWITQALLGSFMVQSELGDFDELEHEEGIDYLREFEFVLNQSDQLLEKIAELHKKHIGMSPDKADVKYLETAKRLEQYGVDLHPARDNDDVEILIGVCYQGVLIYRDRIRIGRFAWPKVLRISYKKNYFYLKIR----SDRYDDSVAIVGFKLFNHNLAKRLWKNAVEQHTFFRMKEPQNQKPTQRYMVSGSSTYGYTGKTLHQYRSMNIARNEPL-KFDRALTKRRTIGSMPAGLEKAGMLYSSMHSLNRSHPRDMTLGKTKSIEYLSA 1972
            KS+K   +    + LLDG + E  V++   G+ L D VC +L+L+EKD+FG+ + ++  Q   WL+  K+I KQ+     W F+F VKFYPP+P  L EDITRY L LQ+R+D+ +G+LPCS++T ALLGS+ VQ+ELGD+D  EH  G DY+ EF F  +Q+ +L E++ ELH+ + GMSP +A+V +LE AK+L  YGVDLH A+D++ ++I++GVC  G+LIYRDR+RI RFAWPK+L+ISYK++ FY+KIR      +Y+   + +GFKL NH  +KRLWK  +E HTFFR+  P  + P + ++V GS  + Y+G+T  Q R  +   + P  +F+R++++R  +      L+ A  L  +M  L++  P +     T S+EY+ A
Sbjct:   53 KSSKRPKTVPVKVSLLDGSDYEVGVEKACKGQTLLDMVCEHLNLLEKDYFGLLFYDTDSQK-NWLDPSKEIKKQIR-VGSWQFSFSVKFYPPDPSQLIEDITRYYLCLQLREDMLSGRLPCSFVTHALLGSYAVQAELGDYDPEEH--GPDYVSEFRFAPSQTRELEERVMELHRTYRGMSPAEAEVNFLENAKKLSMYGVDLHHAKDSEGIDIMLGVCASGLLIYRDRLRINRFAWPKILKISYKRSNFYIKIRPGEVEKKYEQFESTIGFKLPNHRASKRLWKVCIEHHTFFRLVSP--EPPPKGFLVIGSK-FRYSGRTQAQTRQASALIDRPAPQFERSISRRYMLSR---SLDGASALGDTMDRLSQHTPSE----PTPSMEYMEA 429          
BLAST of Protein 4.1 vs. Ensembl Cavefish
Match: ENSAMXT00000003084.2 (pep primary_assembly:Astyanax_mexicanus-2.0:22:7632974:7740250:1 gene:ENSAMXG00000003001.2 transcript:ENSAMXT00000003084.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 339.732 bits (870), Expect = 2.759e-100
Identity = 157/334 (47.01%), Postives = 234/334 (70.06%), Query Frame = 2
Query:  851 IILLDGMEVEFDVDQKMLGKYLFDEVCSYLDLIEKDFFGMTYVNSKLQTWFWLEMDKKISKQLSSADDWAFNFQVKFYPPEPVLLQEDITRYLLSLQVRQDVFTGKLPCSWITQALLGSFMVQSELGDFDELEHEEGIDYLREFEFVLNQSDQLLEKIAELHKKHIGMSPDKADVKYLETAKRLEQYGVDLHPARDNDDVEILIGVCYQGVLIYRDRIRIGRFAWPKVLRISYKKNYFYLKIRSDRYDDSVAIVGFKLFNHNLAKRLWKNAVEQHTFFRMKEPQNQKPTQRYMVSGSSTYGYTGKTLHQYRSMNIARNEPL-KFDRALTKRRTI 1849
            + L+D  + E ++++   G+ L D VC +L+L+EKD+FG+T+ +S  Q   WL+  K+I KQ+ ++  W F F VKFYPP+P  L EDITRY L LQ+R D+ +G+LPCS++T ALLGS+ VQ+ELGD+D+ EH  G DY+ +  F  NQ+ +L E++ ELH+ + GM+P +A++ +LE AK+L  YGVDLH A+D++ ++I++GVC  G+LIYRDR+RI RFAWPK+L+ISYK++ FY+KIR   Y+   + +GFKL NH  AKRLWK  +E HTFFR+  P  + P + ++V GS  + Y+G+T  Q R  +   + P   F+R+ +KR  +
Sbjct:   80 VTLMDSSDYEANIEKHCKGQALVDLVCEHLNLLEKDYFGLTFRDSDTQK-NWLDPSKEIKKQMRTSP-WHFAFAVKFYPPDPSQLMEDITRYYLCLQLRDDMLSGRLPCSFVTHALLGSYTVQAELGDYDQDEH--GSDYISDLRFAPNQTRELEERVMELHRTYRGMTPAEAEMNFLENAKKLSMYGVDLHHAKDSEGIDIMLGVCANGLLIYRDRLRINRFAWPKILKISYKRSNFYIKIRPGEYEQFESTIGFKLPNHRAAKRLWKVCIEHHTFFRLVSP--EPPPKGFLVMGSK-FRYSGRTQAQTRQASALIDRPAPHFERSTSKRHLL 406          
BLAST of Protein 4.1 vs. Ensembl Sea Lamprey
Match: EPB41L2 (erythrocyte membrane protein band 4.1 like 2 [Source:HGNC Symbol;Acc:HGNC:3379])

HSP 1 Score: 257.684 bits (657), Expect = 2.946e-74
Identity = 146/338 (43.20%), Postives = 208/338 (61.54%), Query Frame = 2
Query:  905 GKYLFDEVCSYLDLIEKDFFGMTYVNSKLQTWFWLEMDKKISKQLSSADDWAFNFQVKFYPPEPVLLQEDITRYLLSLQVRQDVFTGKLPCSWITQALLGSFMVQSELGDFDELEHEEGIDYLREFEFVLNQSDQLLEKIAELHKKHIGMSPDKADVKYLETAK-----RLEQYGVDLHPAR-------DNDDVEILIGVCYQGVLIYRDRIRIGRFAWPKVLRISYKKNYFYLKIRSDRYDDSVAIVGFKLFNHNLAKRLWKNAVEQHTFFRMKEPQNQKPTQRY-MVSGSSTYGYTGKTLHQYR--SMNIARNEPLKFDRALTKRR-TIGSMPAGL 1870
            G  LF  VC +L+L+E+D+F +TY ++  Q   WL+  K+I KQL  +  W  +F VKFYPP+P  L EDI+RY L LQ+R+DV  G+LPC  +  ALLGS+ +Q+ELGD+D  EH  G  Y   F+   NQ+ +L +++AELH  H  +SP KA  +  E ++      LE  G   H A        D++ V+I +GVC  G+L+YRD +RI RFAWPK+L+ISY+++ F++K+R   ++   + VGFKL +H  AKRLWK  VE HTFFRM  P+   PT+R   +S  S + Y+G+T  Q R  S  I R  P  F R  ++R+ T+ S+   L
Sbjct:   11 GHELFHRVCEHLNLLERDYFSLTYKDASDQK-NWLDPIKEIKKQLMHSP-WLVSFNVKFYPPDPSHLLEDISRYYLCLQLREDVARGRLPCLPVVHALLGSYALQAELGDYDAAEH--GAGYADRFQLAPNQTHELQDRMAELHAAHRCVSPRKASSRSGEDSRDAFRVSLEPTGAFAHNAAFSPQCHPDSEGVDIKLGVCANGLLVYRDHLRINRFAWPKILKISYRRSNFFIKVRPGEFEKCESNVGFKLPSHRAAKRLWKTCVEHHTFFRMAVPE---PTRRARFMSLGSRFRYSGRTQAQTRQASARIGRPGP-PFVRVSSRRQNTVRSLDGAL 340          
BLAST of Protein 4.1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001312.1 (pep scaffold:Pmarinus_7.0:GL477231:34421:73675:-1 gene:ENSPMAG00000001156.1 transcript:ENSPMAT00000001312.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 259.61 bits (662), Expect = 2.536e-72
Identity = 137/359 (38.16%), Postives = 206/359 (57.38%), Query Frame = 2
Query:  824 KHLSSNKAHIILLDGMEVEFDVDQKMLGKYLFDEVCSYLDLIEKDFFGMTYVNSKLQTWFWLEMDKKISKQLSSADDWAFNFQVKFYPPEPVLLQEDITRYLLSLQVRQDVFTGKLPCSWITQALLGSFMVQSELGDFDELEHEEGIDYLREFEFVLNQSDQLLEKIAELHKKHIGMSPDKADVKYLETAKRLEQYGVDLHPARDNDDVEILIGVCYQGVLIYRDRIRIGRFAWPKVLRISYKKNYFYLKIRSDRYDDSVAIVGFKLFNHNLAKRLWKNAVEQHTFFRMKEPQNQKPTQRYMV---SGSSTYGYTGKTLHQY---------RSMNIARNEPLKFDRALTKRRTIGSMPA 1864
            +H +    HI LLD   +    ++   GK L D V ++LDL E D+FG+ + +   +T  WL+  K + KQ+  +  + FNF+VKF+  +P  LQE+ TRY   LQ+R D+   +LPC   T ALL S++VQSELGD+ E EH  G  YL +  F+  Q     +++A+LHK+H+GM+P  A+  YL  AK +E YGV+LH ARD  +VEI++GV   GV +Y + +RI  F W K+++I +K  +F++++R ++ +    I+GF L N+   K LWK  VE HTFFRM  P +  P   ++    S  S + Y+G+T  Q          R+ N AR+   +F R     +  GS  A
Sbjct:   24 RHRTEALCHINLLDNTAITLRANKSEAGKALLDAVFAHLDLAETDYFGLQFADDSTETPRWLDPTKPLRKQIKRSSPYIFNFRVKFFVTDPSKLQEEYTRYHYFLQLRNDILEARLPCPHNTAALLASYIVQSELGDYSETEHLPG--YLSDLRFLPRQGLDFEKEVAKLHKQHVGMTPADAEFNYLNVAKNVEFYGVELHYARDQSNVEIMVGVTAGGVNVYNNGVRISNFPWIKIVKIFFKLKHFFVQLRKEQNETRENIIGFNLGNYRACKTLWKACVEHHTFFRMARPAS-PPHLGFLAQYFSLGSKFRYSGRTEMQTVQYGKERSNRNRNFARSPSQRFPRRTISGKEWGSNAA 379          
BLAST of Protein 4.1 vs. Ensembl Sea Lamprey
Match: epb41l5 (erythrocyte membrane protein band 4.1 like 5 [Source:ZFIN;Acc:ZDB-GENE-030616-450])

HSP 1 Score: 211.46 bits (537), Expect = 1.134e-60
Identity = 117/322 (36.34%), Postives = 182/322 (56.52%), Query Frame = 2
Query:  893 QKMLGKYLFDEVCSYLDLIEKDFFGMTYVNSKLQTWFWLEMDKKISKQLSSADDWAFNFQVKFYPPEPVLLQEDITRYLLSLQVRQDVFTGKLPCSWITQALLGSFMVQSELGDFDELEHEEGIDYLREFEFVLNQSDQLLEKIAELHKKHIGMSPDKADVKYLETAKRLEQYGVDLHPARDNDDVEILIGVCYQGVLIYRDRIRIGRFAWPKVLRISYKKNYFYLKIRSDRYDDSVA----IVGFKLFNHNLAKRLWKNAVEQHTFFRMKEPQNQKPTQRYMVSGSSTYGYTGKTLHQYRSMNIARNEPLKFDRALTKRRT 1846
            +K +G+ LFD+V  +LD++E D+FG+ +++S  Q   WL+  K I KQ+     + F+ +VKFY  EP  L E++TRYL  LQ++QD+ +GKL C + T   L ++ +Q+ELGD D +EH   +  + EF F+ +QS+++ E I E  K   G +P +A++ YL  AK LE YGVD+H  +  D  E  +G+   GVL++    +IG F WPK+ R+ +K+    L +  D  DD          F+L +    K LWK AVE H FFR++ P          +   S + ++G+T  Q   ++ AR     F+R  +KR T
Sbjct:    1 KKAVGQDLFDQVMYHLDILEVDYFGLQFMDSA-QVSHWLDHTKNIRKQVKIGPPYCFHMRVKFYSSEPNNLHEELTRYLFVLQLKQDILSGKLECPFETAVQLATYSLQAELGDCDPVEHNPAL--VSEFRFIPSQSEEMEEAILEKWKDCRGQTPAQAELNYLNKAKWLEMYGVDMHSVKGRDGNEYSLGLTPTGVLVFEGENKIGLFFWPKITRLDFKRTKLTLVVVED--DDQAKEQEHTFVFRLDHPKACKHLWKCAVEHHAFFRLRGPSKTNADPSSFIRMGSRFRFSGRTEFQATKVSKARRTS-SFERRPSKRYT 316          
BLAST of Protein 4.1 vs. Ensembl Sea Lamprey
Match: epb41l5 (erythrocyte membrane protein band 4.1 like 5 [Source:ZFIN;Acc:ZDB-GENE-030616-450])

HSP 1 Score: 211.846 bits (538), Expect = 1.200e-60
Identity = 121/343 (35.28%), Postives = 189/343 (55.10%), Query Frame = 2
Query:  893 QKMLGKYLFDEVCSYLDLIEKDFFGMTYVNSKLQTWFWLEMDKKISKQLSSADDWAFNFQVKFYPPEPVLLQEDITRYLLSLQVRQDVFTGKLPCSWITQALLGSFMVQSELGDFDELEHEEGIDYLREFEFVLNQSDQLLEKIAELHKKHIGMSPDKADVKYLETAKRLEQYGVDLHPARDNDDVEILIGVCYQGVLIYRDRIRIGRFAWPKVLRISYKKNYFYLKIRSDRYDDSVA----IVGFKLFNHNLAKRLWKNAVEQHTFFRMKEPQNQKPTQRYMVSGSSTYGYTGKTLHQYRSMNIAR------NEPLK-------FDRALTKRRTIGSMPAGL 1870
            +K +G+ LFD+V  +LD++E D+FG+ +++S  Q   WL+  K I KQ+     + F+ +VKFY  EP  L E++TRYL  LQ++QD+ +GKL C + T   L ++ +Q+ELGD D +EH   +  + EF F+ +QS+++ E I E  K   G +P +A++ YL  AK LE YGVD+H  +  D  E  +G+   GVL++    +IG F WPK+ R+ +K+    L +  D  DD          F+L +    K LWK AVE H FFR++ P          +   S + ++G+T  Q   ++ AR        P K       F +A   +RT+ S+P+ L
Sbjct:    1 KKAVGQDLFDQVMYHLDILEVDYFGLQFMDSA-QVSHWLDHTKNIRKQVKIGPPYCFHMRVKFYSSEPNNLHEELTRYLFVLQLKQDILSGKLECPFETAVQLATYSLQAELGDCDPVEHNPAL--VSEFRFIPSQSEEMEEAILEKWKDCRGQTPAQAELNYLNKAKWLEMYGVDMHSVKGRDGNEYSLGLTPTGVLVFEGENKIGLFFWPKITRLDFKRTKLTLVVVED--DDQAKEQEHTFVFRLDHPKACKHLWKCAVEHHAFFRLRGPSKTNADPSSFIRMGSRFRFSGRTEFQATKVSKARRTSSFERRPSKRYTRRASFQKAEAPKRTVISIPSRL 338          
BLAST of Protein 4.1 vs. Ensembl Sea Lamprey
Match: epb41l5 (erythrocyte membrane protein band 4.1 like 5 [Source:ZFIN;Acc:ZDB-GENE-030616-450])

HSP 1 Score: 211.46 bits (537), Expect = 1.497e-60
Identity = 117/322 (36.34%), Postives = 182/322 (56.52%), Query Frame = 2
Query:  893 QKMLGKYLFDEVCSYLDLIEKDFFGMTYVNSKLQTWFWLEMDKKISKQLSSADDWAFNFQVKFYPPEPVLLQEDITRYLLSLQVRQDVFTGKLPCSWITQALLGSFMVQSELGDFDELEHEEGIDYLREFEFVLNQSDQLLEKIAELHKKHIGMSPDKADVKYLETAKRLEQYGVDLHPARDNDDVEILIGVCYQGVLIYRDRIRIGRFAWPKVLRISYKKNYFYLKIRSDRYDDSVA----IVGFKLFNHNLAKRLWKNAVEQHTFFRMKEPQNQKPTQRYMVSGSSTYGYTGKTLHQYRSMNIARNEPLKFDRALTKRRT 1846
            +K +G+ LFD+V  +LD++E D+FG+ +++S  Q   WL+  K I KQ+     + F+ +VKFY  EP  L E++TRYL  LQ++QD+ +GKL C + T   L ++ +Q+ELGD D +EH   +  + EF F+ +QS+++ E I E  K   G +P +A++ YL  AK LE YGVD+H  +  D  E  +G+   GVL++    +IG F WPK+ R+ +K+    L +  D  DD          F+L +    K LWK AVE H FFR++ P          +   S + ++G+T  Q   ++ AR     F+R  +KR T
Sbjct:    1 KKAVGQDLFDQVMYHLDILEVDYFGLQFMDSA-QVSHWLDHTKNIRKQVKIGPPYCFHMRVKFYSSEPNNLHEELTRYLFVLQLKQDILSGKLECPFETAVQLATYSLQAELGDCDPVEHNPAL--VSEFRFIPSQSEEMEEAILEKWKDCRGQTPAQAELNYLNKAKWLEMYGVDMHSVKGRDGNEYSLGLTPTGVLVFEGENKIGLFFWPKITRLDFKRTKLTLVVVED--DDQAKEQEHTFVFRLDHPKACKHLWKCAVEHHAFFRLRGPSKTNADPSSFIRMGSRFRFSGRTEFQATKVSKARRTS-SFERRPSKRYT 316          
BLAST of Protein 4.1 vs. Ensembl Nematostella
Match: EDO36130 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJJ3])

HSP 1 Score: 244.202 bits (622), Expect = 1.325e-72
Identity = 128/294 (43.54%), Postives = 185/294 (62.93%), Query Frame = 2
Query:  914 LFDEVCSYLDLIEKDFFGMTYVNSKLQTWFWLEMDKKISKQLSSADDWAFNFQVKFYPPEPVLLQEDITRYLLSLQVRQDVFTGKLPCSWITQALLGSFMVQSELGDFDELEHEEGIDYLREFEFVLNQSDQLLEKIAELHKKHIGMSPDKADVKYLETAKRLEQYGVDLHPARDNDDVEILIGVCYQGVLIYRDRIRIGRFAWPKVLRISYKKNYFYLKIRSDRYDDSVAIVGFKLFNHNLAKRLWKNAVEQHTFFRMKEPQNQKPTQRYMVSGSSTYGYTGKTLHQYRSMNI 1795
            L   V  +L+L EK++FG+ Y +   +  +WL+  K+I KQL   +   F   VKFY P P  L+ D+TRY++ LQVR D+   +LPCS+  QALLGS++VQSE GD+D  EH+   +YL    F  NQS +L+E+I ELHK+H G++P++AD +YLE A++L  YGVD HPARD +  E+L+GV Y GVL+++D +R  +F WPKV+ +SYK   F +K R    ++    + FKL     AKRL+K+ VE HTFFR+  P         ++   S + Y+ KTL Q R+  +
Sbjct:   10 LMVAVAEHLNLDEKEYFGLLYDHKGEK--YWLDPQKEIKKQLK-GNLPHFELAVKFYEPYPSKLKHDMTRYMMVLQVRDDIICERLPCSFGAQALLGSYVVQSEFGDYDPHEHKG--NYLAGLVFSPNQSHELVERIKELHKEHRGLTPEEADTQYLEAARKLTMYGVDAHPARDGNGDEVLVGVSYAGVLVFKDDLRQNKFPWPKVVYLSYKGRDFSVKSRPGELEELTTTMTFKLPTEKAAKRLYKSCVEHHTFFRLSFPDPPPSKTDSLLRMGSKHRYSDKTLFQLRNEGV 298          
BLAST of Protein 4.1 vs. Ensembl Nematostella
Match: EDO30224 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1E3])

HSP 1 Score: 236.113 bits (601), Expect = 1.685e-68
Identity = 122/337 (36.20%), Postives = 198/337 (58.75%), Query Frame = 2
Query:  854 ILLDGMEVEFD--VDQKMLGKYLFDEVCSYLDLIEKDFFGMTYVNSKLQTWFWLEMDKKISKQLSSADDWAFNFQVKFYPPEPVLLQEDITRYLLSLQVRQDVFTGKLPCSWITQALLGSFMVQSELGDFDELEHEEGIDYLREFEFVLNQSDQLLEKIAELHKKHIGMSPDKADVKYLETAKRLEQYGVDLHPARDNDDVEILIGVCYQGVLIYRDRIRIGRFAWPKVLRISYKKNYFYLKIRSDRYDD--SVAIVGFKLFNHNLAKRLWKNAVEQHTFFRMKEPQNQKPTQRYMVSGSSTYGYTGKTLHQYR-SMNIARNEPLKFDRALTKRRTI 1849
            + + G++ +++  +D+   G +LFD+VC ++ L EK++FG+ Y++ K   + WLE D+ I +Q+  A    F F VKFYP  P  L+EDITRY   LQ+R+D+  G++ CS    ALL S+++Q+ELGD    EHE  + YL + +F   Q  +L +KI   H+KH+GM+P  A+ +YL+  ++L  YG D++ A  ++   + I +   GV ++++  ++ RF WPK++ I +K   F L +R+   DD      + FK  +   AKR+WK  VE H FFR+KEP        +   GS  + Y+G+T HQ R + ++   E   FDR  +KR ++
Sbjct:   11 VQVAGLDSDYECPIDKTTKGDHLFDQVCDHIGLAEKEYFGLRYIDEKDGQFNWLEGDRSIKRQMGKAP-LHFYFAVKFYPENPTTLREDITRYQFVLQLREDLLKGRIQCSNPIHALLASYVMQAELGDLHPEEHE--VAYLSDLKFFPKQPPELRQKIEAFHRKHVGMTPSDAEFQYLDNVRKLPLYGRDMYQAWGDEGQAVTIAISAWGVEVFQNNRQMHRFVWPKIISIGFKSKKFSLTLRAPSEDDYYKSTTIYFKCGSQRAAKRVWKVCVEHHAFFRLKEPVPLPKNTNFFKIGSK-FRYSGRTQHQARNNESVGVREQPSFDRVSSKRFSL 343          
BLAST of Protein 4.1 vs. Ensembl Nematostella
Match: EDO44823 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUW8])

HSP 1 Score: 243.817 bits (621), Expect = 3.890e-67
Identity = 131/341 (38.42%), Postives = 201/341 (58.94%), Query Frame = 2
Query:  842 KAHIILLDGMEVEFDVDQKMLGKYLFDEVCSYLDLIEKDFFGMTYVNSKLQTWF------WLEMDKKISKQLSSADDWAFNFQVKFYPPEPVLLQEDITRYLLSLQVRQDVFTGKLPCSWITQALLGSFMVQSELGDFDELEHEEGIDYLREFEFVLNQSDQLLEKIAELHKKHIGMSPDKADVKYLETAKRLEQYGVDLHPARDNDDVEILIGVCYQGVLIYRDRIRIGRFAWPKVLRISYKKNYFYLKIRSDRYDDSVAIVGFKLFNHNLAKRLWKNAVEQHTFFRMKEPQNQKPTQRYMVSGSSTYGYTGKTLHQY--RSMNIARNEPLKFDRALTKR 1840
            +  + LLD  E   DVD+   G  L +EV  +LD+ EK +FG+ YV+             WL+ DK I KQ      + F F V+F+  +P  L ED+TRY   LQ+++D+ TG+LPC + T A L S+++Q+ELGD+D   H +G  Y+ EF F+ +Q+D   E+ AE HK HIG +P  A+  +LE AK L+ YGVDLH A+D+D  ++ +GV   G+ +Y ++ +I  F W K++++ +K+  F+++IR D  + +  I+GF++  +   K LWK  VE H+F+R   P   K T++ ++   S Y Y GKT +Q    S   AR EP K  R L++R
Sbjct:   36 RCVVELLDDSEFIIDVDKNAKGTVLLNEVFRHLDIQEKHYFGLQYVSDSPDNMVGGAKEQWLQDDKIIRKQKKGTPPYIFYFCVRFFVSDPSKLVEDLTRYYFYLQIKRDILTGRLPCLYDTAAELSSYILQAELGDYDPKLHLDG--YVSEFRFIPDQTDDFEERAAEFHKHHIGQTPADAEFNFLEVAKTLDLYGVDLHCAKDHDGTDLFLGVSALGLTVYHNKCKINFFPWSKIVKVCFKRKRFFIQIRPDWNEWTDNIIGFQMLTYRSCKNLWKVCVEYHSFYRTHYP---KATEKRVLRMGSKYRYKGKTEYQAIEESRTHARPEP-KIVRTLSRR 370          
BLAST of Protein 4.1 vs. Ensembl Nematostella
Match: EDO33626 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRN5])

HSP 1 Score: 229.565 bits (584), Expect = 1.909e-61
Identity = 114/309 (36.89%), Postives = 184/309 (59.55%), Query Frame = 2
Query:  851 IILLDGMEVEFDVDQKMLGKYLFDEVCSYLDLIEKDFFGMTYVNSKLQTWFWLEMDKKISKQLSSADDWAFNFQVKFYPPEPVLLQEDITRYLLSLQVRQDVFTGKLPCSWITQALLGSFMVQSELGDFDELEHEEGIDYLREFEFVLNQSDQLLEKIAELHKKHIGMSPDKADVKYLETAKRLEQYGVDLHPARDNDDVEILIGVCYQGVLIYRDRIRIGRFAWPKVLRISYKKNYFYLKIRSDRYDDSVAIVGFKLFNHNLAKRLWKNAVEQHTFFRMKEPQNQKPTQRYMVSGSSTYGYTGKTLHQ 1777
            + +LD   V+FD++ K+ G  L+ +V  YL+L E+++FG++Y + K    FWL+  K I KQ+       F F VKFY  +P +LQE+ TRYL +LQV++D+  G L CS  T ALL S++VQ ELGDFD L    G  YL +F+F   Q+     +I++ HK+H  +SP   D   L+ A+RLE YGV L+PA+D D+V++ +     G+++++   +I   +W K+ ++S+K+  F +K+  + +     +V F++ + N  K  WK A+  H FFR  E Q+    +  + S  S+Y ++G+T  Q
Sbjct:   27 VCMLDDSVVKFDIEPKVKGDILYKQVYEYLNLDEREYFGLSYYD-KSDNLFWLDQLKPIKKQVKEIGKVLFRFCVKFYTADPAMLQEEYTRYLFALQVKKDLVNGGLKCSESTAALLASYVVQGELGDFDTLSCRPG--YLADFQFFPEQTVDSEARISDFHKQHRSLSPTDCDYNLLDVARRLEMYGVILYPAKDKDNVDLELAAANMGIIVFQSGSKINTLSWAKIRKLSFKRKRFLIKLHPEIFGHYKDVVEFQMASRNACKSFWKVAISTHAFFRQSESQSPPRHRPRVFSRGSSYRFSGRTQKQ 332          
BLAST of Protein 4.1 vs. Ensembl Nematostella
Match: EDO34391 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPH7])

HSP 1 Score: 206.838 bits (525), Expect = 7.718e-60
Identity = 110/280 (39.29%), Postives = 172/280 (61.43%), Query Frame = 2
Query:  851 IILLDGMEVEFDVDQKMLGKYLFDEVCSYLDLIEKDFFGMTYVNSKLQTWFWLEMDKKISKQLSSADD-WAFNFQVKFYPPEPVLLQEDITRYLLSLQVRQDVFTGKLPCSWITQALLGSFMVQSELGDFDELEHEEGIDYLREFEFVLNQSDQLLEKIAELHKKHIGMSPDKADVKYLETAKRLEQYGVDLHPARDNDDVEILIGVCYQGVLIYRDRIRIGRFAWPKVLRISYKKNYFYLKIRSDRYDDSVAIVGFKLFNHNLAKRLWKNAVEQHTFFR 1687
            I LLD  E+  +  +   G+ +FD VC  LDL+EKD+FG+ YV+   Q   WL++ K + KQ+ S    +   F+VKFY  +P L+ E+ITRY   LQ+++D+  G+L CS+   A LG+++VQ+ELGD+D  + E+  +Y+ EF  V  QS++L  KIA++H+   G  P  A+  +L+  K L+ YGVD HP +D D+V++ +G+   G+ I RD  ++  F W ++++ SY+   FY+++     DD  A  GF+L +    K LWK AVE H F+R
Sbjct:   18 ISLLDDTELTCEFRRDAKGQTVFDTVCKALDLVEKDYFGLRYVDDSKQR-HWLDLSKSVIKQMKSLKPPFKLFFRVKFYALDPGLIHEEITRYQCFLQIKRDILHGRLLCSYNELAELGAYIVQAELGDYDPEDQED--NYVSEFRIVPKQSEKLENKIADIHRSLSGQVPSVAEKNFLDKVKSLDMYGVDPHPCKDQDNVQLYLGLTPTGIAIIRDGKKVSGFEWAQIIKCSYEGKVFYVQVHK---DDRKANYGFRLPDPLACKHLWKCAVEHHAFYR 291          
BLAST of Protein 4.1 vs. Ensembl Medaka
Match: si:ch73-18b11.1 (erythrocyte membrane protein band 4.1 like 2 [Source:NCBI gene;Acc:101171627])

HSP 1 Score: 343.199 bits (879), Expect = 1.443e-101
Identity = 165/350 (47.14%), Postives = 242/350 (69.14%), Query Frame = 2
Query:  845 AHIILLDGMEVEFDVDQKMLGKYLFDEVCSYLDLIEKDFFGMTYVNSKLQTWFWLEMDKKISKQLSSADDWAFNFQVKFYPPEPVLLQEDITRYLLSLQVRQDVFTGKLPCSWITQALLGSFMVQSELGDFDELEHEEGIDYLREFEFVLNQSDQLLEKIAELHKKHIGMSPDKADVKYLETAKRLEQYGVDLHPARDNDDVEILIGVCYQGVLIYRDRIRIGRFAWPKVLRISYKKNYFYLKIRSDRYDDSVAIVGFKLFNHNLAKRLWKNAVEQHTFFRMKEPQNQKPTQRYMVSGSSTYGYTGKTLHQYRSMNIARNEPL-KFDRALTKR--RTIGSMPA-GLEKAG 1882
             H+ LLDG +   +V+++  G+YLF +VC +L+L+EKD+FG+TY ++  +   WL+  K+I +Q+ S ++W F+F VKFYPP+P LL EDITRYLL LQ+R DV  G+LPCS++T ALLGS+ +Q+E GD  E +    +D++ +  F  NQS ++ EKI ELHK H GM+P +AD+++LE AK+L  YGVDLH A+D++ V+I++GVC  G+L+Y+DR+RI RFAWPK+L+ISYK+N FY+KIR    +   + VGFKL NH  AKRLWK  VE H+FFR+  P  + PT+   ++  S + Y+G+T  Q R  +   + P   F+R  +KR  R++   P   + +AG
Sbjct:  209 CHVTLLDGTDFSCEVEKRANGQYLFFKVCEHLNLLEKDYFGLTYKDTHDEKC-WLDPMKEIKRQIRS-NNWQFSFNVKFYPPDPSLLTEDITRYLLCLQLRDDVAFGRLPCSFVTHALLGSYTLQAEFGD-QEPDQPRPLDFISQQTFAPNQSKEMEEKILELHKSHKGMTPAQADIQFLENAKKLSMYGVDLHRAKDSEGVDIMLGVCANGLLVYKDRLRINRFAWPKILKISYKRNNFYIKIRPGETEQFESTVGFKLQNHRSAKRLWKVCVENHSFFRLNAP--EPPTKARFLTLGSKFRYSGRTQAQTRMASSLIDRPAPNFERTSSKRISRSLDGAPVISITEAG 553          
BLAST of Protein 4.1 vs. Ensembl Medaka
Match: si:ch73-18b11.1 (erythrocyte membrane protein band 4.1 like 2 [Source:NCBI gene;Acc:101171627])

HSP 1 Score: 343.199 bits (879), Expect = 3.527e-101
Identity = 165/350 (47.14%), Postives = 242/350 (69.14%), Query Frame = 2
Query:  845 AHIILLDGMEVEFDVDQKMLGKYLFDEVCSYLDLIEKDFFGMTYVNSKLQTWFWLEMDKKISKQLSSADDWAFNFQVKFYPPEPVLLQEDITRYLLSLQVRQDVFTGKLPCSWITQALLGSFMVQSELGDFDELEHEEGIDYLREFEFVLNQSDQLLEKIAELHKKHIGMSPDKADVKYLETAKRLEQYGVDLHPARDNDDVEILIGVCYQGVLIYRDRIRIGRFAWPKVLRISYKKNYFYLKIRSDRYDDSVAIVGFKLFNHNLAKRLWKNAVEQHTFFRMKEPQNQKPTQRYMVSGSSTYGYTGKTLHQYRSMNIARNEPL-KFDRALTKR--RTIGSMPA-GLEKAG 1882
             H+ LLDG +   +V+++  G+YLF +VC +L+L+EKD+FG+TY ++  +   WL+  K+I +Q+ S ++W F+F VKFYPP+P LL EDITRYLL LQ+R DV  G+LPCS++T ALLGS+ +Q+E GD  E +    +D++ +  F  NQS ++ EKI ELHK H GM+P +AD+++LE AK+L  YGVDLH A+D++ V+I++GVC  G+L+Y+DR+RI RFAWPK+L+ISYK+N FY+KIR    +   + VGFKL NH  AKRLWK  VE H+FFR+  P  + PT+   ++  S + Y+G+T  Q R  +   + P   F+R  +KR  R++   P   + +AG
Sbjct:  209 CHVTLLDGTDFSCEVEKRANGQYLFFKVCEHLNLLEKDYFGLTYKDTHDEKC-WLDPMKEIKRQIRS-NNWQFSFNVKFYPPDPSLLTEDITRYLLCLQLRDDVAFGRLPCSFVTHALLGSYTLQAEFGD-QEPDQPRPLDFISQQTFAPNQSKEMEEKILELHKSHKGMTPAQADIQFLENAKKLSMYGVDLHRAKDSEGVDIMLGVCANGLLVYKDRLRINRFAWPKILKISYKRNNFYIKIRPGETEQFESTVGFKLQNHRSAKRLWKVCVENHSFFRLNAP--EPPTKARFLTLGSKFRYSGRTQAQTRMASSLIDRPAPNFERTSSKRISRSLDGAPVISITEAG 553          
BLAST of Protein 4.1 vs. Ensembl Medaka
Match: si:ch73-18b11.1 (erythrocyte membrane protein band 4.1 like 2 [Source:NCBI gene;Acc:101171627])

HSP 1 Score: 342.813 bits (878), Expect = 9.296e-101
Identity = 165/350 (47.14%), Postives = 242/350 (69.14%), Query Frame = 2
Query:  845 AHIILLDGMEVEFDVDQKMLGKYLFDEVCSYLDLIEKDFFGMTYVNSKLQTWFWLEMDKKISKQLSSADDWAFNFQVKFYPPEPVLLQEDITRYLLSLQVRQDVFTGKLPCSWITQALLGSFMVQSELGDFDELEHEEGIDYLREFEFVLNQSDQLLEKIAELHKKHIGMSPDKADVKYLETAKRLEQYGVDLHPARDNDDVEILIGVCYQGVLIYRDRIRIGRFAWPKVLRISYKKNYFYLKIRSDRYDDSVAIVGFKLFNHNLAKRLWKNAVEQHTFFRMKEPQNQKPTQRYMVSGSSTYGYTGKTLHQYRSMNIARNEPL-KFDRALTKR--RTIGSMPA-GLEKAG 1882
             H+ LLDG +   +V+++  G+YLF +VC +L+L+EKD+FG+TY ++  +   WL+  K+I +Q+ S ++W F+F VKFYPP+P LL EDITRYLL LQ+R DV  G+LPCS++T ALLGS+ +Q+E GD  E +    +D++ +  F  NQS ++ EKI ELHK H GM+P +AD+++LE AK+L  YGVDLH A+D++ V+I++GVC  G+L+Y+DR+RI RFAWPK+L+ISYK+N FY+KIR    +   + VGFKL NH  AKRLWK  VE H+FFR+  P  + PT+   ++  S + Y+G+T  Q R  +   + P   F+R  +KR  R++   P   + +AG
Sbjct:  209 CHVTLLDGTDFSCEVEKRANGQYLFFKVCEHLNLLEKDYFGLTYKDTHDEKC-WLDPMKEIKRQIRS-NNWQFSFNVKFYPPDPSLLTEDITRYLLCLQLRDDVAFGRLPCSFVTHALLGSYTLQAEFGD-QEPDQPRPLDFISQQTFAPNQSKEMEEKILELHKSHKGMTPAQADIQFLENAKKLSMYGVDLHRAKDSEGVDIMLGVCANGLLVYKDRLRINRFAWPKILKISYKRNNFYIKIRPGETEQFESTVGFKLQNHRSAKRLWKVCVENHSFFRLNAP--EPPTKARFLTLGSKFRYSGRTQAQTRMASSLIDRPAPNFERTSSKRISRSLDGAPVISITEAG 553          
BLAST of Protein 4.1 vs. Ensembl Medaka
Match: si:ch73-18b11.1 (erythrocyte membrane protein band 4.1 like 2 [Source:NCBI gene;Acc:101171627])

HSP 1 Score: 343.584 bits (880), Expect = 9.682e-101
Identity = 165/350 (47.14%), Postives = 242/350 (69.14%), Query Frame = 2
Query:  845 AHIILLDGMEVEFDVDQKMLGKYLFDEVCSYLDLIEKDFFGMTYVNSKLQTWFWLEMDKKISKQLSSADDWAFNFQVKFYPPEPVLLQEDITRYLLSLQVRQDVFTGKLPCSWITQALLGSFMVQSELGDFDELEHEEGIDYLREFEFVLNQSDQLLEKIAELHKKHIGMSPDKADVKYLETAKRLEQYGVDLHPARDNDDVEILIGVCYQGVLIYRDRIRIGRFAWPKVLRISYKKNYFYLKIRSDRYDDSVAIVGFKLFNHNLAKRLWKNAVEQHTFFRMKEPQNQKPTQRYMVSGSSTYGYTGKTLHQYRSMNIARNEPL-KFDRALTKR--RTIGSMPA-GLEKAG 1882
             H+ LLDG +   +V+++  G+YLF +VC +L+L+EKD+FG+TY ++  +   WL+  K+I +Q+ S ++W F+F VKFYPP+P LL EDITRYLL LQ+R DV  G+LPCS++T ALLGS+ +Q+E GD  E +    +D++ +  F  NQS ++ EKI ELHK H GM+P +AD+++LE AK+L  YGVDLH A+D++ V+I++GVC  G+L+Y+DR+RI RFAWPK+L+ISYK+N FY+KIR    +   + VGFKL NH  AKRLWK  VE H+FFR+  P  + PT+   ++  S + Y+G+T  Q R  +   + P   F+R  +KR  R++   P   + +AG
Sbjct:  209 CHVTLLDGTDFSCEVEKRANGQYLFFKVCEHLNLLEKDYFGLTYKDTHDEKC-WLDPMKEIKRQIRS-NNWQFSFNVKFYPPDPSLLTEDITRYLLCLQLRDDVAFGRLPCSFVTHALLGSYTLQAEFGD-QEPDQPRPLDFISQQTFAPNQSKEMEEKILELHKSHKGMTPAQADIQFLENAKKLSMYGVDLHRAKDSEGVDIMLGVCANGLLVYKDRLRINRFAWPKILKISYKRNNFYIKIRPGETEQFESTVGFKLQNHRSAKRLWKVCVENHSFFRLNAP--EPPTKARFLTLGSKFRYSGRTQAQTRMASSLIDRPAPNFERTSSKRISRSLDGAPVISITEAG 553          
BLAST of Protein 4.1 vs. Ensembl Medaka
Match: si:ch73-18b11.1 (erythrocyte membrane protein band 4.1 like 2 [Source:NCBI gene;Acc:101171627])

HSP 1 Score: 344.354 bits (882), Expect = 1.484e-100
Identity = 165/350 (47.14%), Postives = 242/350 (69.14%), Query Frame = 2
Query:  845 AHIILLDGMEVEFDVDQKMLGKYLFDEVCSYLDLIEKDFFGMTYVNSKLQTWFWLEMDKKISKQLSSADDWAFNFQVKFYPPEPVLLQEDITRYLLSLQVRQDVFTGKLPCSWITQALLGSFMVQSELGDFDELEHEEGIDYLREFEFVLNQSDQLLEKIAELHKKHIGMSPDKADVKYLETAKRLEQYGVDLHPARDNDDVEILIGVCYQGVLIYRDRIRIGRFAWPKVLRISYKKNYFYLKIRSDRYDDSVAIVGFKLFNHNLAKRLWKNAVEQHTFFRMKEPQNQKPTQRYMVSGSSTYGYTGKTLHQYRSMNIARNEPL-KFDRALTKR--RTIGSMPA-GLEKAG 1882
             H+ LLDG +   +V+++  G+YLF +VC +L+L+EKD+FG+TY ++  +   WL+  K+I +Q+ S ++W F+F VKFYPP+P LL EDITRYLL LQ+R DV  G+LPCS++T ALLGS+ +Q+E GD  E +    +D++ +  F  NQS ++ EKI ELHK H GM+P +AD+++LE AK+L  YGVDLH A+D++ V+I++GVC  G+L+Y+DR+RI RFAWPK+L+ISYK+N FY+KIR    +   + VGFKL NH  AKRLWK  VE H+FFR+  P  + PT+   ++  S + Y+G+T  Q R  +   + P   F+R  +KR  R++   P   + +AG
Sbjct:  209 CHVTLLDGTDFSCEVEKRANGQYLFFKVCEHLNLLEKDYFGLTYKDTHDEKC-WLDPMKEIKRQIRS-NNWQFSFNVKFYPPDPSLLTEDITRYLLCLQLRDDVAFGRLPCSFVTHALLGSYTLQAEFGD-QEPDQPRPLDFISQQTFAPNQSKEMEEKILELHKSHKGMTPAQADIQFLENAKKLSMYGVDLHRAKDSEGVDIMLGVCANGLLVYKDRLRINRFAWPKILKISYKRNNFYIKIRPGETEQFESTVGFKLQNHRSAKRLWKVCVENHSFFRLNAP--EPPTKARFLTLGSKFRYSGRTQAQTRMASSLIDRPAPNFERTSSKRISRSLDGAPVISITEAG 553          
BLAST of Protein 4.1 vs. Planmine SMEST
Match: SMESG000029732.1 (SMESG000029732.1)

HSP 1 Score: 1812.35 bits (4693), Expect = 0.000e+0
Identity = 1064/1064 (100.00%), Postives = 1064/1064 (100.00%), Query Frame = 2
Query:   59 MHQYNEEYDNDGVNQESQXXXXXXXXXXXXXXXVXXXXXXXXXXXXXXMAYEEAPPPRKSEEENFDPSQPPKRKHRSKNKKRDEEYIEEPNYQYNADDGYEDGQKSPEPDYXXXXXXXXXXXXXXXXXXXDPPEDHYLNLKIQSPIESXXXXXXYPFEDANESIQLXXXXXXXXXXXXXSVGQSDQNETPVEPKPKKKSGGFMXXXXXXXXXXXXXXXXXXXXXGNQWQSNPEIFNPAYDSQPATLERKKISKSAKHLSSNKAHIILLDGMEVEFDVDQKMLGKYLFDEVCSYLDLIEKDFFGMTYVNSKLQTWFWLEMDKKISKQLSSADDWAFNFQVKFYPPEPVLLQEDITRYLLSLQVRQDVFTGKLPCSWITQALLGSFMVQSELGDFDELEHEEGIDYLREFEFVLNQSDQLLEKIAELHKKHIGMSPDKADVKYLETAKRLEQYGVDLHPARDNDDVEILIGVCYQGVLIYRDRIRIGRFAWPKVLRISYKKNYFYLKIRSDRYDDSVAIVGFKLFNHNLAKRLWKNAVEQHTFFRMKEPQNQKPTQRYMVSGSSTYGYTGKTLHQYRSMNIARNEPLKFDRALTKRRTIGSMPAGLEKAGMLYSSMHSLNRSHPRDMTLGKTKSIEYLSAKRPGSNLXXXXXXXXXXXXXXRLAPPQSKYPPYGGSVSSFNEDRHMSFQSGNSINAADSYTAINDDQASLPPMPTVQLSEYTKPYKKHNSKTSRSNDVLSDDGINPQLTISKPSRKQAKQKSYEVNSEDDQNPQPEYAKVLKKQPSKTSRTPDVLSDDGNNPQLEFSKPFRKQNSKAPRSFDVPSDDGIDQQPEYSKPMKKRSSRTSRPNDVVPDEERNPSPEISKPLKKQHSKSRRQTEEPSDEEIPQPIYAKPHKKRHSKTVRPNEELSDDGFVPPTVQGKVNARPEIILPLPDPPVDTSQSEAADSPSKLSKKRGSQKQSGTPNSNRXXXXXXXXXXXXXXXXXXXVXXXXXXXXXXPMEHNLXXXXXXIVELPQVTXXXXXXXXXXXXXXXXXNIVVKDQIAIKKSAAAPRYNDESSNDDML 3250
            MHQYNEEYDNDGVNQESQKREKKKKRHRKPKEEVYNDDEININYNNPNMAYEEAPPPRKSEEENFDPSQPPKRKHRSKNKKRDEEYIEEPNYQYNADDGYEDGQKSPEPDYEKPIRKHKKERRKKSRETEDPPEDHYLNLKIQSPIESNNNNNNYPFEDANESIQLDEDDDHYEDEVDHSVGQSDQNETPVEPKPKKKSGGFMNIFASFKKKNKSKNTDNNKINGNQWQSNPEIFNPAYDSQPATLERKKISKSAKHLSSNKAHIILLDGMEVEFDVDQKMLGKYLFDEVCSYLDLIEKDFFGMTYVNSKLQTWFWLEMDKKISKQLSSADDWAFNFQVKFYPPEPVLLQEDITRYLLSLQVRQDVFTGKLPCSWITQALLGSFMVQSELGDFDELEHEEGIDYLREFEFVLNQSDQLLEKIAELHKKHIGMSPDKADVKYLETAKRLEQYGVDLHPARDNDDVEILIGVCYQGVLIYRDRIRIGRFAWPKVLRISYKKNYFYLKIRSDRYDDSVAIVGFKLFNHNLAKRLWKNAVEQHTFFRMKEPQNQKPTQRYMVSGSSTYGYTGKTLHQYRSMNIARNEPLKFDRALTKRRTIGSMPAGLEKAGMLYSSMHSLNRSHPRDMTLGKTKSIEYLSAKRPGSNLGINQGSTSNINNNNRLAPPQSKYPPYGGSVSSFNEDRHMSFQSGNSINAADSYTAINDDQASLPPMPTVQLSEYTKPYKKHNSKTSRSNDVLSDDGINPQLTISKPSRKQAKQKSYEVNSEDDQNPQPEYAKVLKKQPSKTSRTPDVLSDDGNNPQLEFSKPFRKQNSKAPRSFDVPSDDGIDQQPEYSKPMKKRSSRTSRPNDVVPDEERNPSPEISKPLKKQHSKSRRQTEEPSDEEIPQPIYAKPHKKRHSKTVRPNEELSDDGFVPPTVQGKVNARPEIILPLPDPPVDTSQSEAADSPSKLSKKRGSQKQSGTPNSNRPMPPNHFKPPPPPPEPIAPVRSNSSSERSSPMEHNLPPPPPPIVELPQVTKPKPPPLKPKPALKPKPNIVVKDQIAIKKSAAAPRYNDESSNDDML
Sbjct:    1 MHQYNEEYDNDGVNQESQKREKKKKRHRKPKEEVYNDDEININYNNPNMAYEEAPPPRKSEEENFDPSQPPKRKHRSKNKKRDEEYIEEPNYQYNADDGYEDGQKSPEPDYEKPIRKHKKERRKKSRETEDPPEDHYLNLKIQSPIESNNNNNNYPFEDANESIQLDEDDDHYEDEVDHSVGQSDQNETPVEPKPKKKSGGFMNIFASFKKKNKSKNTDNNKINGNQWQSNPEIFNPAYDSQPATLERKKISKSAKHLSSNKAHIILLDGMEVEFDVDQKMLGKYLFDEVCSYLDLIEKDFFGMTYVNSKLQTWFWLEMDKKISKQLSSADDWAFNFQVKFYPPEPVLLQEDITRYLLSLQVRQDVFTGKLPCSWITQALLGSFMVQSELGDFDELEHEEGIDYLREFEFVLNQSDQLLEKIAELHKKHIGMSPDKADVKYLETAKRLEQYGVDLHPARDNDDVEILIGVCYQGVLIYRDRIRIGRFAWPKVLRISYKKNYFYLKIRSDRYDDSVAIVGFKLFNHNLAKRLWKNAVEQHTFFRMKEPQNQKPTQRYMVSGSSTYGYTGKTLHQYRSMNIARNEPLKFDRALTKRRTIGSMPAGLEKAGMLYSSMHSLNRSHPRDMTLGKTKSIEYLSAKRPGSNLGINQGSTSNINNNNRLAPPQSKYPPYGGSVSSFNEDRHMSFQSGNSINAADSYTAINDDQASLPPMPTVQLSEYTKPYKKHNSKTSRSNDVLSDDGINPQLTISKPSRKQAKQKSYEVNSEDDQNPQPEYAKVLKKQPSKTSRTPDVLSDDGNNPQLEFSKPFRKQNSKAPRSFDVPSDDGIDQQPEYSKPMKKRSSRTSRPNDVVPDEERNPSPEISKPLKKQHSKSRRQTEEPSDEEIPQPIYAKPHKKRHSKTVRPNEELSDDGFVPPTVQGKVNARPEIILPLPDPPVDTSQSEAADSPSKLSKKRGSQKQSGTPNSNRPMPPNHFKPPPPPPEPIAPVRSNSSSERSSPMEHNLPPPPPPIVELPQVTKPKPPPLKPKPALKPKPNIVVKDQIAIKKSAAAPRYNDESSNDDML 1064          
BLAST of Protein 4.1 vs. Planmine SMEST
Match: SMESG000062476.1 (SMESG000062476.1)

HSP 1 Score: 256.529 bits (654), Expect = 3.103e-70
Identity = 140/307 (45.60%), Postives = 199/307 (64.82%), Query Frame = 2
Query:  845 AHIILLDGMEVEFDVDQKMLGKYLFDEVCSYLDLIEKDFFGMTYVNSKLQTWFWLEMDKKISKQLSSADDWAFNFQVKFYPPEPVLLQEDITRYLLSLQVRQDVFTGKLPCSWITQALLGSFMVQSELGDFDELEHEEGIDYLREFEFVLN--QSDQLLEKIAELHKKHIGM-SPDKADVKYLETAKRLEQYGVDLHPARDNDDVEILIGVCYQGVLIYRDRIRIGRFAWPKVLRISYKKNYFYLKIRSDRYDDSVAIVGFKLFNHNLAKRLWKNAVEQHTFFRMKEPQNQKPTQRYMVSGSSTYGY 1756
             ++ +LDG E  +D+D    G++LFD +C  LDL E+ +FG+ Y +  L+ WFWL MDKKIS QL   + W F+FQVKFYPP     +ED+T+Y   LQVRQD+  G LP S+    LLG+  VQSE GDFD   H+ GI+YLR+  F     Q+D+LL +I+ELHK+ +GM +P++AD  +L  A +L  YGVD+H  ++  + E+ +GV + G+LIYR RIRI R +WPK+++++YK   FYL +R+   + +   + FK  +H LAKRLWK  VE HTFFRM + +N +  Q     G+  Y Y
Sbjct:   87 CNVTMLDGTEENYDIDSASFGQHLFDRICDQLDLNERQYFGIKYNDKTLRIWFWLAMDKKISDQLGK-NQWVFDFQVKFYPPHVDDFEEDLTKYFFCLQVRQDIVEGILPMSFNIFVLLGAHAVQSEAGDFDPNNHQ-GIEYLRKMPFAPKALQTDELLLRISELHKQ-VGMQTPEEADRAFLWNAMKLGMYGVDMHKVKNQQNEELSVGVYHSGILIYRGRIRIIRHSWPKIVKLTYKHKSFYLFLRATEINKAERQLEFKCGSHKLAKRLWKACVEHHTFFRMVDAENPRKPQLIPGFGTRKYLY 390          
BLAST of Protein 4.1 vs. Planmine SMEST
Match: SMESG000019493.1 (SMESG000019493.1)

HSP 1 Score: 248.054 bits (632), Expect = 2.533e-67
Identity = 115/284 (40.49%), Postives = 186/284 (65.49%), Query Frame = 2
Query:  851 IILLDGMEVEFDVDQKMLGKYLFDEVCSYLDLIEKDFFGMTYVNSKLQTWFWLEMDKKISKQLSSADDWAFNFQVKFYPPEPVLLQEDITRYLLSLQVRQDVFTGKLPCSWITQALLGSFMVQSELGDFDELEHEEGIDYLREFEFVLN--QSDQLLEKIAELHKKHIGMSPDKADVKYLETAKRLEQYGVDLHPARDNDDVEILIGVCYQGVLIYRDRIRIGRFAWPKVLRISYKKNYFYLKIRSDRYDDSVAIVGFKLFNHNLAKRLWKNAVEQHTFFRMKE 1696
            +I+LDG E  F +D+   G++LFD VC +L+L E+++FG++Y   + +  FWL+  KKI+K +   +   F FQVKFYPPE  ++ ED+TRY LSLQVRQD+  GKLPCS+    +L S+++QSE GD+D   H  GI+Y++         Q+   +EK+  LHK H G +P++AD  +L+ A++L  YG+D+H  ++++  EI++GV Y G+++YR ++R+ RF+W +++++SYKK    + +R    +D+   + FK  +  L K+ +K  V+ H FFRM E
Sbjct:  108 VIMLDGTEEVFTIDRASFGQHLFDAVCDHLELNEREYFGISY-KDRCKIMFWLDFTKKITKHVPD-NRLVFEFQVKFYPPEISMVVEDLTRYYLSLQVRQDLVCGKLPCSFYVYTILASYVIQSEAGDYDPQAHR-GIEYIKSQPLAPQKFQTQDFMEKVVALHKLHRGQTPEEADKNFLDNARKLALYGLDMHKVKNSEGEEIMLGVYYGGIVLYRQKVRVIRFSWARLIQVSYKKKKLIITVRGVNKNDNKKELTFKCTDLKLTKKAYKAVVDHHYFFRMIE 388          
BLAST of Protein 4.1 vs. Planmine SMEST
Match: SMESG000038155.1 (SMESG000038155.1)

HSP 1 Score: 242.662 bits (618), Expect = 4.563e-65
Identity = 124/360 (34.44%), Postives = 213/360 (59.17%), Query Frame = 2
Query:  776 DSQPATLERKKISKSAKHLSSNKAHIILLDGMEVEFDVDQKMLGKYLFDEVCSYLDLIEKDFFGMTYVNSKLQTWFWLEMDKKISKQLSSADDWAFNFQVKFYPPEPVLLQEDITRYLLSLQVRQDVFTGKLPCSWITQALLGSFMVQSELGDFDELEHEEGIDYLREFEFVLNQSDQLLEKIAELHKKHIGMSPDKADVKYLETAKRLEQYGVDLHPARDNDDVEILIGVCYQGVLIYRDRIRIGRFAWPKVLRISYKKNYFYLKIRSDRYDDSVAIVGFKLFNHNLAKRLWKNAVEQHTFFRMKEPQNQKPTQRYMVSGSSTYGYTGKTLHQYRSMNIARNEPLK---FDRALTKRRT 1846
            ++Q + L+R  +SK           + LLD     F V  + +G++L+++V + L L+E D+F + Y+N K     WL+  K++ KQ +   ++ F F +KFY P P +L+++ TRYL +LQ+++D++ G L C+  T ALL +F+ QSE+GDF E E+++   YL         +++ L K+ E H+  +G SP +AD   L+TA+++E YG+ LHPARD++++ + + V +QG++I+++RI+I  F+W KV ++S+K+  FY+K+ ++ YD    IV F   + N  K  WK  +E H FFR +  +     +  ++S  S+Y YTG+T  Q +     R    K   F+R+L+  R 
Sbjct:    2 ENQTSPLKRANLSKYIG------VRVTLLDDSVQHFHVSVRAIGQHLYNQVIAKLQLLESDYFDLEYIN-KEGVSCWLDHLKQVVKQCTQRKEYIFQFGIKFYAPYPNMLEDEYTRYLFALQIKRDIYQGHLQCNINTTALLLAFIAQSEIGDFLEDEYDD-YTYLSSLRLTKQANEEFLMKVMECHRTLVGQSPSEADYNLLDTARKVESYGIKLHPARDHENLPLKLAVSHQGIVIHQNRIKINIFSWAKVRKLSFKRKRFYIKLHAEGYD----IVEFIFNSRNECKNFWKQCIEHHAFFRCQAVKQGSKRRSKVLSKGSSYRYTGRTQKQLQE--CVRETSYKRPQFERSLSMSRV 347          
BLAST of Protein 4.1 vs. Planmine SMEST
Match: SMESG000038155.1 (SMESG000038155.1)

HSP 1 Score: 241.506 bits (615), Expect = 1.092e-64
Identity = 124/360 (34.44%), Postives = 213/360 (59.17%), Query Frame = 2
Query:  776 DSQPATLERKKISKSAKHLSSNKAHIILLDGMEVEFDVDQKMLGKYLFDEVCSYLDLIEKDFFGMTYVNSKLQTWFWLEMDKKISKQLSSADDWAFNFQVKFYPPEPVLLQEDITRYLLSLQVRQDVFTGKLPCSWITQALLGSFMVQSELGDFDELEHEEGIDYLREFEFVLNQSDQLLEKIAELHKKHIGMSPDKADVKYLETAKRLEQYGVDLHPARDNDDVEILIGVCYQGVLIYRDRIRIGRFAWPKVLRISYKKNYFYLKIRSDRYDDSVAIVGFKLFNHNLAKRLWKNAVEQHTFFRMKEPQNQKPTQRYMVSGSSTYGYTGKTLHQYRSMNIARNEPLK---FDRALTKRRT 1846
            ++Q + L+R  +SK           + LLD     F V  + +G++L+++V + L L+E D+F + Y+N K     WL+  K++ KQ +   ++ F F +KFY P P +L+++ TRYL +LQ+++D++ G L C+  T ALL +F+ QSE+GDF E E+++   YL         +++ L K+ E H+  +G SP +AD   L+TA+++E YG+ LHPARD++++ + + V +QG++I+++RI+I  F+W KV ++S+K+  FY+K+ ++ YD    IV F   + N  K  WK  +E H FFR +  +     +  ++S  S+Y YTG+T  Q +     R    K   F+R+L+  R 
Sbjct:    2 ENQTSPLKRANLSKYIG------VRVTLLDDSVQHFHVSVRAIGQHLYNQVIAKLQLLESDYFDLEYIN-KEGVSCWLDHLKQVVKQCTQRKEYIFQFGIKFYAPYPNMLEDEYTRYLFALQIKRDIYQGHLQCNINTTALLLAFIAQSEIGDFLEDEYDD-YTYLSSLRLTKQANEEFLMKVMECHRTLVGQSPSEADYNLLDTARKVESYGIKLHPARDHENLPLKLAVSHQGIVIHQNRIKINIFSWAKVRKLSFKRKRFYIKLHAEGYD----IVEFIFNSRNECKNFWKQCIEHHAFFRCQAVKQGSKRRSKVLSKGSSYRYTGRTQKQLQE--CVRETSYKRPQFERSLSMSRV 347          
The following BLAST results are available for this feature:
BLAST of Protein 4.1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EPB41L32.403e-10650.74erythrocyte membrane protein band 4.1 like 3 [Sour... [more]
EPB41L33.142e-10650.74erythrocyte membrane protein band 4.1 like 3 [Sour... [more]
EPB41L35.596e-10650.29erythrocyte membrane protein band 4.1 like 3 [Sour... [more]
EPB41L36.449e-10650.29erythrocyte membrane protein band 4.1 like 3 [Sour... [more]
EPB41L31.254e-10550.29erythrocyte membrane protein band 4.1 like 3 [Sour... [more]
back to top
BLAST of Protein 4.1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
frm-32.252e-5833.43FERM domain (Protein4.1-ezrin-radixin-moesin) fami... [more]
frm-39.484e-5633.61FERM domain (Protein4.1-ezrin-radixin-moesin) fami... [more]
frm-11.977e-5533.53FERM domain (Protein4.1-ezrin-radixin-moesin) fami... [more]
frm-11.977e-5533.53FERM domain (Protein4.1-ezrin-radixin-moesin) fami... [more]
ptp-14.352e-5534.09Tyrosine-protein phosphatase 1 [Source:UniProtKB/... [more]
back to top
BLAST of Protein 4.1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cora7.107e-10347.45gene:FBgn0010434 transcript:FBtr0301279[more]
cora8.532e-10347.45gene:FBgn0010434 transcript:FBtr0086506[more]
cora2.433e-10147.45gene:FBgn0010434 transcript:FBtr0086508[more]
cora5.985e-9847.45gene:FBgn0010434 transcript:FBtr0340468[more]
cora6.675e-9847.45gene:FBgn0010434 transcript:FBtr0340469[more]
back to top
BLAST of Protein 4.1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EPB41L24.672e-10447.66si:ch73-18b11.1 [Source:ZFIN;Acc:ZDB-GENE-070912-3... [more]
si:dkey-178k16.11.225e-10347.73si:dkey-178k16.1 [Source:ZFIN;Acc:ZDB-GENE-090312-... [more]
si:dkey-178k16.13.763e-10147.73si:dkey-178k16.1 [Source:ZFIN;Acc:ZDB-GENE-090312-... [more]
epb41l3a6.600e-10047.18erythrocyte membrane protein band 4.1-like 3a [Sou... [more]
epb41l3a6.600e-10047.18erythrocyte membrane protein band 4.1-like 3a [Sou... [more]
back to top
BLAST of Protein 4.1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dcx1.512e-10449.71doublecortin [Source:Xenbase;Acc:XB-GENE-992092][more]
dcx2.639e-10449.71doublecortin [Source:Xenbase;Acc:XB-GENE-992092][more]
dcx3.293e-10449.71doublecortin [Source:Xenbase;Acc:XB-GENE-992092][more]
dcx4.466e-10449.71doublecortin [Source:Xenbase;Acc:XB-GENE-992092][more]
dcx1.178e-10249.71doublecortin [Source:Xenbase;Acc:XB-GENE-992092][more]
back to top
BLAST of Protein 4.1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Epb41l34.747e-10750.29erythrocyte membrane protein band 4.1 like 3 [Sour... [more]
Epb41l38.309e-10750.29erythrocyte membrane protein band 4.1 like 3 [Sour... [more]
Epb41l32.200e-10650.29erythrocyte membrane protein band 4.1 like 3 [Sour... [more]
Epb41l33.452e-10650.29erythrocyte membrane protein band 4.1 like 3 [Sour... [more]
Epb41l34.782e-10650.29erythrocyte membrane protein band 4.1 like 3 [Sour... [more]
back to top
BLAST of Protein 4.1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9WV92|E41L3_MOUSE3.345e-10550.29Band 4.1-like protein 3 OS=Mus musculus OX=10090 G... [more]
sp|Q9Y2J2|E41L3_HUMAN7.308e-10450.29Band 4.1-like protein 3 OS=Homo sapiens OX=9606 GN... [more]
sp|Q9Z2H5|E41L1_MOUSE1.252e-10248.73Band 4.1-like protein 1 OS=Mus musculus OX=10090 G... [more]
sp|Q9WTP0|E41L1_RAT1.782e-10248.73Band 4.1-like protein 1 OS=Rattus norvegicus OX=10... [more]
sp|Q9H4G0|E41L1_HUMAN7.468e-10248.73Band 4.1-like protein 1 OS=Homo sapiens OX=9606 GN... [more]
back to top
BLAST of Protein 4.1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2M1153.937e-16061.32FERM domain-containing protein OS=Opisthorchis fel... [more]
A0A504YNY92.373e-15859.45Neuronal acetylcholine receptor subunit alpha-2 OS... [more]
A0A4E0RAY69.432e-15859.16Septate junction protein OS=Fasciola hepatica OX=6... [more]
A0A419PEF44.129e-15761.58Band 4.1-like protein 2 OS=Clonorchis sinensis OX=... [more]
A0A068WP302.098e-15255.92Protein 4.1 OS=Echinococcus granulosus OX=6210 GN=... [more]
back to top
BLAST of Protein 4.1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000039790.12.317e-10147.01pep primary_assembly:Astyanax_mexicanus-2.0:22:763... [more]
ENSAMXT00000046054.12.878e-10147.01pep primary_assembly:Astyanax_mexicanus-2.0:22:763... [more]
si:dkey-178k16.13.842e-10144.25band 4.1-like protein 1 [Source:NCBI gene;Acc:1030... [more]
si:dkey-178k16.15.827e-10144.25band 4.1-like protein 1 [Source:NCBI gene;Acc:1030... [more]
ENSAMXT00000003084.22.759e-10047.01pep primary_assembly:Astyanax_mexicanus-2.0:22:763... [more]
back to top
BLAST of Protein 4.1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EPB41L22.946e-7443.20erythrocyte membrane protein band 4.1 like 2 [Sour... [more]
ENSPMAT00000001312.12.536e-7238.16pep scaffold:Pmarinus_7.0:GL477231:34421:73675:-1 ... [more]
epb41l51.134e-6036.34erythrocyte membrane protein band 4.1 like 5 [Sour... [more]
epb41l51.200e-6035.28erythrocyte membrane protein band 4.1 like 5 [Sour... [more]
epb41l51.497e-6036.34erythrocyte membrane protein band 4.1 like 5 [Sour... [more]
back to top
BLAST of Protein 4.1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein 4.1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO361301.325e-7243.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO302241.685e-6836.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO448233.890e-6738.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO336261.909e-6136.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO343917.718e-6039.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein 4.1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch73-18b11.11.443e-10147.14erythrocyte membrane protein band 4.1 like 2 [Sour... [more]
si:ch73-18b11.13.527e-10147.14erythrocyte membrane protein band 4.1 like 2 [Sour... [more]
si:ch73-18b11.19.296e-10147.14erythrocyte membrane protein band 4.1 like 2 [Sour... [more]
si:ch73-18b11.19.682e-10147.14erythrocyte membrane protein band 4.1 like 2 [Sour... [more]
si:ch73-18b11.11.484e-10047.14erythrocyte membrane protein band 4.1 like 2 [Sour... [more]
back to top
BLAST of Protein 4.1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000029732.10.000e+0100.00SMESG000029732.1[more]
SMESG000062476.13.103e-7045.60SMESG000062476.1[more]
SMESG000019493.12.533e-6740.49SMESG000019493.1[more]
SMESG000038155.14.563e-6534.44SMESG000038155.1[more]
SMESG000038155.11.092e-6434.44SMESG000038155.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024358 ID=SMED30024358|Name=Protein 4.1|organism=Schmidtea mediterranea sexual|type=transcript|length=3544bp
TATATTGATTTCAAACAATAAGGAAAAACATATTTCGAATTTTTAGTAGT
GAAACGAAATGCATCAATATAATGAGGAATATGACAATGACGGAGTGAAT
CAAGAGTCTCAAAAGCGTGAGAAAAAGAAAAAACGCCACCGAAAGCCTAA
AGAAGAAGTTTATAATGATGATGAAATTAATATAAATTACAACAATCCTA
ATATGGCATATGAAGAGGCTCCACCTCCTCGAAAATCCGAGGAAGAAAAT
TTTGACCCATCTCAACCTCCTAAACGTAAACATCGTTCGAAAAATAAAAA
ACGAGATGAGGAATACATAGAAGAACCTAATTATCAATATAATGCTGATG
ATGGTTACGAAGATGGTCAAAAGTCACCGGAGCCTGATTACGAAAAACCT
ATTAGAAAACACAAAAAAGAACGGCGCAAAAAATCTAGAGAAACGGAGGA
TCCGCCTGAAGATCACTATTTAAATCTAAAAATTCAATCGCCGATTGAGA
GTAATAATAATAATAATAATTATCCGTTTGAAGATGCTAATGAATCAATT
CAACTTGATGAAGATGATGATCATTATGAAGATGAAGTTGATCATTCAGT
TGGCCAATCAGATCAAAATGAAACTCCAGTTGAACCTAAACCGAAAAAGA
AAAGCGGAGGATTTATGAATATTTTTGCTTCCTTTAAAAAGAAAAATAAA
TCAAAGAATACAGATAATAATAAGATCAACGGCAATCAGTGGCAATCCAA
TCCGGAAATATTTAATCCTGCCTATGACAGTCAGCCCGCAACTCTCGAAC
GCAAAAAGATAAGTAAATCAGCAAAGCACCTTTCATCGAATAAAGCACAT
ATCATTTTATTGGACGGCATGGAAGTGGAATTTGACGTTGATCAGAAAAT
GCTGGGCAAATATTTGTTCGACGAAGTCTGTTCGTATTTGGATTTAATAG
AGAAAGATTTCTTTGGAATGACTTATGTCAATTCTAAATTGCAGACTTGG
TTTTGGCTTGAGATGGACAAGAAAATCTCTAAGCAGTTATCAAGTGCAGA
CGATTGGGCTTTTAATTTCCAAGTGAAATTTTATCCACCAGAACCGGTTC
TCCTTCAGGAAGATATTACACGATATTTGTTGAGTCTGCAAGTTCGTCAA
GATGTTTTTACCGGGAAACTTCCTTGCTCGTGGATCACACAAGCTCTGCT
TGGATCATTTATGGTTCAGTCGGAACTTGGTGACTTTGACGAATTGGAAC
ACGAAGAAGGAATTGATTATCTGAGAGAATTCGAATTTGTTCTCAACCAA
AGTGATCAACTTCTGGAAAAGATTGCCGAGCTCCATAAAAAGCATATTGG
AATGTCTCCGGATAAGGCTGATGTCAAATATCTTGAAACTGCGAAACGAT
TGGAACAATATGGAGTTGATCTTCATCCCGCACGAGACAACGATGACGTG
GAGATTTTGATCGGAGTTTGTTACCAAGGTGTTTTGATTTACAGGGACAG
AATCCGAATTGGAAGATTTGCTTGGCCAAAGGTTCTTAGAATATCTTACA
AGAAAAATTACTTTTACCTAAAGATTCGATCAGATCGGTACGACGACTCC
GTTGCTATTGTTGGATTCAAACTCTTCAATCACAATCTTGCTAAGCGCTT
GTGGAAAAATGCTGTTGAACAGCACACATTTTTCCGAATGAAAGAACCGC
AAAATCAAAAACCAACCCAGAGATATATGGTATCAGGATCATCAACTTAT
GGTTACACAGGGAAAACTCTTCATCAATATCGAAGCATGAATATTGCACG
AAATGAGCCGCTTAAGTTTGATAGGGCACTGACAAAACGAAGAACTATTG
GATCAATGCCTGCAGGACTAGAAAAAGCTGGGATGCTATATAGCAGCATG
CATTCTTTGAATCGGTCTCATCCCAGAGACATGACACTTGGAAAAACAAA
AAGTATTGAGTATCTAAGTGCCAAACGTCCCGGATCTAATTTAGGGATAA
ATCAAGGTTCAACAAGCAACATAAATAACAATAATCGATTAGCACCTCCA
CAAAGCAAATATCCTCCATACGGGGGATCTGTGTCTTCTTTCAATGAAGA
TCGTCATATGTCATTCCAGAGCGGTAATAGTATAAATGCTGCGGATTCAT
ATACGGCAATAAATGATGATCAGGCGTCATTGCCTCCTATGCCCACTGTT
CAACTGTCAGAATATACTAAACCATACAAGAAACACAATTCAAAAACATC
TCGTTCAAATGACGTGCTATCCGATGATGGCATTAATCCACAATTGACAA
TTTCTAAGCCATCTAGAAAGCAAGCTAAACAAAAATCATATGAAGTGAAT
TCAGAGGACGATCAAAATCCACAACCTGAATATGCTAAAGTGCTCAAAAA
ACAACCATCTAAAACCAGTCGCACACCTGATGTACTTTCTGATGACGGGA
ATAATCCACAATTAGAGTTTAGCAAACCATTCAGAAAACAAAATTCTAAA
GCACCTCGTTCATTCGATGTTCCCTCAGATGATGGCATTGACCAACAGCC
TGAATATAGTAAACCAATGAAAAAGCGCAGTTCAAGAACTTCTCGTCCGA
ATGATGTTGTGCCTGATGAGGAAAGAAATCCTTCTCCTGAAATTTCTAAA
CCACTAAAAAAGCAACATTCAAAATCTCGCCGGCAAACAGAAGAACCTTC
AGATGAAGAAATTCCTCAGCCGATTTATGCAAAACCTCATAAGAAAAGGC
ATTCAAAAACAGTTCGACCGAATGAAGAATTATCGGATGACGGATTTGTT
CCTCCAACTGTCCAGGGAAAGGTCAATGCAAGACCGGAAATTATTTTACC
GCTGCCAGATCCACCAGTTGATACATCGCAATCTGAAGCCGCTGACTCTC
CTTCAAAGCTATCTAAGAAACGAGGAAGCCAAAAGCAAAGTGGCACTCCG
AATTCTAATCGACCGATGCCTCCAAATCACTTTAAACCGCCACCTCCTCC
TCCTGAGCCCATTGCTCCGGTACGATCCAACAGCAGCAGTGAGCGTTCCT
CTCCTATGGAGCATAATTTACCGCCTCCGCCTCCTCCAATCGTGGAATTG
CCTCAAGTCACAAAGCCGAAACCTCCTCCATTGAAACCAAAACCTGCACT
GAAACCTAAACCGAACATTGTTGTTAAGGATCAAATTGCTATCAAAAAGA
GTGCAGCAGCCCCCCGTTACAACGATGAAAGTAGTAACGATGACATGCTG
TAAATCAGTTTGTAAACTCGTATTGAAATTTGCTAATATTTACGGCTGTG
GCTTTTTACATTTTATTGTTCATTTTATATTGATTTATAATATATTTATA
AATCAGTAAATATATTATAAATGCGTGTGTGTGCGTGTGTAATGACAGCT
ATTAATCATCATGGCATATCATATATATATGTTTATTAGATATATATTCA
TTCCACATATCAATTTGATCCCCTCGGTTATTGATCGGTTCTGATTTTTG
ATCTGTTTAATTGGGAGTTTGATCCTGATTTTACTGTTTGATTT
back to top

protein sequence of SMED30024358-orf-1

>SMED30024358-orf-1 ID=SMED30024358-orf-1|Name=SMED30024358-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1065bp
MHQYNEEYDNDGVNQESQKREKKKKRHRKPKEEVYNDDEININYNNPNMA
YEEAPPPRKSEEENFDPSQPPKRKHRSKNKKRDEEYIEEPNYQYNADDGY
EDGQKSPEPDYEKPIRKHKKERRKKSRETEDPPEDHYLNLKIQSPIESNN
NNNNYPFEDANESIQLDEDDDHYEDEVDHSVGQSDQNETPVEPKPKKKSG
GFMNIFASFKKKNKSKNTDNNKINGNQWQSNPEIFNPAYDSQPATLERKK
ISKSAKHLSSNKAHIILLDGMEVEFDVDQKMLGKYLFDEVCSYLDLIEKD
FFGMTYVNSKLQTWFWLEMDKKISKQLSSADDWAFNFQVKFYPPEPVLLQ
EDITRYLLSLQVRQDVFTGKLPCSWITQALLGSFMVQSELGDFDELEHEE
GIDYLREFEFVLNQSDQLLEKIAELHKKHIGMSPDKADVKYLETAKRLEQ
YGVDLHPARDNDDVEILIGVCYQGVLIYRDRIRIGRFAWPKVLRISYKKN
YFYLKIRSDRYDDSVAIVGFKLFNHNLAKRLWKNAVEQHTFFRMKEPQNQ
KPTQRYMVSGSSTYGYTGKTLHQYRSMNIARNEPLKFDRALTKRRTIGSM
PAGLEKAGMLYSSMHSLNRSHPRDMTLGKTKSIEYLSAKRPGSNLGINQG
STSNINNNNRLAPPQSKYPPYGGSVSSFNEDRHMSFQSGNSINAADSYTA
INDDQASLPPMPTVQLSEYTKPYKKHNSKTSRSNDVLSDDGINPQLTISK
PSRKQAKQKSYEVNSEDDQNPQPEYAKVLKKQPSKTSRTPDVLSDDGNNP
QLEFSKPFRKQNSKAPRSFDVPSDDGIDQQPEYSKPMKKRSSRTSRPNDV
VPDEERNPSPEISKPLKKQHSKSRRQTEEPSDEEIPQPIYAKPHKKRHSK
TVRPNEELSDDGFVPPTVQGKVNARPEIILPLPDPPVDTSQSEAADSPSK
LSKKRGSQKQSGTPNSNRPMPPNHFKPPPPPPEPIAPVRSNSSSERSSPM
EHNLPPPPPPIVELPQVTKPKPPPLKPKPALKPKPNIVVKDQIAIKKSAA
APRYNDESSNDDML*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000208testis
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR035963FERM_2
IPR019749Band_41_domain
IPR000798Ez/rad/moesin-like
IPR018980FERM_PH-like_C
IPR018979FERM_N
IPR019748FERM_central
IPR011993PH-like_dom_sf
IPR014352FERM/acyl-CoA-bd_prot_sf
IPR019747FERM_CS
IPR000299FERM_domain
IPR029071Ubiquitin-like_domsf
Vocabulary: molecular function
TermDefinition
GO:0008092cytoskeletal protein binding
Vocabulary: cellular component
TermDefinition
GO:0019898extrinsic component of membrane
GO:0005737cytoplasm
GO:0005856cytoskeleton
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000798Ezrin/radixin/moesin-likePRINTSPR00661ERMFAMILYcoord: 326..345
score: 31.11
coord: 274..293
score: 40.0
coord: 369..390
score: 32.83
coord: 459..479
score: 26.46
IPR019749Band 4.1 domainPRINTSPR00935BAND41coord: 373..393
score: 44.25
coord: 360..373
score: 43.01
coord: 436..452
score: 42.89
coord: 294..306
score: 40.87
IPR019749Band 4.1 domainSMARTSM00295B41_5coord: 257..456
e-value: 1.5E-50
score: 183.9
IPR018980FERM, C-terminal PH-like domainSMARTSM01196FERM_C_3coord: 460..550
e-value: 3.0E-29
score: 113.2
IPR018980FERM, C-terminal PH-like domainPFAMPF09380FERM_Ccoord: 460..549
e-value: 5.5E-20
score: 71.6
NoneNo IPR availableGENE3DG3DSA:3.10.20.90coord: 259..342
e-value: 2.8E-23
score: 83.8
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..199
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 734..754
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 954..969
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 142..160
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 101..116
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 639..668
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 782..818
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..19
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 719..1064
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 55..72
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1001..1031
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 970..987
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 642..668
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 831..882
NoneNo IPR availablePANTHERPTHR232804.1 G PROTEINcoord: 222..985
NoneNo IPR availableCDDcd13184FERM_C_4_1_familycoord: 451..544
e-value: 4.7602E-47
score: 160.953
NoneNo IPR availableCDDcd17098FERM_F1_FARP1_likecoord: 264..346
e-value: 3.97348E-24
score: 94.9727
NoneNo IPR availableSUPERFAMILYSSF50729PH domain-likecoord: 449..575
IPR019748FERM central domainPFAMPF00373FERM_Mcoord: 349..456
e-value: 5.5E-15
score: 55.8
IPR019748FERM central domainCDDcd14473FERM_B-lobecoord: 354..448
e-value: 7.74872E-26
score: 100.399
IPR011993PH-like domain superfamilyGENE3DG3DSA:2.30.29.30coord: 451..545
e-value: 4.4E-32
score: 112.3
IPR018979FERM, N-terminalPFAMPF09379FERM_Ncoord: 265..328
e-value: 8.5E-14
score: 51.2
IPR014352FERM/acyl-CoA-binding protein superfamilyGENE3DG3DSA:1.20.80.10coord: 343..450
e-value: 1.4E-34
score: 120.7
IPR019747FERM conserved sitePROSITEPS00660FERM_1coord: 316..345
IPR000299FERM domainPROSITEPS50057FERM_3coord: 261..546
score: 75.541
IPR029071Ubiquitin-like domain superfamilySUPERFAMILYSSF54236Ubiquitin-likecoord: 264..344
IPR035963FERM superfamily, second domainSUPERFAMILYSSF47031Second domain of FERMcoord: 345..451