Tissue factor pathway inhibitor 2

Overview
NameTissue factor pathway inhibitor 2
Smed IDSMED30024357
Length (bp)1977
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tissue factor pathway inhibitor 2 (SMED30024357) t-SNE clustered cells

Violin plots show distribution of expression levels for Tissue factor pathway inhibitor 2 (SMED30024357) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tissue factor pathway inhibitor 2 (SMED30024357) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tissue factor pathway inhibitor 2 (SMED30024357) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024357

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
central nervous systemSMED30024357SMESG000009888.1 SmedASXL_019161SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
pigment cellSMED30024357SMESG000009888.1 SmedASXL_019161SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
parenchymal cellSMED30024357SMESG000009888.1 dd_Smed_v4_2293_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
pigment cellSMED30024357SMESG000009888.1 dd_Smed_v6_2293_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
glial cellSMED30024357SMESG000009888.1 dd_Smed_v6_2293_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tissue factor pathway inhibitor 2 vs. Ensembl Celegans
Match: mig-6 (Papilin [Source:UniProtKB/Swiss-Prot;Acc:O76840])

HSP 1 Score: 55.8398 bits (133), Expect = 9.394e-8
Identity = 55/191 (28.80%), Postives = 79/191 (41.36%), Query Frame = 1
Query: 1318 SFDKVCNLDKDEGSGLDRYSMWYFNKETRKCEWFTYLXXXXXXXRFYYRANCESSCIERVTNLCARSDIVNCMESWLHCKMESDSECQENALMDRLDV-----QLVCPPKQPICVNVPREIRKSPVYLTHRSLIPSDCKLRKDQGHCKTDSDXXXXXXXXXXXNDCLGFLYSKCGGNLNRFPSKEDCMNRC 1875
            S + +C   +D G        W++N  +++CE FTY G GGN NRF  +  CE  C                   ++H    S +  ++     +         +V PP+Q            SPV +   S     C L  DQG CK   D    +YY +    C+ F Y+ CGGN NRF SK+ C + C
Sbjct: 1266 SMEDICRSRQDAGPCETYSDQWFYNAFSQECETFTYGGCGGNLNRFRSKDECEQRCF------------------FVHGAQPSAARQEQAQPAAQPAQPAQPSNIVSPPQQ----------SASPVVVPSNSKQRDACHLNVDQGRCKGAFD---SWYYEVATGSCVTFKYTGCGGNANRFASKDQCESLC 1425          
BLAST of Tissue factor pathway inhibitor 2 vs. Ensembl Celegans
Match: mig-6 (Papilin [Source:UniProtKB/Swiss-Prot;Acc:O76840])

HSP 1 Score: 55.8398 bits (133), Expect = 9.394e-8
Identity = 55/191 (28.80%), Postives = 79/191 (41.36%), Query Frame = 1
Query: 1318 SFDKVCNLDKDEGSGLDRYSMWYFNKETRKCEWFTYLXXXXXXXRFYYRANCESSCIERVTNLCARSDIVNCMESWLHCKMESDSECQENALMDRLDV-----QLVCPPKQPICVNVPREIRKSPVYLTHRSLIPSDCKLRKDQGHCKTDSDXXXXXXXXXXXNDCLGFLYSKCGGNLNRFPSKEDCMNRC 1875
            S + +C   +D G        W++N  +++CE FTY G GGN NRF  +  CE  C                   ++H    S +  ++     +         +V PP+Q            SPV +   S     C L  DQG CK   D    +YY +    C+ F Y+ CGGN NRF SK+ C + C
Sbjct: 1266 SMEDICRSRQDAGPCETYSDQWFYNAFSQECETFTYGGCGGNLNRFRSKDECEQRCF------------------FVHGAQPSAARQEQAQPAAQPAQPAQPSNIVSPPQQ----------SASPVVVPSNSKQRDACHLNVDQGRCKGAFD---SWYYEVATGSCVTFKYTGCGGNANRFASKDQCESLC 1425          
BLAST of Tissue factor pathway inhibitor 2 vs. Ensembl Celegans
Match: mig-6 (Papilin [Source:UniProtKB/Swiss-Prot;Acc:O76840])

HSP 1 Score: 55.8398 bits (133), Expect = 9.394e-8
Identity = 55/191 (28.80%), Postives = 79/191 (41.36%), Query Frame = 1
Query: 1318 SFDKVCNLDKDEGSGLDRYSMWYFNKETRKCEWFTYLXXXXXXXRFYYRANCESSCIERVTNLCARSDIVNCMESWLHCKMESDSECQENALMDRLDV-----QLVCPPKQPICVNVPREIRKSPVYLTHRSLIPSDCKLRKDQGHCKTDSDXXXXXXXXXXXNDCLGFLYSKCGGNLNRFPSKEDCMNRC 1875
            S + +C   +D G        W++N  +++CE FTY G GGN NRF  +  CE  C                   ++H    S +  ++     +         +V PP+Q            SPV +   S     C L  DQG CK   D    +YY +    C+ F Y+ CGGN NRF SK+ C + C
Sbjct: 1266 SMEDICRSRQDAGPCETYSDQWFYNAFSQECETFTYGGCGGNLNRFRSKDECEQRCF------------------FVHGAQPSAARQEQAQPAAQPAQPAQPSNIVSPPQQ----------SASPVVVPSNSKQRDACHLNVDQGRCKGAFD---SWYYEVATGSCVTFKYTGCGGNANRFASKDQCESLC 1425          
BLAST of Tissue factor pathway inhibitor 2 vs. Ensembl Celegans
Match: mig-6 (Papilin [Source:UniProtKB/Swiss-Prot;Acc:O76840])

HSP 1 Score: 53.9138 bits (128), Expect = 4.618e-7
Identity = 55/191 (28.80%), Postives = 79/191 (41.36%), Query Frame = 1
Query: 1318 SFDKVCNLDKDEGSGLDRYSMWYFNKETRKCEWFTYLXXXXXXXRFYYRANCESSCIERVTNLCARSDIVNCMESWLHCKMESDSECQENALMDRLDV-----QLVCPPKQPICVNVPREIRKSPVYLTHRSLIPSDCKLRKDQGHCKTDSDXXXXXXXXXXXNDCLGFLYSKCGGNLNRFPSKEDCMNRC 1875
            S + +C   +D G        W++N  +++CE FTY G GGN NRF  +  CE  C                   ++H    S +  ++     +         +V PP+Q            SPV +   S     C L  DQG CK   D    +YY +    C+ F Y+ CGGN NRF SK+ C + C
Sbjct: 1266 SMEDICRSRQDAGPCETYSDQWFYNAFSQECETFTYGGCGGNLNRFRSKDECEQRCF------------------FVHGAQPSAARQEQAQPAAQPAQPAQPSNIVSPPQQ----------SASPVVVPSNSKQRDACHLNVDQGRCKGAFD---SWYYEVATGSCVTFKYTGCGGNANRFASKDQCESLC 1425          
BLAST of Tissue factor pathway inhibitor 2 vs. Ensembl Celegans
Match: mig-6 (Papilin [Source:UniProtKB/Swiss-Prot;Acc:O76840])

HSP 1 Score: 53.9138 bits (128), Expect = 4.618e-7
Identity = 55/191 (28.80%), Postives = 79/191 (41.36%), Query Frame = 1
Query: 1318 SFDKVCNLDKDEGSGLDRYSMWYFNKETRKCEWFTYLXXXXXXXRFYYRANCESSCIERVTNLCARSDIVNCMESWLHCKMESDSECQENALMDRLDV-----QLVCPPKQPICVNVPREIRKSPVYLTHRSLIPSDCKLRKDQGHCKTDSDXXXXXXXXXXXNDCLGFLYSKCGGNLNRFPSKEDCMNRC 1875
            S + +C   +D G        W++N  +++CE FTY G GGN NRF  +  CE  C                   ++H    S +  ++     +         +V PP+Q            SPV +   S     C L  DQG CK   D    +YY +    C+ F Y+ CGGN NRF SK+ C + C
Sbjct: 1266 SMEDICRSRQDAGPCETYSDQWFYNAFSQECETFTYGGCGGNLNRFRSKDECEQRCF------------------FVHGAQPSAARQEQAQPAAQPAQPAQPSNIVSPPQQ----------SASPVVVPSNSKQRDACHLNVDQGRCKGAFD---SWYYEVATGSCVTFKYTGCGGNANRFASKDQCESLC 1425          
BLAST of Tissue factor pathway inhibitor 2 vs. Ensembl Fly
Match: Ppn (gene:FBgn0003137 transcript:FBtr0301839)

HSP 1 Score: 50.0618 bits (118), Expect = 7.948e-6
Identity = 55/195 (28.21%), Postives = 76/195 (38.97%), Query Frame = 1
Query: 1330 VCNLDKDEGSGLDRYSMWYFNKETRKCEWFTYLXXXXXXXRFYYRANCESSCIE-RVTNLCARSDIVNCMESWL----------HCKMESDSECQE--NALMDRLDVQLVCPPKQPICVNVPREIRKSPVYLTHRSLIPSDCKLRKDQGHCKTDSDXXXXXXXXXXXNDCLGFLYSKCGGNLNRFPSKEDCMNRC 1875
            VC    + G   +R + W+++ E   C  FTY G GGNGNRF  R  CE  C E +  ++C           W            C+  +   C    N   D  + Q VC   +   V   +EI                C L    G C   S     +YY  +  +C+ F+Y+ C GN N F S E C N+C
Sbjct: 2136 VCAEPPEAGECDNRTTAWFYDSENMACTAFTYTGCGGNGNRFETRDQCERQCGEFKGVDVCNEPVTTGPCTDWQTKYYFNTASQACEPFTYGGCDGTGNRFSDLFECQTVCLAGREPRVGSAKEI----------------CLLPVATGRCNGPSVHERRWYYDDEAGNCVSFIYAGCSGNQNNFRSFEACTNQC 2314          
BLAST of Tissue factor pathway inhibitor 2 vs. Ensembl Fly
Match: Ppn (gene:FBgn0003137 transcript:FBtr0301837)

HSP 1 Score: 50.0618 bits (118), Expect = 8.591e-6
Identity = 55/195 (28.21%), Postives = 76/195 (38.97%), Query Frame = 1
Query: 1330 VCNLDKDEGSGLDRYSMWYFNKETRKCEWFTYLXXXXXXXRFYYRANCESSCIE-RVTNLCARSDIVNCMESWL----------HCKMESDSECQE--NALMDRLDVQLVCPPKQPICVNVPREIRKSPVYLTHRSLIPSDCKLRKDQGHCKTDSDXXXXXXXXXXXNDCLGFLYSKCGGNLNRFPSKEDCMNRC 1875
            VC    + G   +R + W+++ E   C  FTY G GGNGNRF  R  CE  C E +  ++C           W            C+  +   C    N   D  + Q VC   +   V   +EI                C L    G C   S     +YY  +  +C+ F+Y+ C GN N F S E C N+C
Sbjct: 2193 VCAEPPEAGECDNRTTAWFYDSENMACTAFTYTGCGGNGNRFETRDQCERQCGEFKGVDVCNEPVTTGPCTDWQTKYYFNTASQACEPFTYGGCDGTGNRFSDLFECQTVCLAGREPRVGSAKEI----------------CLLPVATGRCNGPSVHERRWYYDDEAGNCVSFIYAGCSGNQNNFRSFEACTNQC 2371          
BLAST of Tissue factor pathway inhibitor 2 vs. Ensembl Zebrafish
Match: wu:fb59d01 (wu:fb59d01 [Source:ZFIN;Acc:ZDB-GENE-030131-1098])

HSP 1 Score: 50.8322 bits (120), Expect = 1.044e-6
Identity = 27/74 (36.49%), Postives = 42/74 (56.76%), Query Frame = 1
Query: 1309 DESSFDKVCNLDKDEGSGLDRYSMWYFNKETRKCEWFTYLXXXXXXXRFYYRANCESSCIERVTNLCARSDIVN 1530
            DE+S   +C+++ DEG+    + M+Y+N E + C  F Y G  GN NRF  R  C+ +C+ R   L   +D+ N
Sbjct:   88 DETS---ICSMEMDEGTCFALFPMYYYNAEEKICRMFIYRGCRGNANRFESREECQQTCLARSGRLMGAADLPN 158          
BLAST of Tissue factor pathway inhibitor 2 vs. Ensembl Xenopus
Match: itch (itchy E3 ubiquitin protein ligase [Source:Xenbase;Acc:XB-GENE-976485])

HSP 1 Score: 62.003 bits (149), Expect = 3.263e-9
Identity = 59/227 (25.99%), Postives = 105/227 (46.26%), Query Frame = 1
Query:  847 YGERKATTIESEYLSKKSTTKRTYNSILDLPMSISIVYQESN--------SNLKPTKKALRNYSSTTKMPTLMPIIIAKLSTLSSESINQKIILKSKTSEFKT-----ENKDPSKMETVINKPSKTLQKSTVNKSKDQIKEITTQTSFTTVKMTTIPAPWKTRFGNNDESSFDKVCNLDKDEGSGLDRYSMWYFNKETRKCEWFTYLXXXXXXXRFYYRANCESSCI 1488
            + ER  TT++ +  S +     T  +  + P+  +I+ Q++         SN+      L N++S     +  P+    LSTL      Q + LK   +E +      EN+   +  T + + ++TL++ST      +    T++   + V + +      +   N+ +++  +VCNL K+EG+  D    WY++ ET+ C  F Y G GGN NRF  +  CE  CI
Sbjct: 2845 HSERVTTTVKPDETSSQHPKVVTILTSTETPIEPTILQQDAEMPTAELQVSNVSENSATL-NWTSPVSQKS--PLYDPTLSTLEE----QVVTLKQNATEAEKLNEGLENEVKYQQLTTVIEHNRTLEQST----SQETFTTTSKAQLSPVALASAKLVVNSETANSPQTTGPEVCNLQKEEGTCRDFVLKWYYDPETKSCARFWYGGCGGNENRFSTQKECEKICI 3060          
BLAST of Tissue factor pathway inhibitor 2 vs. Ensembl Xenopus
Match: itch (itchy E3 ubiquitin protein ligase [Source:Xenbase;Acc:XB-GENE-976485])

HSP 1 Score: 58.5362 bits (140), Expect = 3.816e-8
Identity = 67/244 (27.46%), Postives = 107/244 (43.85%), Query Frame = 1
Query:  847 YGERKATTIESEYLSKKSTTKRTYNSILDLPMSISIVYQESN--------SNLKPTKKALRNYSSTTKMPTLMPIIIAKLSTLSSESINQKIILKSKTSEFKT-----ENKDPSKMETVINKPSKTLQKST-----VNKSKDQIKEI------------TTQTSFTTVKMTTIPAPWKTRFGNNDESSFDKVCNLDKDEGSGLDRYSMWYFNKETRKCEWFTYLXXXXXXXRFYYRANCESSCI 1488
            + ER  TT++ +  S +     T  +  + P+  +I+ Q++         SN+      L N++S     +  P+    LSTL      Q + LK   +E +      EN+   +  T + + ++TL++ST        SK Q+  +            T  +  TTV    +PAP        +  S  +VCNL K+EG+  D    WY++ ET+ C  F Y G GGN NRF  +  CE  CI
Sbjct: 2845 HSERVTTTVKPDETSSQHPKVVTILTSTETPIEPTILQQDAEMPTAELQVSNVSENSATL-NWTSPVSQKS--PLYDPTLSTLEE----QVVTLKQNATEAEKLNEGLENEVKYQQLTTVIEHNRTLEQSTSQETFTTTSKAQLSPVALASAKLVVNSETANSPQTTVVEKALPAP----VLEVNTISGPEVCNLQKEEGTCRDFVLKWYYDPETKSCARFWYGGCGGNENRFSTQKECEKICI 3077          
BLAST of Tissue factor pathway inhibitor 2 vs. Ensembl Xenopus
Match: itch (itchy E3 ubiquitin protein ligase [Source:Xenbase;Acc:XB-GENE-976485])

HSP 1 Score: 58.5362 bits (140), Expect = 3.926e-8
Identity = 67/244 (27.46%), Postives = 107/244 (43.85%), Query Frame = 1
Query:  847 YGERKATTIESEYLSKKSTTKRTYNSILDLPMSISIVYQESN--------SNLKPTKKALRNYSSTTKMPTLMPIIIAKLSTLSSESINQKIILKSKTSEFKT-----ENKDPSKMETVINKPSKTLQKST-----VNKSKDQIKEI------------TTQTSFTTVKMTTIPAPWKTRFGNNDESSFDKVCNLDKDEGSGLDRYSMWYFNKETRKCEWFTYLXXXXXXXRFYYRANCESSCI 1488
            + ER  TT++ +  S +     T  +  + P+  +I+ Q++         SN+      L N++S     +  P+    LSTL      Q + LK   +E +      EN+   +  T + + ++TL++ST        SK Q+  +            T  +  TTV    +PAP        +  S  +VCNL K+EG+  D    WY++ ET+ C  F Y G GGN NRF  +  CE  CI
Sbjct: 2648 HSERVTTTVKPDETSSQHPKVVTILTSTETPIEPTILQQDAEMPTAELQVSNVSENSATL-NWTSPVSQKS--PLYDPTLSTLEE----QVVTLKQNATEAEKLNEGLENEVKYQQLTTVIEHNRTLEQSTSQETFTTTSKAQLSPVALASAKLVVNSETANSPQTTVVEKALPAP----VLEVNTISGPEVCNLQKEEGTCRDFVLKWYYDPETKSCARFWYGGCGGNENRFSTQKECEKICI 2880          
BLAST of Tissue factor pathway inhibitor 2 vs. UniProt/SwissProt
Match: sp|P0DJ77|VKT5_CYRSC (Kunitz-type kappaPI-theraphotoxin-Hs1a OS=Cyriopagopus schmidti OX=29017 PE=2 SV=1)

HSP 1 Score: 48.9062 bits (115), Expect = 4.530e-6
Identity = 22/55 (40.00%), Postives = 30/55 (54.55%), Query Frame = 1
Query: 1714 CKLRKDQGHCKTDSDXXXXXXXXXXXNDCLGFLYSKCGGNLNRFPSKEDCMNRCA 1878
            C+L  D+G CK   +       +     C  F+Y  CGGN N+FP++E CM RCA
Sbjct:   37 CRLPSDRGRCKASFERWYFNGRT-----CAKFIYGGCGGNGNKFPTQEACMKRCA 86          
BLAST of Tissue factor pathway inhibitor 2 vs. UniProt/SwissProt
Match: sp|P68425|VKT1A_CYRSC (Kunitz-type kappaPI-theraphotoxin-Hs1a OS=Cyriopagopus schmidti OX=29017 PE=1 SV=2)

HSP 1 Score: 48.9062 bits (115), Expect = 4.530e-6
Identity = 22/55 (40.00%), Postives = 30/55 (54.55%), Query Frame = 1
Query: 1714 CKLRKDQGHCKTDSDXXXXXXXXXXXNDCLGFLYSKCGGNLNRFPSKEDCMNRCA 1878
            C+L  D+G CK   +       +     C  F+Y  CGGN N+FP++E CM RCA
Sbjct:   37 CRLPSDRGRCKASFERWYFNGRT-----CAKFIYGGCGGNGNKFPTQEACMKRCA 86          
BLAST of Tissue factor pathway inhibitor 2 vs. UniProt/SwissProt
Match: sp|O76840|PPN1_CAEEL (Papilin OS=Caenorhabditis elegans OX=6239 GN=mig-6 PE=1 SV=1)

HSP 1 Score: 53.9138 bits (128), Expect = 5.874e-6
Identity = 55/191 (28.80%), Postives = 79/191 (41.36%), Query Frame = 1
Query: 1318 SFDKVCNLDKDEGSGLDRYSMWYFNKETRKCEWFTYLXXXXXXXRFYYRANCESSCIERVTNLCARSDIVNCMESWLHCKMESDSECQENALMDRLDV-----QLVCPPKQPICVNVPREIRKSPVYLTHRSLIPSDCKLRKDQGHCKTDSDXXXXXXXXXXXNDCLGFLYSKCGGNLNRFPSKEDCMNRC 1875
            S + +C   +D G        W++N  +++CE FTY G GGN NRF  +  CE  C                   ++H    S +  ++     +         +V PP+Q            SPV +   S     C L  DQG CK   D    +YY +    C+ F Y+ CGGN NRF SK+ C + C
Sbjct: 1266 SMEDICRSRQDAGPCETYSDQWFYNAFSQECETFTYGGCGGNLNRFRSKDECEQRCF------------------FVHGAQPSAARQEQAQPAAQPAQPAQPSNIVSPPQQ----------SASPVVVPSNSKQRDACHLNVDQGRCKGAFD---SWYYEVATGSCVTFKYTGCGGNANRFASKDQCESLC 1425          
BLAST of Tissue factor pathway inhibitor 2 vs. UniProt/SwissProt
Match: sp|P0DJ82|VKT27_CYRSC (Kunitz-type kappaPI-theraphotoxin-Hs1c OS=Cyriopagopus schmidti OX=29017 PE=2 SV=1)

HSP 1 Score: 47.7506 bits (112), Expect = 9.065e-6
Identity = 22/55 (40.00%), Postives = 30/55 (54.55%), Query Frame = 1
Query: 1714 CKLRKDQGHCKTDSDXXXXXXXXXXXNDCLGFLYSKCGGNLNRFPSKEDCMNRCA 1878
            C+L  D+G CK   +       +     C  F+Y  CGGN N+FP++E CM RCA
Sbjct:   37 CRLPSDRGRCKASFECWYFNGRT-----CAKFIYGGCGGNGNKFPTQEACMKRCA 86          
BLAST of Tissue factor pathway inhibitor 2 vs. TrEMBL
Match: A0A4E0RJ48 (Putative kunitz-type protease inhibitor OS=Fasciola hepatica OX=6192 GN=D915_001673 PE=4 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 8.173e-30
Identity = 81/201 (40.30%), Postives = 107/201 (53.23%), Query Frame = 1
Query: 1276 PAPWKTRFGNNDESSFDKVCNLDKDEGSGLDRYSMWYFNKETRKCEWFTYLXXXXXXXRFYYRANCESSCIERVTNLCARSDIVNCMESWLHCKMESDSECQENALMDRLDVQLVCPPKQPICVNVPREIRKSPVYLTHRSLIPSDCKLRKDQGHCKTDSDXXXXXXXXXXXNDCLGFLYSKCGGNLNRFPSKEDCMNRCA 1878
            PAPW  R  N   S   + C+   + G G D  S WYF+ +   C WF Y G GGN NRFY R  CES CI  V NLC   D V C     HC +  D  C++   M   D Q+ CPP QP+C++  R  R +P        IP +C   KD G C+   + +++++Y  + NDC+ F Y  CGGN NRF +K DCM+ C+
Sbjct:  294 PAPWAYRDANRFGSPRHQACSQPLNRGVGPDEVSSWYFDTKLHVCRWFGYRGYGGNANRFYSRTACESLCIHDVENLC---DTVKCSWPGTHCSLVGDQTCKQTEEMYGRDWQIRCPPDQPVCLSR-RGTRIAPD--IDFKDIPRECFQSKDPGTCER-KNPAVMFHYDRERNDCMTFYYHNCGGNDNRFETKSDCMSHCS 487          
BLAST of Tissue factor pathway inhibitor 2 vs. TrEMBL
Match: A0A183A7E1 (Uncharacterized protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS2876 PE=4 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 2.404e-25
Identity = 77/200 (38.50%), Postives = 101/200 (50.50%), Query Frame = 1
Query: 1279 APWKTRFGNNDESSFDKVCNLDKDEGSGLDRYSMWYFNKETRKCEWFTYLXXXXXXXRFYYRANCESSCIERVTNLCARSDIVNCMESWLHCKMESDSECQENALMDRLDVQLVCPPKQPICVNVPREIRKSPVYLTHRSLIPSDCKLRKDQGHCKTDSDXXXXXXXXXXXNDCLGFLYSKCGGNLNRFPSKEDCMNRCA 1878
            APW  R            C+   + G G D  S WYF+ +   C WF Y G GGN NRFY R  CES CI  V NLC   + V C     HC +  D  C+    M   D  L CPP QP+C++  R  R +P        IP +C   KD G C+   + +++++Y  + NDC+ F Y  CGGN NRF +K DCM+ C+
Sbjct:  273 APWAYRDVYRFGPPRHPACSQPLNRGVGPDEVSSWYFDTQLNVCRWFGYRGYGGNSNRFYSRTACESLCIRDVENLC---ETVKCSWHGTHCSLVGDQACKHAEEMYGRDWSLRCPPDQPVCLSR-RGTRIAPD--IDFKNIPHECFQPKDPGSCER-KNPAVMFHYDRERNDCMTFYYHNCGGNDNRFETKSDCMSHCS 465          
BLAST of Tissue factor pathway inhibitor 2 vs. TrEMBL
Match: A0A074ZTJ3 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_06118 PE=4 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 4.654e-25
Identity = 73/201 (36.32%), Postives = 99/201 (49.25%), Query Frame = 1
Query: 1276 PAPWKTRFGNNDESSFDKVCNLDKDEGSGLDRYSMWYFNKETRKCEWFTYLXXXXXXXRFYYRANCESSCIERVTNLCARSDIVNCMESWLHCKMESDSECQENALMDRLDVQLVCPPKQPICVNVPREIRKSPVYLTHRSLIPSDCKLRKDQGHCKTDSDXXXXXXXXXXXNDCLGFLYSKCGGNLNRFPSKEDCMNRCA 1878
            P+PW  R  +       + C L  D G+G D  S WY+     +C WF Y G+GGN NRFY R  CES CI  + NLC   +   C      C M  D  C+EN      D +L C P QP+CVN+            +   +P +C+   D G C+   + ++ +YY  + N C+ F Y  CGGN NRF +K DCM  C+
Sbjct:  342 PSPWTVRDVHRLGQPRHEACMLPVDRGAGPDEISAWYYEPNEYRCRWFGYRGHGGNANRFYSRTACESYCIRDLENLC---ETATCHWPGTRCVMVGDDFCKENERRHGRDWRLKCTPDQPVCVNI------------NFQPLPHECRQTMDGGSCQR-KNPAVNFYYDRERNTCMTFYYHGCGGNDNRFETKSDCMTHCS 526          
BLAST of Tissue factor pathway inhibitor 2 vs. TrEMBL
Match: A0A5J4NZU2 (Uncharacterized protein OS=Paragonimus westermani OX=34504 GN=DEA37_0002287 PE=4 SV=1)

HSP 1 Score: 119.398 bits (298), Expect = 5.596e-25
Identity = 72/201 (35.82%), Postives = 106/201 (52.74%), Query Frame = 1
Query: 1276 PAPWKTRFGNNDESSFDKVCNLDKDEGSGLDRYSMWYFNKETRKCEWFTYLXXXXXXXRFYYRANCESSCIERVTNLCARSDIVNCMESWLHCKMESDSECQENALMDRLDVQLVCPPKQPICVNVPREIRKSPVYLTHRSLIPSDCKLRKDQGHCKTDSDXXXXXXXXXXXNDCLGFLYSKCGGNLNRFPSKEDCMNRCA 1878
            P+PW  R            C +  D G G D  S WY++ +  +C WF Y G+ GN NRFY RA CE+ CI  + NLC   ++VNC     HC +  D  C++       D +  CPP  P+C++  R  R +P  ++ ++L P +C   K  G C+   + S+ +YY  + N C+ F +  CGGN NRF +K DCM+ C+
Sbjct:  248 PSPWPLRDVQRLGEPRQSACTMPLDRGVGPDEISSWYYDNQEHRCRWFDYRGHRGNANRFYSRAACEAYCIRDLQNLC---EVVNCSWPGTHCSLMPDQLCKDMEHRHGRDWRQKCPPDHPVCLSR-RNTRLAPD-VSFQTL-PPECLQHKQNGSCQK-KNPSVNFYYDRERNTCMTFYFHNCGGNDNRFETKSDCMSHCS 441          
BLAST of Tissue factor pathway inhibitor 2 vs. TrEMBL
Match: A0A4S2M372 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_004277 PE=4 SV=1)

HSP 1 Score: 114.39 bits (285), Expect = 1.580e-24
Identity = 74/201 (36.82%), Postives = 102/201 (50.75%), Query Frame = 1
Query: 1276 PAPWKTRFGNNDESSFDKVCNLDKDEGSGLDRYSMWYFNKETRKCEWFTYLXXXXXXXRFYYRANCESSCIERVTNLCARSDIVNCMESWLHCKMESDSECQENALMDRLDVQLVCPPKQPICVNVPREIRKSPVYLTHRSLIPSDCKLRKDQGHCKTDSDXXXXXXXXXXXNDCLGFLYSKCGGNLNRFPSKEDCMNRCA 1878
            P+PW  R  +       + C L  D G+G D  S WY+     +C WF Y G+GGN NRFY R  CES CI  + NLC   +   C      C M  D  C+EN      D +L C P QP+CV+  +  R +P    +   +P +C+   D G C+   + ++ +YY  + N C+ F Y  CGGN NRF +K DCM  C+
Sbjct:   84 PSPWTVRDVHRLGQPRREACMLSVDRGAGPDEISAWYYEPNEYRCRWFGYRGHGGNANRFYSRTACESYCIRDLENLC---ETATCHWPGTKCVMVGDDFCKENERRHGRDWRLKCTPDQPVCVSR-KNTRMAPD--INFQPLPHECRQAMDGGSCQR-KNPAVNFYYDRERNTCMTFYYHGCGGNDNRFETKSDCMTHCS 277          
BLAST of Tissue factor pathway inhibitor 2 vs. Ensembl Cavefish
Match: ENSAMXT00000051114.1 (pep primary_assembly:Astyanax_mexicanus-2.0:11:5183832:5196079:-1 gene:ENSAMXG00000033686.1 transcript:ENSAMXT00000051114.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.1358 bits (113), Expect = 7.289e-6
Identity = 54/181 (29.83%), Postives = 81/181 (44.75%), Query Frame = 1
Query: 1333 CNLDKDEGSGLDRY-SMWYFNKETRKCEWFTYLXXXXXXXRFYYRANCESSCIERVTNLCARSDIVNCMESWLHCKMESDSECQENALMDRLDVQLVCPPKQPICVNVPREIRKSPVYLTHRSLIPSDCKLRKDQGHCKTDSDXXXXXXXXXXXNDCLGFLYSKCGGNLNRFPSKEDCMNR 1872
            C+L  D G+   +Y   WY++K    C  F Y G  GN NRF     C ++CI     L ++S + +   S        D++C    +   L+VQ       P  + V R      V++         C L+ DQG C+      L ++Y  + N+C  F Y  C GN NRF S+E+C +R
Sbjct:   21 CSLSMDSGTPCGQYVQRWYYDKAVGACSPFWYGGCSGNSNRFKTEFECINTCI-----LTSKSSVSHRHHS------IRDNQCYYLDMTTGLNVQ-----NWPCSLQVCRWHSYGDVHV---------CLLKNDQGPCRA---YLLKWFYDTQQNECARFWYGGCKGNGNRFDSQEECEDR 173          
BLAST of Tissue factor pathway inhibitor 2 vs. Planmine SMEST
Match: SMESG000009888.1 (SMESG000009888.1)

HSP 1 Score: 968.763 bits (2503), Expect = 0.000e+0
Identity = 504/514 (98.05%), Postives = 509/514 (99.03%), Query Frame = 1
Query:  136 MNNYHFYQHNFDPGRFVIYLSKLQSRFLVSLNQLIPSFSISMDHQHFIMIFILYSLSVTIPVTVLMQPTQSTSTYSNSMKKENETEATLKRVQNIEIPENGEFPFNKTNDDILAPMNNSESFGESSISNLSISEAAVGMTFSTETSIQKKTNLDYDKFTIXXXXXXXXXKNPATRSYXXXXXXXXXXXNNFSSIQSTAHTIKTISAFNTTTSPHIPDLSVQVTKMYSKRRSTNTTIKYGERKATTIESEYLSKKSTTKRTYNSILDLPMSISIVYQESNSNLKPTKKALRNYSSTTKMPTLMPIIIAKLSTLSSESINQKIILKSKTSEFKTENKDPSKMETVINKPSKTLQKSTVNKSKDQIKEITTQTSFTTVKMTTIPAPWKTRFGNNDESSFDKVCNLDKDEGSGLDRYSMWYFNKETRKCEWFTYLXXXXXXXRFYYRANCESSCIERVTNLCARSDIVNCMESWLHCKMESDSECQENALMDRLDVQLVCPPKQPICVNVPREIRKSP 1677
            MNNYH+YQHNF+ GRFVIYLSKLQSRFLVSLNQLIPSFSISMDHQHFIMIFILYSLSV IPVTVLMQPTQS STYSNSMKKENETEATLKRVQ IEIPENGEFPFNKTNDDILAPMNNSESFGESSISNLSISEAAVGMTFSTETSIQKKTNLDYDKFTISPTSSSLSSKNPATRSYKIILKSLSSKINNFSSIQSTAHTIKTISAFNTTTSPHIPDLSVQVTKMYSKRRSTNTTIKYGERKATTIESEYLSKKSTTKRTYNSILDLPMSISIVYQESNSNLKPTKKALRNYSSTTKMPTL+PIIIAKLSTLSSESINQKIILKSKTSEFKTENKDPSKMETVINKPSKTLQKSTVNKSKDQIKEITTQ+SFTTVKMTTIPAPWKTRF NNDESSFDKVCNL+KDEGSGLDRYSMWYFNKETRKCEWFTYLGNGGNGNRFYYRANCESSCIERVTNLCARSDIVNCMESWLHCKMESDSECQENALMDRLDVQLVCPPKQPICVNVPREIRKSP
Sbjct:    1 MNNYHYYQHNFNTGRFVIYLSKLQSRFLVSLNQLIPSFSISMDHQHFIMIFILYSLSVAIPVTVLMQPTQSNSTYSNSMKKENETEATLKRVQYIEIPENGEFPFNKTNDDILAPMNNSESFGESSISNLSISEAAVGMTFSTETSIQKKTNLDYDKFTISPTSSSLSSKNPATRSYKIILKSLSSKINNFSSIQSTAHTIKTISAFNTTTSPHIPDLSVQVTKMYSKRRSTNTTIKYGERKATTIESEYLSKKSTTKRTYNSILDLPMSISIVYQESNSNLKPTKKALRNYSSTTKMPTLIPIIIAKLSTLSSESINQKIILKSKTSEFKTENKDPSKMETVINKPSKTLQKSTVNKSKDQIKEITTQSSFTTVKMTTIPAPWKTRFENNDESSFDKVCNLEKDEGSGLDRYSMWYFNKETRKCEWFTYLGNGGNGNRFYYRANCESSCIERVTNLCARSDIVNCMESWLHCKMESDSECQENALMDRLDVQLVCPPKQPICVNVPREIRKSP 514          
BLAST of Tissue factor pathway inhibitor 2 vs. Planmine SMEST
Match: SMESG000009888.1 (SMESG000009888.1)

HSP 1 Score: 888.256 bits (2294), Expect = 0.000e+0
Identity = 466/473 (98.52%), Postives = 469/473 (99.15%), Query Frame = 1
Query:  259 MDHQHFIMIFILYSLSVTIPVTVLMQPTQSTSTYSNSMKKENETEATLKRVQNIEIPENGEFPFNKTNDDILAPMNNSESFGESSISNLSISEAAVGMTFSTETSIQKKTNLDYDKFTIXXXXXXXXXKNPATRSYXXXXXXXXXXXNNFSSIQSTAHTIKTISAFNTTTSPHIPDLSVQVTKMYSKRRSTNTTIKYGERKATTIESEYLSKKSTTKRTYNSILDLPMSISIVYQESNSNLKPTKKALRNYSSTTKMPTLMPIIIAKLSTLSSESINQKIILKSKTSEFKTENKDPSKMETVINKPSKTLQKSTVNKSKDQIKEITTQTSFTTVKMTTIPAPWKTRFGNNDESSFDKVCNLDKDEGSGLDRYSMWYFNKETRKCEWFTYLXXXXXXXRFYYRANCESSCIERVTNLCARSDIVNCMESWLHCKMESDSECQENALMDRLDVQLVCPPKQPICVNVPREIRKSP 1677
            MDHQHFIMIFILYSLSV IPVTVLMQPTQS STYSNSMKKENETEATLKRVQ IEIPENGEFPFNKTNDDILAPMNNSESFGESSISNLSISEAAVGMTFSTETSIQKKTNLDYDKFTISPTSSSLSSKNPATRSYKIILKSLSSKINNFSSIQSTAHTIKTISAFNTTTSPHIPDLSVQVTKMYSKRRSTNTTIKYGERKATTIESEYLSKKSTTKRTYNSILDLPMSISIVYQESNSNLKPTKKALRNYSSTTKMPTL+PIIIAKLSTLSSESINQKIILKSKTSEFKTENKDPSKMETVINKPSKTLQKSTVNKSKDQIKEITTQ+SFTTVKMTTIPAPWKTRF NNDESSFDKVCNL+KDEGSGLDRYSMWYFNKETRKCEWFTYLGNGGNGNRFYYRANCESSCIERVTNLCARSDIVNCMESWLHCKMESDSECQENALMDRLDVQLVCPPKQPICVNVPREIRKSP
Sbjct:    1 MDHQHFIMIFILYSLSVAIPVTVLMQPTQSNSTYSNSMKKENETEATLKRVQYIEIPENGEFPFNKTNDDILAPMNNSESFGESSISNLSISEAAVGMTFSTETSIQKKTNLDYDKFTISPTSSSLSSKNPATRSYKIILKSLSSKINNFSSIQSTAHTIKTISAFNTTTSPHIPDLSVQVTKMYSKRRSTNTTIKYGERKATTIESEYLSKKSTTKRTYNSILDLPMSISIVYQESNSNLKPTKKALRNYSSTTKMPTLIPIIIAKLSTLSSESINQKIILKSKTSEFKTENKDPSKMETVINKPSKTLQKSTVNKSKDQIKEITTQSSFTTVKMTTIPAPWKTRFENNDESSFDKVCNLEKDEGSGLDRYSMWYFNKETRKCEWFTYLGNGGNGNRFYYRANCESSCIERVTNLCARSDIVNCMESWLHCKMESDSECQENALMDRLDVQLVCPPKQPICVNVPREIRKSP 473          
BLAST of Tissue factor pathway inhibitor 2 vs. Planmine SMEST
Match: SMESG000009888.1 (SMESG000009888.1)

HSP 1 Score: 870.537 bits (2248), Expect = 0.000e+0
Identity = 459/466 (98.50%), Postives = 462/466 (99.14%), Query Frame = 1
Query:  280 MIFILYSLSVTIPVTVLMQPTQSTSTYSNSMKKENETEATLKRVQNIEIPENGEFPFNKTNDDILAPMNNSESFGESSISNLSISEAAVGMTFSTETSIQKKTNLDYDKFTIXXXXXXXXXKNPATRSYXXXXXXXXXXXNNFSSIQSTAHTIKTISAFNTTTSPHIPDLSVQVTKMYSKRRSTNTTIKYGERKATTIESEYLSKKSTTKRTYNSILDLPMSISIVYQESNSNLKPTKKALRNYSSTTKMPTLMPIIIAKLSTLSSESINQKIILKSKTSEFKTENKDPSKMETVINKPSKTLQKSTVNKSKDQIKEITTQTSFTTVKMTTIPAPWKTRFGNNDESSFDKVCNLDKDEGSGLDRYSMWYFNKETRKCEWFTYLXXXXXXXRFYYRANCESSCIERVTNLCARSDIVNCMESWLHCKMESDSECQENALMDRLDVQLVCPPKQPICVNVPREIRKSP 1677
            MIFILYSLSV IPVTVLMQPTQS STYSNSMKKENETEATLKRVQ IEIPENGEFPFNKTNDDILAPMNNSESFGESSISNLSISEAAVGMTFSTETSIQKKTNLDYDKFTISPTSSSLSSKNPATRSYKIILKSLSSKINNFSSIQSTAHTIKTISAFNTTTSPHIPDLSVQVTKMYSKRRSTNTTIKYGERKATTIESEYLSKKSTTKRTYNSILDLPMSISIVYQESNSNLKPTKKALRNYSSTTKMPTL+PIIIAKLSTLSSESINQKIILKSKTSEFKTENKDPSKMETVINKPSKTLQKSTVNKSKDQIKEITTQ+SFTTVKMTTIPAPWKTRF NNDESSFDKVCNL+KDEGSGLDRYSMWYFNKETRKCEWFTYLGNGGNGNRFYYRANCESSCIERVTNLCARSDIVNCMESWLHCKMESDSECQENALMDRLDVQLVCPPKQPICVNVPREIRKSP
Sbjct:    1 MIFILYSLSVAIPVTVLMQPTQSNSTYSNSMKKENETEATLKRVQYIEIPENGEFPFNKTNDDILAPMNNSESFGESSISNLSISEAAVGMTFSTETSIQKKTNLDYDKFTISPTSSSLSSKNPATRSYKIILKSLSSKINNFSSIQSTAHTIKTISAFNTTTSPHIPDLSVQVTKMYSKRRSTNTTIKYGERKATTIESEYLSKKSTTKRTYNSILDLPMSISIVYQESNSNLKPTKKALRNYSSTTKMPTLIPIIIAKLSTLSSESINQKIILKSKTSEFKTENKDPSKMETVINKPSKTLQKSTVNKSKDQIKEITTQSSFTTVKMTTIPAPWKTRFENNDESSFDKVCNLEKDEGSGLDRYSMWYFNKETRKCEWFTYLGNGGNGNRFYYRANCESSCIERVTNLCARSDIVNCMESWLHCKMESDSECQENALMDRLDVQLVCPPKQPICVNVPREIRKSP 466          
The following BLAST results are available for this feature:
BLAST of Tissue factor pathway inhibitor 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tissue factor pathway inhibitor 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mig-69.394e-828.80Papilin [Source:UniProtKB/Swiss-Prot;Acc:O76840][more]
mig-69.394e-828.80Papilin [Source:UniProtKB/Swiss-Prot;Acc:O76840][more]
mig-69.394e-828.80Papilin [Source:UniProtKB/Swiss-Prot;Acc:O76840][more]
mig-64.618e-728.80Papilin [Source:UniProtKB/Swiss-Prot;Acc:O76840][more]
mig-64.618e-728.80Papilin [Source:UniProtKB/Swiss-Prot;Acc:O76840][more]
back to top
BLAST of Tissue factor pathway inhibitor 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Ppn7.948e-628.21gene:FBgn0003137 transcript:FBtr0301839[more]
Ppn8.591e-628.21gene:FBgn0003137 transcript:FBtr0301837[more]
back to top
BLAST of Tissue factor pathway inhibitor 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
wu:fb59d011.044e-636.49wu:fb59d01 [Source:ZFIN;Acc:ZDB-GENE-030131-1098][more]
back to top
BLAST of Tissue factor pathway inhibitor 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
itch3.263e-925.99itchy E3 ubiquitin protein ligase [Source:Xenbase;... [more]
itch3.816e-827.46itchy E3 ubiquitin protein ligase [Source:Xenbase;... [more]
itch3.926e-827.46itchy E3 ubiquitin protein ligase [Source:Xenbase;... [more]
back to top
BLAST of Tissue factor pathway inhibitor 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tissue factor pathway inhibitor 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|P0DJ77|VKT5_CYRSC4.530e-640.00Kunitz-type kappaPI-theraphotoxin-Hs1a OS=Cyriopag... [more]
sp|P68425|VKT1A_CYRSC4.530e-640.00Kunitz-type kappaPI-theraphotoxin-Hs1a OS=Cyriopag... [more]
sp|O76840|PPN1_CAEEL5.874e-628.80Papilin OS=Caenorhabditis elegans OX=6239 GN=mig-6... [more]
sp|P0DJ82|VKT27_CYRSC9.065e-640.00Kunitz-type kappaPI-theraphotoxin-Hs1c OS=Cyriopag... [more]
back to top
BLAST of Tissue factor pathway inhibitor 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4E0RJ488.173e-3040.30Putative kunitz-type protease inhibitor OS=Fasciol... [more]
A0A183A7E12.404e-2538.50Uncharacterized protein OS=Echinostoma caproni OX=... [more]
A0A074ZTJ34.654e-2536.32Uncharacterized protein OS=Opisthorchis viverrini ... [more]
A0A5J4NZU25.596e-2535.82Uncharacterized protein OS=Paragonimus westermani ... [more]
A0A4S2M3721.580e-2436.82Uncharacterized protein OS=Opisthorchis felineus O... [more]
back to top
BLAST of Tissue factor pathway inhibitor 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSAMXT00000051114.17.289e-629.83pep primary_assembly:Astyanax_mexicanus-2.0:11:518... [more]
back to top
BLAST of Tissue factor pathway inhibitor 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tissue factor pathway inhibitor 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tissue factor pathway inhibitor 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tissue factor pathway inhibitor 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tissue factor pathway inhibitor 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000009888.10.000e+098.05SMESG000009888.1[more]
SMESG000009888.10.000e+098.52SMESG000009888.1[more]
SMESG000009888.10.000e+098.50SMESG000009888.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024357 ID=SMED30024357|Name=Tissue factor pathway inhibitor 2|organism=Schmidtea mediterranea sexual|type=transcript|length=1977bp
CTCGAAAAATTAAATTCGACCTCTCGGCCAAATTGTGATCAAAATTCACA
CAACGGCTCTCATTATTTACAGCCGAGAGATAATAAACATTCTCGCCGAA
TCCATTGATGAAAATTATTATAATCATTTCAACCGATGAACAATTATCAC
TTTTATCAACACAATTTCGATCCAGGCAGATTTGTGATTTATCTCTCGAA
ACTTCAATCGAGATTTTTAGTGAGTCTTAATCAACTGATTCCATCATTTA
GTATTTCAATGGATCACCAACACTTTATTATGATTTTTATTTTATATAGT
CTCAGTGTTACTATTCCTGTAACCGTGCTGATGCAGCCTACTCAATCAAC
TTCTACTTACTCAAATTCAATGAAAAAAGAAAACGAGACAGAAGCCACAT
TGAAACGTGTACAGAACATAGAAATTCCAGAAAATGGTGAATTTCCTTTT
AATAAAACAAATGATGACATTCTCGCACCAATGAATAATTCAGAATCATT
CGGCGAGAGTTCTATCAGCAATCTGAGCATATCTGAAGCTGCTGTTGGTA
TGACATTTTCTACTGAAACATCTATTCAGAAAAAAACCAATTTGGATTAT
GACAAATTTACAATATCGCCAACATCAAGTTCACTAAGTTCTAAGAACCC
AGCAACAAGATCTTATAAAATAATCTTAAAAAGTTTATCCTCGAAGATTA
ATAATTTTTCCTCCATTCAGAGTACTGCTCACACAATTAAAACAATATCT
GCATTTAATACAACAACTTCACCCCACATTCCAGATCTATCAGTACAAGT
GACAAAAATGTATTCAAAACGGAGAAGTACGAACACAACTATAAAATATG
GCGAAAGAAAAGCTACAACAATAGAAAGCGAATACCTTTCAAAGAAATCG
ACTACTAAAAGAACCTATAACTCAATATTAGACTTACCAATGTCTATCAG
TATTGTTTATCAAGAATCTAATTCCAATTTAAAGCCCACCAAAAAGGCTT
TAAGAAATTACTCTTCAACAACTAAAATGCCAACACTAATGCCGATTATC
ATCGCCAAACTGTCAACTTTGTCCAGTGAAAGTATAAATCAGAAAATCAT
TCTCAAATCAAAAACCAGTGAATTCAAAACAGAAAATAAAGACCCATCAA
AAATGGAAACTGTAATCAATAAACCTTCAAAAACTCTTCAAAAATCGACT
GTCAATAAAAGTAAAGATCAAATCAAAGAAATAACTACTCAAACGTCCTT
TACAACGGTTAAGATGACGACGATTCCAGCTCCATGGAAGACTCGATTTG
GAAATAATGATGAATCTTCATTTGATAAGGTATGTAACCTTGATAAAGAT
GAAGGATCTGGACTGGACAGATATTCAATGTGGTATTTCAATAAAGAAAC
AAGAAAATGTGAATGGTTCACTTATCTAGGAAACGGCGGAAATGGAAATC
GGTTTTATTATCGAGCAAATTGTGAAAGTTCTTGCATTGAAAGAGTAACC
AATTTATGTGCAAGATCGGATATTGTAAACTGTATGGAGAGCTGGCTACA
TTGTAAAATGGAGTCAGATTCTGAATGTCAAGAGAATGCACTGATGGATA
GATTGGACGTCCAATTGGTATGCCCTCCTAAGCAACCGATTTGTGTTAAT
GTTCCTCGAGAAATTAGGAAGTCTCCCGTTTATTTAACTCACCGAAGTCT
GATCCCTAGTGACTGTAAGCTACGAAAAGATCAAGGACATTGTAAAACTG
ACAGCGACAGCTCCTTGGTTTACTATTATTCTTTAAAACTTAACGACTGT
CTTGGTTTTTTGTATTCAAAATGTGGAGGAAATCTCAACCGCTTTCCGTC
GAAAGAGGACTGTATGAATCGTTGCGCAATTTGAGATTGCATTGTTTGTC
AATTGTTTGTTTTTATTGTTAATATACCGTTCAAATGTTTTCATTTTGGA
AAATATCCAAAAATGTGTTGGTAATTT
back to top

protein sequence of SMED30024357-orf-1

>SMED30024357-orf-1 ID=SMED30024357-orf-1|Name=SMED30024357-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=583bp
MNNYHFYQHNFDPGRFVIYLSKLQSRFLVSLNQLIPSFSISMDHQHFIMI
FILYSLSVTIPVTVLMQPTQSTSTYSNSMKKENETEATLKRVQNIEIPEN
GEFPFNKTNDDILAPMNNSESFGESSISNLSISEAAVGMTFSTETSIQKK
TNLDYDKFTISPTSSSLSSKNPATRSYKIILKSLSSKINNFSSIQSTAHT
IKTISAFNTTTSPHIPDLSVQVTKMYSKRRSTNTTIKYGERKATTIESEY
LSKKSTTKRTYNSILDLPMSISIVYQESNSNLKPTKKALRNYSSTTKMPT
LMPIIIAKLSTLSSESINQKIILKSKTSEFKTENKDPSKMETVINKPSKT
LQKSTVNKSKDQIKEITTQTSFTTVKMTTIPAPWKTRFGNNDESSFDKVC
NLDKDEGSGLDRYSMWYFNKETRKCEWFTYLGNGGNGNRFYYRANCESSC
IERVTNLCARSDIVNCMESWLHCKMESDSECQENALMDRLDVQLVCPPKQ
PICVNVPREIRKSPVYLTHRSLIPSDCKLRKDQGHCKTDSDSSLVYYYSL
KLNDCLGFLYSKCGGNLNRFPSKEDCMNRCAI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000103central nervous system
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
PLANA:0007528glial cell
Vocabulary: INTERPRO
TermDefinition
IPR036880Kunitz_BPTI_sf
IPR002223Kunitz_BPTI
Vocabulary: molecular function
TermDefinition
GO:0004867serine-type endopeptidase inhibitor activity
Vocabulary: biological process
TermDefinition
GO:0010951negative regulation of endopeptidase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002223Pancreatic trypsin inhibitor Kunitz domainPRINTSPR00759BASICPTASEcoord: 555..565
score: 48.36
coord: 565..580
score: 46.81
coord: 524..538
score: 32.01
IPR002223Pancreatic trypsin inhibitor Kunitz domainSMARTSM00131KU_2coord: 398..451
e-value: 1.1E-11
score: 54.9
coord: 525..581
e-value: 2.1E-14
score: 63.8
IPR002223Pancreatic trypsin inhibitor Kunitz domainPFAMPF00014Kunitz_BPTIcoord: 527..580
e-value: 5.8E-13
score: 48.9
coord: 399..450
e-value: 3.0E-13
score: 49.8
IPR002223Pancreatic trypsin inhibitor Kunitz domainPROSITEPS50279BPTI_KUNITZ_2coord: 400..450
score: 12.16
IPR002223Pancreatic trypsin inhibitor Kunitz domainPROSITEPS50279BPTI_KUNITZ_2coord: 527..580
score: 12.559
IPR002223Pancreatic trypsin inhibitor Kunitz domainCDDcd00109KUcoord: 399..451
e-value: 2.80458E-13
score: 62.2674
IPR002223Pancreatic trypsin inhibitor Kunitz domainCDDcd00109KUcoord: 525..580
e-value: 8.45854E-13
score: 61.1118
IPR036880Pancreatic trypsin inhibitor Kunitz domain superfamilyGENE3DG3DSA:4.10.410.10coord: 392..453
e-value: 2.4E-16
score: 61.3
IPR036880Pancreatic trypsin inhibitor Kunitz domain superfamilyGENE3DG3DSA:4.10.410.10coord: 508..581
e-value: 9.4E-16
score: 59.5
IPR036880Pancreatic trypsin inhibitor Kunitz domain superfamilySUPERFAMILYSSF57362BPTI-likecoord: 518..581
IPR036880Pancreatic trypsin inhibitor Kunitz domain superfamilySUPERFAMILYSSF57362BPTI-likecoord: 396..452
NoneNo IPR availablePANTHERPTHR10083:SF350WU:FB59D01coord: 510..580
NoneNo IPR availablePANTHERPTHR10083:SF350WU:FB59D01coord: 351..468
NoneNo IPR availablePANTHERPTHR10083KUNITZ-TYPE PROTEASE INHIBITOR-RELATEDcoord: 351..468
NoneNo IPR availablePANTHERPTHR10083KUNITZ-TYPE PROTEASE INHIBITOR-RELATEDcoord: 510..580
NoneNo IPR availableTMHMMTMhelixcoord: 47..69