SCP domain-containing protein

Overview
NameSCP domain-containing protein
Smed IDSMED30024356
Length (bp)674
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024356

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parapharyngeal regionSMED30024356h1SMcG0007523 SmedASXL_009740SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
parapharyngeal regionSMED30024356h1SMcG0007523 dd_Smed_v6_41_1_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SCP domain-containing protein vs. Ensembl Human
Match: GLIPR1 (GLI pathogenesis related 1 [Source:HGNC Symbol;Acc:HGNC:17001])

HSP 1 Score: 128.257 bits (321), Expect = 1.137e-35
Identity = 75/184 (40.76%), Postives = 94/184 (51.09%), Query Frame = 3
Query:   69 DLREDFLTAHNTFRRQVAQGKVQGQPAAGDMMEMVWSDELAATAENSANRCVFQHDNDEDRATKSFPD---AGQNIYAGWEP----KEAIKLWFDENKDYSYNSDGCNGVCGHYTQVAWAKSYAVGCASVHCEGRNGFQY----KYFVVCNYGPAGNYMGEKPYKPGSACSNCPTGSTCNDGLC 587
            D  +D +  HN FR +V       +P A DM+ M W   LA  A+  A+ C F H+       K  P+    G+NI+ G  P      AI  W+DE +DY + +  C  VCGHYTQV WA SY VGCA   C   +GF       +F +CNYGP GNY    PYK G+ CS CP    C D LC
Sbjct:   32 DFIKDCVRIHNKFRSEV-------KPTASDMLYMTWDPALAQIAKAWASNCQFSHNTRLKPPHKLHPNFTSLGENIWTGSVPIFSVSSAITNWYDEIQDYDFKTRICKKVCGHYTQVVWADSYKVGCAVQFCPKVSGFDALSNGAHF-ICNYGPGGNY-PTWPYKRGATCSACPNNDKCLDNLC 206          
BLAST of SCP domain-containing protein vs. Ensembl Human
Match: GLIPR1L1 (GLIPR1 like 1 [Source:HGNC Symbol;Acc:HGNC:28392])

HSP 1 Score: 126.716 bits (317), Expect = 2.378e-35
Identity = 71/174 (40.80%), Postives = 96/174 (55.17%), Query Frame = 3
Query:   87 LTAHNTFRRQVAQGKVQGQPAAGDMMEMVWSDELAATAENSANRCVFQHDNDEDRATK---SFPDAGQNIYAG----WEPKEAIKLWFDENKDYSYNSDGCNGVCGHYTQVAWAKSYAVGCASVHCEGRNGFQYKYFVVCNYGPAGNYMGEKPYKPGSACSNCPTGSTCNDGLC 587
            + AHN +R     GKV   P A DM  M+W   LA  A+  AN+C F+H++  D++ K   +F   G+NI+ G    + P+ AI  W++E + Y ++S  C+ VCGHYTQ+ WA S+ VGCA   C    G     F VCNYGPAGN+    PY  G +CS C     C   LC
Sbjct:   38 IEAHNEWR-----GKVN--PPAADMKYMIWDKGLAKMAKAWANQCKFEHNDCLDKSYKCYAAFEYVGENIWLGGIKSFTPRHAITAWYNETQFYDFDSLSCSRVCGHYTQLVWANSFYVGCAVAMCPNLGGASTAIF-VCNYGPAGNFANMPPYVRGESCSLCSKEEKCVKNLC 203          
BLAST of SCP domain-containing protein vs. Ensembl Human
Match: GLIPR1L1 (GLIPR1 like 1 [Source:HGNC Symbol;Acc:HGNC:28392])

HSP 1 Score: 126.331 bits (316), Expect = 2.640e-35
Identity = 71/174 (40.80%), Postives = 96/174 (55.17%), Query Frame = 3
Query:   87 LTAHNTFRRQVAQGKVQGQPAAGDMMEMVWSDELAATAENSANRCVFQHDNDEDRATK---SFPDAGQNIYAG----WEPKEAIKLWFDENKDYSYNSDGCNGVCGHYTQVAWAKSYAVGCASVHCEGRNGFQYKYFVVCNYGPAGNYMGEKPYKPGSACSNCPTGSTCNDGLC 587
            + AHN +R     GKV   P A DM  M+W   LA  A+  AN+C F+H++  D++ K   +F   G+NI+ G    + P+ AI  W++E + Y ++S  C+ VCGHYTQ+ WA S+ VGCA   C    G     F VCNYGPAGN+    PY  G +CS C     C   LC
Sbjct:   38 IEAHNEWR-----GKVN--PPAADMKYMIWDKGLAKMAKAWANQCKFEHNDCLDKSYKCYAAFEYVGENIWLGGIKSFTPRHAITAWYNETQFYDFDSLSCSRVCGHYTQLVWANSFYVGCAVAMCPNLGGASTAIF-VCNYGPAGNFANMPPYVRGESCSLCSKEEKCVKNLC 203          
BLAST of SCP domain-containing protein vs. Ensembl Human
Match: CRISP2 (cysteine rich secretory protein 2 [Source:HGNC Symbol;Acc:HGNC:12024])

HSP 1 Score: 123.25 bits (308), Expect = 5.772e-34
Identity = 67/188 (35.64%), Postives = 99/188 (52.66%), Query Frame = 3
Query:   54 FSISSDLREDFLTAHNTFRRQVAQGKVQGQPAAGDMMEMVWSDELAATAENSANRCVFQHDNDEDRATKSFPDAGQNIYAGWEP---KEAIKLWFDENKDYSYN--SDGCNGVCGHYTQVAWAKSYAVGCASVHCEGRNGFQYKYFVVCNYGPAGNYMGEK--PYKPGSACSNCPTGSTCNDGLCSKS 596
             +    ++ + +  HN  R+ V+       P A +M++M WS E+   A+  AN+C  QH + EDR T +    G+N+Y   +P     AI+ W+DE  D+ Y       N V GHYTQ+ W  +Y VGC   +C  ++    KY+ VC Y PAGN M  K  PY+ G+ C+ CP    C+ GLC+ S
Sbjct:   30 LTTQLQVQREIVNKHNELRKAVS-------PPASNMLKMEWSREVTTNAQRWANKCTLQHSDPEDRKTST--RCGENLYMSSDPTSWSSAIQSWYDEILDFVYGVGPKSPNAVVGHYTQLVWYSTYQVGCGIAYCPNQDSL--KYYYVCQYCPAGNNMNRKNTPYQQGTPCAGCP--DDCDKGLCTNS 204          
BLAST of SCP domain-containing protein vs. Ensembl Human
Match: CRISP2 (cysteine rich secretory protein 2 [Source:HGNC Symbol;Acc:HGNC:12024])

HSP 1 Score: 123.25 bits (308), Expect = 5.772e-34
Identity = 67/188 (35.64%), Postives = 99/188 (52.66%), Query Frame = 3
Query:   54 FSISSDLREDFLTAHNTFRRQVAQGKVQGQPAAGDMMEMVWSDELAATAENSANRCVFQHDNDEDRATKSFPDAGQNIYAGWEP---KEAIKLWFDENKDYSYN--SDGCNGVCGHYTQVAWAKSYAVGCASVHCEGRNGFQYKYFVVCNYGPAGNYMGEK--PYKPGSACSNCPTGSTCNDGLCSKS 596
             +    ++ + +  HN  R+ V+       P A +M++M WS E+   A+  AN+C  QH + EDR T +    G+N+Y   +P     AI+ W+DE  D+ Y       N V GHYTQ+ W  +Y VGC   +C  ++    KY+ VC Y PAGN M  K  PY+ G+ C+ CP    C+ GLC+ S
Sbjct:   30 LTTQLQVQREIVNKHNELRKAVS-------PPASNMLKMEWSREVTTNAQRWANKCTLQHSDPEDRKTST--RCGENLYMSSDPTSWSSAIQSWYDEILDFVYGVGPKSPNAVVGHYTQLVWYSTYQVGCGIAYCPNQDSL--KYYYVCQYCPAGNNMNRKNTPYQQGTPCAGCP--DDCDKGLCTNS 204          
BLAST of SCP domain-containing protein vs. Ensembl Celegans
Match: scl-5 (SCP-Like extracellular protein [Source:UniProtKB/TrEMBL;Acc:Q18543])

HSP 1 Score: 106.301 bits (264), Expect = 3.205e-28
Identity = 67/199 (33.67%), Postives = 99/199 (49.75%), Query Frame = 3
Query:   60 ISSDLREDFLTAHNTFRRQVAQG----KVQGQPAAGDMMEMVWSDELAATAENSANRCVFQHDNDEDRATKSFPDAGQNIYAGWEPKEAIKL----------WFDENKDYSYNSDGC-----NGVCGHYTQVAWAKSYAVGCASVHC-EGRNGFQYKYFVVCNYGPAGNYMGEKPYKPGSACSNCPTGSTCN--DGLCS 590
             S++ +   L  HNT R ++A+G    K   +PAA DM++M W   +AA+A+  AN+C   H              G+N+Y  W       +          W  E +DY ++S+       N   GH TQ+AWAK+  +GC   +C +  NGF  K  VVC Y P GNY+ +  Y  G+ CS CP+G++C    GLC+
Sbjct:   19 FSANGQAAILNVHNTLRSRIAKGTYVAKGTAKPAASDMLKMKWDATVAASAQAYANKCPTGHSGAAGL--------GENLYWYWTSATITNIDQFGATGSAAWEKEFQDYGWSSNTLSMSLFNTGIGHATQMAWAKTNLIGCGVKNCGKDTNGFN-KVTVVCQYKPQGNYLNQNIYTSGTTCSKCPSGTSCEAATGLCA 208          
BLAST of SCP domain-containing protein vs. Ensembl Celegans
Match: scl-14 (SCP-Like extracellular protein [Source:UniProtKB/TrEMBL;Acc:Q93444])

HSP 1 Score: 100.523 bits (249), Expect = 4.242e-26
Identity = 62/189 (32.80%), Postives = 88/189 (46.56%), Query Frame = 3
Query:   84 FLTAHNTFRRQVAQGKVQGQ----PAAGDMMEMVWSDELAATAENSANRCVFQHDNDEDRATKSFPDAGQNIYAGWEPKEAIKL----------WFDENKDYSYNSDGC-----NGVCGHYTQVAWAKSYAVGCASVHCEGRNGFQYKYFVVCNYGPAGNYMGEKPYKPGSACSNCPTGSTCN--DGLC 587
             L  HNT R ++A+G    +     AA DM++M W   LA +++  ANRC   H N            G+N+Y  W       +          W  E +DY ++S+       N   GH TQ+AWAK+  +GC   +C        K  VVC+Y P GNY+ +  Y  G+ CS CP G++C    GLC
Sbjct:   27 ILNVHNTLRSRIAKGTYVARGTVKHAASDMLKMKWLRSLATSSQIYANRCPTGHSN--------MIGVGENLYWYWTSGTITNIDQFGAMASAAWEKEFQDYGWSSNTLTMSLFNSGVGHATQMAWAKTNLIGCGVKNCGMDTNGMNKVAVVCHYQPQGNYLNQNIYTSGTTCSKCPAGTSCEAATGLC 207          
BLAST of SCP domain-containing protein vs. Ensembl Celegans
Match: scl-10 (SCP-Like extracellular protein [Source:UniProtKB/TrEMBL;Acc:Q20609])

HSP 1 Score: 99.7525 bits (247), Expect = 1.030e-25
Identity = 65/190 (34.21%), Postives = 93/190 (48.95%), Query Frame = 3
Query:   84 FLTAHNTFRRQVAQGK-VQG---QPAAGDMMEMVWSDELAATAENSANRCVFQHDNDEDRATKSFPDAGQNIYAGWEP-----------KEAIKLWFDENKDYSYNSDGC-----NGVCGHYTQVAWAKSYAVGCASVHCEGRNGFQYKYFVVCNYGPAGNYMGEKPYKPGSACSNCPTGSTC--NDGLC 587
             L+ HN  R Q+A GK V G   +P+A +MM+++W   L  TA++ +  C   H       + S  + G+N+Y    P             +  LW  E + + +N +       N   GH TQ+AWA +  +GC    C   + F  +Y VVC Y PAGNY+G   YK G  CSNCP G+ C  + GLC
Sbjct:   30 ILSRHNYLRSQIALGKYVAGNSTKPSASNMMKLIWDTTLETTAQDYSTGCPTGH-------SASRANIGENMYWWTSPVVTQTDAELLGNRSANLWESEFQRFGWNGNLLTEELFNSGIGHATQMAWATTNKIGCGISKCS-SDSFGTQYVVVCLYSPAGNYIGMDIYKSGETCSNCPDGTNCESSTGLC 211          
BLAST of SCP domain-containing protein vs. Ensembl Celegans
Match: scl-2 (SCP-Like extracellular protein [Source:UniProtKB/TrEMBL;Acc:Q20603])

HSP 1 Score: 94.3597 bits (233), Expect = 1.212e-23
Identity = 67/195 (34.36%), Postives = 93/195 (47.69%), Query Frame = 3
Query:   75 REDFLTAHNTFRRQVAQGK-----VQGQPAAGDMMEMVWSDELAATAENSANRCVFQHDNDEDRATKSFPDAGQNIYAGWEPKEAIKL----------WFDENKDYSYNS-----DGCNGVCGHYTQVAWAKSYAVGCASVHCEGR--NGFQYKYFVVCNYGPAGNYMGEKPYKPGSACSNCPTGSTC--NDGLC 587
            +   + AHNT R ++A+G       Q  P   ++++M W   +AA+A+N AN C   H  D           G+N+Y  W       L          W  E +DY + S     D  N   GH TQ+AWAKS  +GC    C GR  NG   K  VVC Y P GN++ +  Y  G+ CS CP+G++C  + GLC
Sbjct:   23 QNGIINAHNTLRSKIAKGTYVAKGTQKSPGT-NLLKMKWDSAVAASAQNYANGCPTGHSGD--------AGLGENLYWYWTSGSLGDLNQYGSAASASWEKEFQDYGWKSNLMTIDLFNTGIGHATQMAWAKSNLIGCGVKDC-GRDSNGLN-KVTVVCQYKPQGNFINQYIYVSGATCSGCPSGTSCETSTGLC 206          
BLAST of SCP domain-containing protein vs. Ensembl Celegans
Match: scl-2 (SCP-Like extracellular protein [Source:UniProtKB/TrEMBL;Acc:Q20603])

HSP 1 Score: 94.3597 bits (233), Expect = 1.212e-23
Identity = 67/195 (34.36%), Postives = 93/195 (47.69%), Query Frame = 3
Query:   75 REDFLTAHNTFRRQVAQGK-----VQGQPAAGDMMEMVWSDELAATAENSANRCVFQHDNDEDRATKSFPDAGQNIYAGWEPKEAIKL----------WFDENKDYSYNS-----DGCNGVCGHYTQVAWAKSYAVGCASVHCEGR--NGFQYKYFVVCNYGPAGNYMGEKPYKPGSACSNCPTGSTC--NDGLC 587
            +   + AHNT R ++A+G       Q  P   ++++M W   +AA+A+N AN C   H  D           G+N+Y  W       L          W  E +DY + S     D  N   GH TQ+AWAKS  +GC    C GR  NG   K  VVC Y P GN++ +  Y  G+ CS CP+G++C  + GLC
Sbjct:   23 QNGIINAHNTLRSKIAKGTYVAKGTQKSPGT-NLLKMKWDSAVAASAQNYANGCPTGHSGD--------AGLGENLYWYWTSGSLGDLNQYGSAASASWEKEFQDYGWKSNLMTIDLFNTGIGHATQMAWAKSNLIGCGVKDC-GRDSNGLN-KVTVVCQYKPQGNFINQYIYVSGATCSGCPSGTSCETSTGLC 206          
BLAST of SCP domain-containing protein vs. Ensembl Fly
Match: CG8483 (gene:FBgn0038126 transcript:FBtr0082782)

HSP 1 Score: 114.005 bits (284), Expect = 1.313e-29
Identity = 73/196 (37.24%), Postives = 104/196 (53.06%), Query Frame = 3
Query:   51 AFSISSDLREDFLTAHNTFRRQVAQGKVQGQPAAGDMMEMVWSDELAATAENSANRCVFQHDNDEDRATKSFPDAGQNIYAGWE--PKEA--------IKLWFDENKDYSYNSDGCNGVCGHYTQVAWAKSYAVGCASVHCEGRNGFQYKYFVVCNYGPAGNYMGEKPYKPGS-ACSNCPTG-STCNDGLCSKSGA 602
            A  I+++ R   L  HN  R+ VA G+  GQP A +M E+VW DELAA A+  A+ C F+H  D  R    F   GQN+   W   P +A        I+ WF+E + YS+  D  +   GHY+Q+ W ++  VGC   + E ++  +Y    VCNYGP GN +G  PY+ G  +CS      S+   GLC+  G+
Sbjct:   29 ASGITAEERSIILQEHNRLRQIVATGRYPGQPGAENMREIVWDDELAARAQKWADNCQFRH--DPHRTINRF-TMGQNLAIIWSTAPLDADDGDFPSRIQSWFNEVQKYSFG-DAWSPKTGHYSQLVWGETSLVGCG--YAEYKDTSKYNKLYVCNYGPGGNVVGYNPYEVGKPSCSTYGMKPSSRYQGLCAAPGS 218          
BLAST of SCP domain-containing protein vs. Ensembl Fly
Match: CG17974 (gene:FBgn0034624 transcript:FBtr0071611)

HSP 1 Score: 79.7221 bits (195), Expect = 9.519e-18
Identity = 63/192 (32.81%), Postives = 88/192 (45.83%), Query Frame = 3
Query:   75 REDFLTAHNTFRRQVAQGKVQGQPAAGDMMEMVWSDELAATAENSANRCVFQHDNDEDRATKSFPDAGQNIYAGWEPK-----------EAIKLWFDENKDY------SYNSDGCNGVCGHYTQVAWAKSYAVGCASVHCEGRNGF--QYKYFVVCNYGPAGNYMGEKPYKPGSACSNCPTG-STCNDGLCS 590
            + DFL AHN  R  +A GKV G   A  M  MVW DEL   +  +   C   HD+  +  T  + ++GQN+ A W P+           E + LWF+E          S+         GH+ +++  K++AVGC S+    R  +   Y Y  +CNY      +G   Y+ G A S C TG S    GLCS
Sbjct:   63 KADFLHAHNKRRNFLALGKVPGYYPAARMATMVWDDELQYLSMLNTRTCKLDHDDCHN--TYRYANSGQNLCAVWRPRSPHVNVTSLVEECLGLWFNEFDLIDSSFIDSFKVTPIFEDYGHFAELSVDKNFAVGC-SIMRFTRPDYPSVYIYNFICNYASLYA-LGAPVYETGRAASRCTTGKSHFYPGLCS 250          
BLAST of SCP domain-containing protein vs. Ensembl Fly
Match: CG32679 (gene:FBgn0052679 transcript:FBtr0071469)

HSP 1 Score: 76.2554 bits (186), Expect = 2.120e-16
Identity = 60/184 (32.61%), Postives = 81/184 (44.02%), Query Frame = 3
Query:   84 FLTAHNTFRRQVAQGKVQGQPAAGDMMEMVWSDELAATAENSANRCVFQHDNDEDRATKSFPDAGQNIYAGWE--------PKEAIKLWFDENKDYS------YNSDGCNGVCGHYTQVAWAKSYAVGCASVHCEGRNGFQYKYFVVCNYGPAGNYMGEKPYKPGSACSNCPTGSTCN-DGLCS 590
             L  HN  R  +A G V G P+A  M  M W   LA  A  +A +C   H  DE R T ++  AGQN+   +          ++ I  WFDEN+D +      Y   G   + GH+T +   ++  VGCA       N  Q    + CNY    N +    Y+ G+A S C TG   N   LCS
Sbjct:   64 ILQLHNERRNLIAGGGVSGFPSAVQMATMSWDTTLAQLAAYNALQCRMAH--DECRNTNTYRYAGQNLSILFTRSVDVAVFLRQRIAAWFDENRDATSGDMEDYQMRGGPAI-GHFTTMVNERNNRVGCAIARFTDANNVQ-ATLLACNYA-VTNVVNNPVYRAGTAASECTTGRNSNYPNLCS 242          
BLAST of SCP domain-containing protein vs. Ensembl Fly
Match: CG9400 (gene:FBgn0030562 transcript:FBtr0073920)

HSP 1 Score: 74.3294 bits (181), Expect = 1.639e-15
Identity = 54/186 (29.03%), Postives = 79/186 (42.47%), Query Frame = 3
Query:   48 QAFSISSDLREDFLTAHNTFRRQVAQGKVQGQPAAGDMMEMVWSDELAATAENSANRCVFQHDNDEDRATKSFPDAGQNIYAGWEPKE----------AIKLWFDENKDYS------YNSDGCNGVCGHYTQVAWAKSYAVGCASVHCEGRNGFQYKYFVVCNYGPAGNYMGEKPYKPGSACSNCP 557
            +   +S   R+  L  HN  R ++A G + G  +A  M  + W  EL   A   A RC F H  D+ R T  F  +GQNI   W  +E           +  WF E++D +      Y+        GH+T +   +   VGCA V        ++++ + CNY    N   E  Y+ G A S CP
Sbjct:   87 KLLEMSERRRQLLLDMHNLARSKIASGNLDGYRSAAHMPLLRWDTELEQMAALHAKRCQFAH--DKCRNTPRFKFSGQNIGYFWIGREFKSHSRRMKSFVINWFREHQDANQSFIDRYHPHPQGKKIGHFTLLVSDRVNRVGCAGVRFLEPKSNRFQFMLTCNYD-YNNIFNEPIYQSGPAGSKCP 269          
BLAST of SCP domain-containing protein vs. Ensembl Fly
Match: CG42564 (gene:FBgn0260766 transcript:FBtr0301268)

HSP 1 Score: 70.4774 bits (171), Expect = 7.374e-14
Identity = 64/210 (30.48%), Postives = 93/210 (44.29%), Query Frame = 3
Query:   48 QAFSISSDLREDFLTAHNTFRRQVAQGKVQGQPAAGDMMEMVWSDELAATAENSANRCVFQHDNDEDRATKSFPDAGQNI-YAGWEPK---------EAIKLWFDENKDYS------YNSDGCNGVCGHYTQVAWAKSYAVGCASVHCEGRNGFQYKYFVVCNYGPAGNYMGEKPYKPG-SACSNCPTGSTCNDG-LCSKSGAGKKIDPK 623
            +   IS  +    L   N  R  VA+G   G   A  M  + W+ ELA  AE +   CV +H  DE R TK   +AGQ + Y G + K         + I +W  E    S      Y          ++ Q+    + +VGCA V  + R+G+   +F  CNYG A   +G   Y+PG  A  +C TG+      LC++S   +K+ PK
Sbjct:   85 ELIVISPKVERFLLRRFNELRDSVAKGGFNGLSPASRMGTLKWNPELAYLAEFNVRDCVLRH--DECRNTKFTQNAGQTVGYRGIKGKLPELEDILRDIIGVWLREKSRTSMVNIMKYVEQESQSPKYNFLQIVLENAESVGCAIVQ-QSRHGWIQTFF-ACNYGHA-PVVGSPVYEPGKKAAESCKTGANPKYAHLCAESEVYEKVTPK 289          
BLAST of SCP domain-containing protein vs. Ensembl Zebrafish
Match: glipr1a (GLI pathogenesis-related 1a [Source:ZFIN;Acc:ZDB-GENE-110309-2])

HSP 1 Score: 125.176 bits (313), Expect = 9.805e-35
Identity = 72/178 (40.45%), Postives = 92/178 (51.69%), Query Frame = 3
Query:  111 RQVAQGKVQGQPAAGDMMEMVWSDELAATAENSANRCVFQHD---NDEDRATKSFPDAGQNIYAG-----WEPKEAIKLWFDENKDYSYNSDGCN--GVCGHYTQVAWAKSYAVGCASVHCEGRNGFQYKYF-------VVCNYGPAGNYMGEKPYKPGSACSNCPTGSTCNDGLCSK 593
            R+  Q +    P A +M  M W   LA TA   A  C+F+H+    +  R   +F   G+NI+AG     +  K A+  W +E KDY+YN++ CN   VCGHYTQV WA SY VGCA   C   NG    +F        VCNY  AGN+ G  PYK G++CS C     C   LC K
Sbjct:   37 REHNQNRSSVSPTAANMRYMTWDAALAVTARAWARFCLFKHNIHLREAKRVHPTFTTVGENIWAGAPYSRFTVKSAVFSWVNELKDYNYNNNQCNDKKVCGHYTQVVWADSYKVGCAVQTCP--NGVAETHFSNIQGVIFVCNYATAGNFAGRSPYKQGASCSGCGGSDKCERNLCRK 212          
BLAST of SCP domain-containing protein vs. Ensembl Zebrafish
Match: glipr1a (GLI pathogenesis-related 1a [Source:ZFIN;Acc:ZDB-GENE-110309-2])

HSP 1 Score: 122.094 bits (305), Expect = 2.123e-33
Identity = 75/199 (37.69%), Postives = 100/199 (50.25%), Query Frame = 3
Query:  111 RQVAQGKVQGQPAAGDMMEMVWSDELAATAENSANRCVFQHD---NDEDRATKSFPDAGQNIYAG-----WEPKEAIKLWFDENKDYSYNSDGCN--GVCGHYTQVAWAKSYAVGCASVHCEGRNGFQYKYF-------VVCNYGPAGNYMGEKPYKPGSACSNCPTGSTCNDGLCSKS--GAGKKIDPKPDKVPTKTT 650
            R+  Q +    P A +M  M W   LA TA   A  C+F+H+    +  R   +F   G+NI+AG     +  K A+  W +E KDY+YN++ CN   VCGHYTQV WA SY VGCA   C   NG    +F        VCNY  AGN+ G  PYK G++CS C     C   LC  +   A +  +  PD  P  ++
Sbjct:   45 REHNQNRSSVSPTAANMRYMTWDAALAVTARAWARFCLFKHNIHLREAKRVHPTFTTVGENIWAGAPYSRFTVKSAVFSWVNELKDYNYNNNQCNDKKVCGHYTQVVWADSYKVGCAVQTCP--NGVAETHFSNIQGVIFVCNYATAGNFAGRSPYKQGASCSGCGGSDKCERNLCRNTDRDAEQSYNWTPDWDPALSS 241          
BLAST of SCP domain-containing protein vs. Ensembl Zebrafish
Match: crispld2 (cysteine-rich secretory protein LCCL domain containing 2 [Source:ZFIN;Acc:ZDB-GENE-130131-1])

HSP 1 Score: 117.087 bits (292), Expect = 4.314e-30
Identity = 70/207 (33.82%), Postives = 103/207 (49.76%), Query Frame = 3
Query:   75 REDFLTAHNTFRRQVAQGKVQGQPAAGDMMEMVWSDELAATAENSANRCVFQHDNDEDRATKSFPDAGQNIYAGW----EPKEAIKLWFDENKDYSYN---------SDGCNG-VCGHYTQVAWAKSYAVGCASVHCEGRNGF----QYKYFVVCNYGPAGNYMGEKPYKPGSACSNCPT--GSTCNDGLCSKSGAGKKIDPKPDKV 635
            RE+ L  HN  R +V        P A +M  M+W DEL  +A + A +C ++H   +          GQN+   W     P   ++ W+DE KDY+Y           + C+G +C HYTQ+ WA +  VGCA   C   N +    +   ++VCNY P GN++GE PY+ G  CS CP   G  C D LC K  + ++  P+ ++V
Sbjct:   65 REEILKLHNKLRGEV-------YPTASNMEYMIWDDELERSATSWAEQCQWEHGPQD-----LLMSIGQNLAVHWGRYRSPAYHVQAWYDEVKDYTYPYPHECNPWCPERCSGPMCTHYTQLVWATTNRVGCAVHVCPRMNVWGEIWENAVYLVCNYSPKGNWIGEAPYQHGRPCSQCPPSYGGVCRDNLCYKRDSERQETPEMNEV 259          
BLAST of SCP domain-containing protein vs. Ensembl Zebrafish
Match: CU914487.1 (peptidase inhibitor 16-like [Source:NCBI gene;Acc:101883528])

HSP 1 Score: 107.842 bits (268), Expect = 3.699e-29
Identity = 54/149 (36.24%), Postives = 85/149 (57.05%), Query Frame = 3
Query:  171 VWSDELAATAENSANRCVFQHDNDEDRATKSFPDAGQNIYAGWEPKEAIKL---WFDENKDYSYNSDGC--NGVCGHYTQVAWAKSYAVGCASVHCEGRNGFQYK--YFVVCNYGPAGNYMGEKPYKPGSACSNCPTGSTCNDGLCSKS 596
            VW + +   AE  A +C++ H+ D +  T      G+N++ G  P  A K    WF+EN DY+YN++ C  + +CGHYTQ+ WA +  +GCAS  C+      ++    ++C+Y P GN  G+KPY+ G +CS CP    C + +C K+
Sbjct:    8 VWDETIRLVAEGYAAKCIWDHNPDLEHLT-----MGENLFVGTGPFNATKAVMDWFNENLDYNYNTNDCAEDKMCGHYTQLVWANTTKIGCASYFCDTLEKLHFEKATLLICDYYPQGNIEGQKPYESGESCSKCP--EECENNICGKN 149          
BLAST of SCP domain-containing protein vs. Ensembl Zebrafish
Match: crispld1a (cysteine-rich secretory protein LCCL domain containing 1a [Source:ZFIN;Acc:ZDB-GENE-090612-1])

HSP 1 Score: 110.923 bits (276), Expect = 6.623e-28
Identity = 71/208 (34.13%), Postives = 98/208 (47.12%), Query Frame = 3
Query:   57 SISSDLREDFLTAHNTFRRQVAQGKVQGQPAAGDMMEMVWSDELAATAENSANRCVFQHDNDEDRATKSFPDAGQNIYAGW----EPKEAIKLWFDENKDYSYNSDG---------CNG-VCGHYTQVAWAKSYAVGCASVHCEGRNGFQYKY----FVVCNYGPAGNYMGEKPYKPGSACSNCPT--GSTCNDGLCSKSGAGKKIDP 620
            +I++   +  L  HN  R QV        P A +M  MVW +EL  +AE  A  C+++H           P  GQN+   W     P   ++ W+DE KDYS+             C+G VC HYTQ+ WA S  +GCA   C   N +   +    ++VCNY P GN+ G  PYK G++CS CP   G  C + LC K     +  P
Sbjct:   61 AITASDMQAILDLHNKLRGQV-------YPPASNMEYMVWDNELERSAEEWAETCLWEHG-----PAGLLPQIGQNLGVHWGRYRPPTSHVQAWYDEVKDYSFPYPQECNPHCPFRCSGPVCTHYTQLVWATSSRIGCAINVCYNMNVWGQIWAKAVYLVCNYSPKGNWWGYAPYKHGTSCSACPPSYGGVCRENLCYKGDGKNRQSP 256          
BLAST of SCP domain-containing protein vs. Ensembl Xenopus
Match: crispld2 (cysteine-rich secretory protein LCCL domain containing 2 [Source:NCBI gene;Acc:613091])

HSP 1 Score: 118.627 bits (296), Expect = 1.561e-30
Identity = 71/200 (35.50%), Postives = 99/200 (49.50%), Query Frame = 3
Query:   75 REDFLTAHNTFRRQVAQGKVQGQPAAGDMMEMVWSDELAATAENSANRCVFQHDNDEDRATKSFPDAGQNIYAGW----EPKEAIKLWFDENKDYSYN---------SDGCNG-VCGHYTQVAWAKSYAVGCASVHCEGRNGF----QYKYFVVCNYGPAGNYMGEKPYKPGSACSNCPT--GSTCNDGLCSKSGAGKKI 614
            +E+ +  HN  R QV        P+A +M  M W DEL  +AE  A  C+++H       T      GQN+   W    +P   ++ W+DE KDY+Y           + C+G +C HYTQ+ WA +  VGCA   C+  N +    +   ++VCNY P GN++GE PYK G  CS CP   G  C + LC K     KI
Sbjct:   57 KEEIIQLHNKLRGQV-------HPSASNMEYMTWDDELEKSAEAWAEECIWEHG-----PTALLMSIGQNLAVHWGRYRQPAYHVQSWYDEVKDYTYPYPHECNPYCPERCSGPMCTHYTQIVWATTTKVGCAVNVCKRMNVWGDIWENAVYLVCNYSPKGNWIGEAPYKNGRPCSECPPSYGGNCQNNLCYKGNIDGKI 244          
BLAST of SCP domain-containing protein vs. Ensembl Xenopus
Match: crispld2 (cysteine-rich secretory protein LCCL domain containing 2 [Source:NCBI gene;Acc:613091])

HSP 1 Score: 117.857 bits (294), Expect = 3.404e-30
Identity = 69/193 (35.75%), Postives = 97/193 (50.26%), Query Frame = 3
Query:   75 REDFLTAHNTFRRQVAQGKVQGQPAAGDMMEMVWSDELAATAENSANRCVFQHDNDEDRATKSFPDAGQNIYAGW----EPKEAIKLWFDENKDYSYN---------SDGCNG-VCGHYTQVAWAKSYAVGCASVHCEGRNGF----QYKYFVVCNYGPAGNYMGEKPYKPGSACSNCPT--GSTCNDGLCSK 593
            +E+ +  HN  R QV        P+A +M  M W DEL  +AE  A  C+++H       T      GQN+   W    +P   ++ W+DE KDY+Y           + C+G +C HYTQ+ WA +  VGCA   C+  N +    +   ++VCNY P GN++GE PYK G  CS CP   G  C + LC K
Sbjct:   57 KEEIIQLHNKLRGQV-------HPSASNMEYMTWDDELEKSAEAWAEECIWEHG-----PTALLMSIGQNLAVHWGRYRQPAYHVQSWYDEVKDYTYPYPHECNPYCPERCSGPMCTHYTQIVWATTTKVGCAVNVCKRMNVWGDIWENAVYLVCNYSPKGNWIGEAPYKNGRPCSECPPSYGGNCQNNLCYK 237          
BLAST of SCP domain-containing protein vs. Ensembl Xenopus
Match: crispld2 (cysteine-rich secretory protein LCCL domain containing 2 [Source:NCBI gene;Acc:613091])

HSP 1 Score: 117.472 bits (293), Expect = 5.256e-30
Identity = 69/193 (35.75%), Postives = 97/193 (50.26%), Query Frame = 3
Query:   75 REDFLTAHNTFRRQVAQGKVQGQPAAGDMMEMVWSDELAATAENSANRCVFQHDNDEDRATKSFPDAGQNIYAGW----EPKEAIKLWFDENKDYSYN---------SDGCNG-VCGHYTQVAWAKSYAVGCASVHCEGRNGF----QYKYFVVCNYGPAGNYMGEKPYKPGSACSNCPT--GSTCNDGLCSK 593
            +E+ +  HN  R QV        P+A +M  M W DEL  +AE  A  C+++H       T      GQN+   W    +P   ++ W+DE KDY+Y           + C+G +C HYTQ+ WA +  VGCA   C+  N +    +   ++VCNY P GN++GE PYK G  CS CP   G  C + LC K
Sbjct:   57 KEEIIQLHNKLRGQV-------HPSASNMEYMTWDDELEKSAEAWAEECIWEHG-----PTALLMSIGQNLAVHWGRYRQPAYHVQSWYDEVKDYTYPYPHECNPYCPERCSGPMCTHYTQIVWATTTKVGCAVNVCKRMNVWGDIWENAVYLVCNYSPKGNWIGEAPYKNGRPCSECPPSYGGNCQNNLCYK 237          
BLAST of SCP domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000036788.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:KV464547.1:593:5826:1 gene:ENSXETG00000015856.1 transcript:ENSXETT00000036788.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 112.079 bits (279), Expect = 1.344e-28
Identity = 60/186 (32.26%), Postives = 93/186 (50.00%), Query Frame = 3
Query:   54 FSISSDLREDFLTAHNTFRRQVAQGKVQGQPAAGDMMEMVWSDELAATAENSANRCVFQHDNDEDRATKSFPDAGQNIYAGWEPKEAIKL--WFDENKDYSYNSDGCN--GVCGHYTQVAWAKSYAVGCASVHCEGRNGF--QYKYFVVCNYGPAGNYMGEKPYKPGSACSNCPTGSTCNDGLCSK 593
             +++ + +   L  HN +R Q        +P+A DM+++ W   L A A++ A +C+++H+ D     + F      + +G     A+ L  W  E   Y++ +  C    +CGHYTQ+ WA +  VGC    C    G   +  Y +VCNY P GN+ GE PYK GS C+ CP+   C   LC K
Sbjct:   28 LALNYEEKRIILDKHNFYRSQ-------TEPSASDMIKLTWDSALEAMAKSYAEKCIWEHNKD-----RGFIGENLFVMSGSSLDVALGLDDWHKERGYYNFTTGMCQEGQMCGHYTQMVWAGTERVGCGQNFCPKLEGVDDENMYLLVCNYEPPGNFEGESPYKEGSRCTECPSDHVCIGSLCGK 201          
BLAST of SCP domain-containing protein vs. Ensembl Xenopus
Match: CRISPLD1 (cysteine-rich secretory protein LCCL domain containing 1 [Source:NCBI gene;Acc:100490431])

HSP 1 Score: 107.842 bits (268), Expect = 1.277e-26
Identity = 71/199 (35.68%), Postives = 95/199 (47.74%), Query Frame = 3
Query:   66 SDLREDFLTAHNTFRRQVAQGKVQGQPAAGDMMEMVWSDELAATAENSANRCVFQHDNDEDRATKSFPDAGQNIYAGW----EPKEAIKLWFDENKDYS---------YNSDGCNG-VCGHYTQVAWAKSYAVGCASVHCEGRNGFQYKY----FVVCNYGPAGNYMGEKPYKPGSACSNCPT--GSTCNDGLCSKSGA 602
            SD++   L  HN  R +V        P A +M  M+W  EL  +AE  A  C+++H           P  GQN+ A W     P   ++ W+DE +DY+         Y    C+G VC HYTQ+ WA S  +GCA   C   N +   +    ++VCNY P GN+ G  PYK G  CS CP   G  C D LC K G+
Sbjct:   60 SDMKL-ILDLHNKLRGEV-------YPPASNMEFMIWDVELERSAEAWAETCLWEHG-----PADLLPVIGQNLGAHWGRYRPPTYHVQAWYDEVRDYTFPYPQECDPYCPFRCSGPVCTHYTQLVWATSSRIGCAINLCHNMNVWGQIWPKAIYLVCNYSPKGNWWGHAPYKHGHPCSACPPSYGGGCKDNLCYKDGS 245          
BLAST of SCP domain-containing protein vs. Ensembl Mouse
Match: Pi16 (peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:1921366])

HSP 1 Score: 133.65 bits (335), Expect = 7.393e-38
Identity = 71/201 (35.32%), Postives = 111/201 (55.22%), Query Frame = 3
Query:   57 SISSDLREDFLTAHNTFRRQVAQGKVQGQPAAGDMMEMVWSDELAATAENSANRCVFQHDNDEDRATKSFPDAGQNIYA----GWEPKEAIKLWFDENKDYSYNSDGC--NGVCGHYTQVAWAKSYAVGCASVHCEGRNGFQYK--YFVVCNYGPAGNYMGEKPYKPGSACSNCPTGSTCNDGLCSKSGAGKKIDPKPDKV 635
            +++ D ++  +  HN +R QV+       P A DM++M W DELAA A+  A +CV+ H+ +  R        G+N++A    G +   A+  W +E++ Y++++  C  N +CGHYTQV W+K+  +GC S  CE   G +    + +VCNY P GN  G KPY+ G+ CS CP G +C + LC      +K    P +V
Sbjct:   29 ALTEDEKQTMVDLHNQYRAQVS-------PPASDMLQMRWDDELAAFAKAYAQKCVWGHNKERGRR-------GENLFAITDEGMDVPLAVGNWHEEHEYYNFSTATCDPNQMCGHYTQVVWSKTERIGCGSHFCETLQGVEEANIHLLVCNYEPPGNVKGRKPYQEGTPCSQCPLGYSCENSLCEPMRNPEKAQDSPPRV 215          
BLAST of SCP domain-containing protein vs. Ensembl Mouse
Match: Pi16 (peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:1921366])

HSP 1 Score: 133.65 bits (335), Expect = 7.393e-38
Identity = 71/201 (35.32%), Postives = 111/201 (55.22%), Query Frame = 3
Query:   57 SISSDLREDFLTAHNTFRRQVAQGKVQGQPAAGDMMEMVWSDELAATAENSANRCVFQHDNDEDRATKSFPDAGQNIYA----GWEPKEAIKLWFDENKDYSYNSDGC--NGVCGHYTQVAWAKSYAVGCASVHCEGRNGFQYK--YFVVCNYGPAGNYMGEKPYKPGSACSNCPTGSTCNDGLCSKSGAGKKIDPKPDKV 635
            +++ D ++  +  HN +R QV+       P A DM++M W DELAA A+  A +CV+ H+ +  R        G+N++A    G +   A+  W +E++ Y++++  C  N +CGHYTQV W+K+  +GC S  CE   G +    + +VCNY P GN  G KPY+ G+ CS CP G +C + LC      +K    P +V
Sbjct:   29 ALTEDEKQTMVDLHNQYRAQVS-------PPASDMLQMRWDDELAAFAKAYAQKCVWGHNKERGRR-------GENLFAITDEGMDVPLAVGNWHEEHEYYNFSTATCDPNQMCGHYTQVVWSKTERIGCGSHFCETLQGVEEANIHLLVCNYEPPGNVKGRKPYQEGTPCSQCPLGYSCENSLCEPMRNPEKAQDSPPRV 215          
BLAST of SCP domain-containing protein vs. Ensembl Mouse
Match: Pi16 (peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:1921366])

HSP 1 Score: 135.961 bits (341), Expect = 6.550e-37
Identity = 71/201 (35.32%), Postives = 111/201 (55.22%), Query Frame = 3
Query:   57 SISSDLREDFLTAHNTFRRQVAQGKVQGQPAAGDMMEMVWSDELAATAENSANRCVFQHDNDEDRATKSFPDAGQNIYA----GWEPKEAIKLWFDENKDYSYNSDGC--NGVCGHYTQVAWAKSYAVGCASVHCEGRNGFQYK--YFVVCNYGPAGNYMGEKPYKPGSACSNCPTGSTCNDGLCSKSGAGKKIDPKPDKV 635
            +++ D ++  +  HN +R QV+       P A DM++M W DELAA A+  A +CV+ H+ +  R        G+N++A    G +   A+  W +E++ Y++++  C  N +CGHYTQV W+K+  +GC S  CE   G +    + +VCNY P GN  G KPY+ G+ CS CP G +C + LC      +K    P +V
Sbjct:   29 ALTEDEKQTMVDLHNQYRAQVS-------PPASDMLQMRWDDELAAFAKAYAQKCVWGHNKERGRR-------GENLFAITDEGMDVPLAVGNWHEEHEYYNFSTATCDPNQMCGHYTQVVWSKTERIGCGSHFCETLQGVEEANIHLLVCNYEPPGNVKGRKPYQEGTPCSQCPLGYSCENSLCEPMRNPEKAQDSPPRV 215          
BLAST of SCP domain-containing protein vs. Ensembl Mouse
Match: Pi16 (peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:1921366])

HSP 1 Score: 129.798 bits (325), Expect = 9.734e-37
Identity = 68/185 (36.76%), Postives = 106/185 (57.30%), Query Frame = 3
Query:   57 SISSDLREDFLTAHNTFRRQVAQGKVQGQPAAGDMMEMVWSDELAATAENSANRCVFQHDNDEDRATKSFPDAGQNIYA----GWEPKEAIKLWFDENKDYSYNSDGC--NGVCGHYTQVAWAKSYAVGCASVHCEGRNGFQYK--YFVVCNYGPAGNYMGEKPYKPGSACSNCPTGSTCNDGLC 587
            +++ D ++  +  HN +R QV+       P A DM++M W DELAA A+  A +CV+ H+ +  R        G+N++A    G +   A+  W +E++ Y++++  C  N +CGHYTQV W+K+  +GC S  CE   G +    + +VCNY P GN  G KPY+ G+ CS CP G +C + LC
Sbjct:   29 ALTEDEKQTMVDLHNQYRAQVS-------PPASDMLQMRWDDELAAFAKAYAQKCVWGHNKERGRR-------GENLFAITDEGMDVPLAVGNWHEEHEYYNFSTATCDPNQMCGHYTQVVWSKTERIGCGSHFCETLQGVEEANIHLLVCNYEPPGNVKGRKPYQEGTPCSQCPLGYSCENSLC 199          
BLAST of SCP domain-containing protein vs. Ensembl Mouse
Match: Glipr1l1 (GLI pathogenesis-related 1 like 1 [Source:MGI Symbol;Acc:MGI:1916536])

HSP 1 Score: 124.02 bits (310), Expect = 1.401e-34
Identity = 65/174 (37.36%), Postives = 96/174 (55.17%), Query Frame = 3
Query:   84 FLTAHNTFRRQVAQGKVQGQPAAGDMMEMVWSDELAATAENSANRCVFQHDNDEDRATKSFPD---AGQNIYAGW---EPKEAIKLWFDENKDYSYNSDGCNGVCGHYTQVAWAKSYAVGCASVHCEGRNGFQYKYFVVCNYGPAGNYMGEKPYKPGSACSNCPTGSTCNDGLC 587
            FL  HN  RR+V       QP A DM ++ W  +LA  A+     C   H+    +  +   D    G+NIY G    +P++ +  W++E+K ++++ + C+ +CGHYTQV WAK+  +GCA  +C    GF    F VCNY PAGN++G +PY  G +CS C    TC + LC
Sbjct:   45 FLNIHNELRRKV-------QPPAADMNQLFWDQQLAKLAKAWTRECKLAHNPCIKQRYECLEDYDFIGENIYLGRIETQPEDVVINWYNESKYFNFDFNTCSEMCGHYTQVVWAKTVKIGCAVSNCPNLKGFSAGLF-VCNYSPAGNFIGFRPYTRGDSCSMC-GQKTCENSLC 209          
BLAST of SCP domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9ET66|PI16_MOUSE (Peptidase inhibitor 16 OS=Mus musculus OX=10090 GN=Pi16 PE=1 SV=2)

HSP 1 Score: 135.961 bits (341), Expect = 4.582e-36
Identity = 71/201 (35.32%), Postives = 111/201 (55.22%), Query Frame = 3
Query:   57 SISSDLREDFLTAHNTFRRQVAQGKVQGQPAAGDMMEMVWSDELAATAENSANRCVFQHDNDEDRATKSFPDAGQNIYA----GWEPKEAIKLWFDENKDYSYNSDGC--NGVCGHYTQVAWAKSYAVGCASVHCEGRNGFQYK--YFVVCNYGPAGNYMGEKPYKPGSACSNCPTGSTCNDGLCSKSGAGKKIDPKPDKV 635
            +++ D ++  +  HN +R QV+       P A DM++M W DELAA A+  A +CV+ H+ +  R        G+N++A    G +   A+  W +E++ Y++++  C  N +CGHYTQV W+K+  +GC S  CE   G +    + +VCNY P GN  G KPY+ G+ CS CP G +C + LC      +K    P +V
Sbjct:   29 ALTEDEKQTMVDLHNQYRAQVS-------PPASDMLQMRWDDELAAFAKAYAQKCVWGHNKERGRR-------GENLFAITDEGMDVPLAVGNWHEEHEYYNFSTATCDPNQMCGHYTQVVWSKTERIGCGSHFCETLQGVEEANIHLLVCNYEPPGNVKGRKPYQEGTPCSQCPLGYSCENSLCEPMRNPEKAQDSPPRV 215          
BLAST of SCP domain-containing protein vs. UniProt/SwissProt
Match: sp|Q32LB5|GPRL1_BOVIN (GLIPR1-like protein 1 OS=Bos taurus OX=9913 GN=GLIPR1L1 PE=1 SV=1)

HSP 1 Score: 128.642 bits (322), Expect = 1.987e-35
Identity = 79/188 (42.02%), Postives = 101/188 (53.72%), Query Frame = 3
Query:   48 QAFSISSD-LREDFLTAHNTFRRQVAQGKVQGQPAAGDMMEMVWSDELAATAENSANRCVFQHDNDEDRATKSFPD---AGQNIYAG----WEPKEAIKLWFDENKDYSYNSDGCNGVCGHYTQVAWAKSYAVGCASVHCEGRNGFQYKYFVVCNYGPAGNYMGEKPYKPGSACSNCPTGSTCNDGLC 587
            +A SI++D   E+ L  HN  R  V+       P A DM  M W + LA TAE  A +C F H++   ++ K  P    AG+N++ G       K AI +W+DE K Y +N+  C+ VCGHYTQV WA SY VGCA   C    G      +VCNY PAGNY    PY  G+ CS C  G TC + LC
Sbjct:   25 KAPSITNDRFIEECLRLHNEARTNVS-------PPAADMKYMSWDEALAKTAEAWAKKCKFIHNSCSSKSFKCHPTFQYAGENLWLGPLTISAAKFAINMWYDERKFYDFNTRSCSQVCGHYTQVVWAYSYKVGCAVAVCPNL-GSPDSALLVCNYAPAGNYPNMSPYTNGTPCSMC-QGDTCENNLC 203          
BLAST of SCP domain-containing protein vs. UniProt/SwissProt
Match: sp|Q60477|CRIS2_CAVPO (Cysteine-rich secretory protein 2 OS=Cavia porcellus OX=10141 GN=CRISP2 PE=1 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 5.155e-35
Identity = 70/188 (37.23%), Postives = 101/188 (53.72%), Query Frame = 3
Query:   54 FSISSDLREDFLTAHNTFRRQVAQGKVQGQPAAGDMMEMVWSDELAATAENSANRCVFQHDNDEDRATKSFPDAGQNIYAGWEPK---EAIKLWFDENKDYSYN--SDGCNGVCGHYTQVAWAKSYAVGCASVHCEGRNGFQYKYFVVCNYGPAGN--YMGEKPYKPGSACSNCPTGSTCNDGLCSKS 596
             +  S ++ + +  HN  R+ V        P A +M++M WS E A  A+  ANRC   H N +DR T +    G+N+Y   +P    +AI+ WFDE++D+++       N V GHYTQ+ W  SY VGC   +C  ++    KY+ VC Y PAGN  Y    PYK G  C++CP    C +GLC+ S
Sbjct:   31 ITTQSQVQNEIINKHNQLRKSVT-------PPASNMLKMEWSREAAVNAQKWANRCTLVHSNPDDRKTST--KCGENLYMSSDPSSWSDAIQSWFDESQDFTFGVGPKSHNAVVGHYTQLVWYSSYLVGCGIAYCPNQDSL--KYYYVCQYCPAGNNVYTKNTPYKQGIPCASCP--GHCENGLCTNS 205          
BLAST of SCP domain-containing protein vs. UniProt/SwissProt
Match: sp|P48060|GLIP1_HUMAN (Glioma pathogenesis-related protein 1 OS=Homo sapiens OX=9606 GN=GLIPR1 PE=1 SV=3)

HSP 1 Score: 128.257 bits (321), Expect = 5.460e-35
Identity = 75/184 (40.76%), Postives = 94/184 (51.09%), Query Frame = 3
Query:   69 DLREDFLTAHNTFRRQVAQGKVQGQPAAGDMMEMVWSDELAATAENSANRCVFQHDNDEDRATKSFPD---AGQNIYAGWEP----KEAIKLWFDENKDYSYNSDGCNGVCGHYTQVAWAKSYAVGCASVHCEGRNGFQY----KYFVVCNYGPAGNYMGEKPYKPGSACSNCPTGSTCNDGLC 587
            D  +D +  HN FR +V       +P A DM+ M W   LA  A+  A+ C F H+       K  P+    G+NI+ G  P      AI  W+DE +DY + +  C  VCGHYTQV WA SY VGCA   C   +GF       +F +CNYGP GNY    PYK G+ CS CP    C D LC
Sbjct:   32 DFIKDCVRIHNKFRSEV-------KPTASDMLYMTWDPALAQIAKAWASNCQFSHNTRLKPPHKLHPNFTSLGENIWTGSVPIFSVSSAITNWYDEIQDYDFKTRICKKVCGHYTQVVWADSYKVGCAVQFCPKVSGFDALSNGAHF-ICNYGPGGNY-PTWPYKRGATCSACPNNDKCLDNLC 206          
BLAST of SCP domain-containing protein vs. UniProt/SwissProt
Match: sp|B0VXV6|CRVP_SISCA (Cysteine-rich venom protein 2 OS=Sistrurus catenatus edwardsii OX=8762 PE=2 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 5.511e-35
Identity = 75/199 (37.69%), Postives = 103/199 (51.76%), Query Frame = 3
Query:   69 DLREDFLTAHNTFRRQVAQGKVQGQPAAGDMMEMVWSDELAATAENSANRCVFQHDNDEDRATKSFPDAGQNIYAGWEP---KEAIKLWFDENKDYSYN--SDGCNGVCGHYTQVAWAKSYAVGCASVHCEGRNGFQYKYFVVCNYGPAGNYMGE--KPYKPGSACSNCPTGSTCNDGLCSKSGAGKKIDPKPDKVPTK 644
            +++   +  HN+ RR V        P A +M++M W  E AA AE  A RC+  H   + R  +     G+NIY    P    E I +W  ENK++ Y   +D  N V GHYTQ+ W KSY  GCA+ +C      +Y YF VC Y PAGN  G+   PYK G  C +CP  S C++GLC+        +P P K+ T+
Sbjct:   32 EIQNKIVDLHNSLRRSV-------NPTASNMLKMEWYSEAAANAERWAYRCIESHSPRDSRVLEGI-KCGENIYMSSVPMKWTEIIHIWHGENKNFKYGIGADPPNAVTGHYTQIVWYKSYRAGCAAAYCP---SLEYSYFYVCQYCPAGNIRGKTATPYKSGPPCGDCP--SACDNGLCT--------NPCPKKISTQ 209          
BLAST of SCP domain-containing protein vs. TrEMBL
Match: A0A172RVP6 (TPX-1 protein (Fragment) OS=Schmidtea mediterranea OX=79327 GN=TPX-1 PE=2 SV=1)

HSP 1 Score: 326.25 bits (835), Expect = 7.737e-112
Identity = 154/154 (100.00%), Postives = 154/154 (100.00%), Query Frame = 3
Query:  159 MMEMVWSDELAATAENSANRCVFQHDNDEDRATKSFPDAGQNIYAGWEPKEAIKLWFDENKDYSYNSDGCNGVCGHYTQVAWAKSYAVGCASVHCEGRNGFQYKYFVVCNYGPAGNYMGEKPYKPGSACSNCPTGSTCNDGLCSKSGAGKKIDP 620
            MMEMVWSDELAATAENSANRCVFQHDNDEDRATKSFPDAGQNIYAGWEPKEAIKLWFDENKDYSYNSDGCNGVCGHYTQVAWAKSYAVGCASVHCEGRNGFQYKYFVVCNYGPAGNYMGEKPYKPGSACSNCPTGSTCNDGLCSKSGAGKKIDP
Sbjct:    1 MMEMVWSDELAATAENSANRCVFQHDNDEDRATKSFPDAGQNIYAGWEPKEAIKLWFDENKDYSYNSDGCNGVCGHYTQVAWAKSYAVGCASVHCEGRNGFQYKYFVVCNYGPAGNYMGEKPYKPGSACSNCPTGSTCNDGLCSKSGAGKKIDP 154          
BLAST of SCP domain-containing protein vs. TrEMBL
Match: A0A1C9ZZV5 (SCP domain-containing protein (Fragment) OS=Dugesia japonica OX=6161 PE=2 SV=1)

HSP 1 Score: 197.978 bits (502), Expect = 4.384e-60
Identity = 91/181 (50.28%), Postives = 121/181 (66.85%), Query Frame = 3
Query:   54 FSISSDLREDFLTAHNTFRRQVAQGKVQGQPAAGDMMEMVWSDELAATAENSANRCVFQHDNDEDRATKSFPDAGQNIYAGWEPKEAIKLWFDENKDYSYNSDGCNGVCGHYTQVAWAKSYAVGCASVHCEGRNG--FQYKYFVVCNYGPAGNYMGEKPYKPGSACSNCPTGSTCNDGLCS 590
            F    + ++  L AHN  RR +A GK   QPAA +M+EMVW D LA  AE  A +C+  HD  +DR    F   GQN++AG   KE ++ W+DE KDY+Y   GC+ VCGHYTQVAW+KSYAVGCA+V+C+ + G  F Y +  +CNYGPAGN+  E PY+ G+ACS CP G++C + LC+
Sbjct:   24 FCTPPEYKDFLLKAHNDLRRDIALGKTPNQPAAANMIEMVWDDALAGKAEEWAGKCIAGHDTYDDRQLDKFMFVGQNMFAGSNYKEVVQGWYDEYKDYTYEGKGCSAVCGHYTQVAWSKSYAVGCAAVNCKEKTGGSFAYGWLFICNYGPAGNFNDEAPYEVGAACSKCPKGTSCKNNLCA 204          
BLAST of SCP domain-containing protein vs. TrEMBL
Match: H2YDM6 (SCP domain-containing protein OS=Ciona savignyi OX=51511 PE=4 SV=1)

HSP 1 Score: 149.828 bits (377), Expect = 4.936e-41
Identity = 79/199 (39.70%), Postives = 112/199 (56.28%), Query Frame = 3
Query:   48 QAFSISSDLREDFLTAHNTFRRQVAQGKVQGQPAAGDMMEMVWSDELAATAENSANRCVFQHDNDEDRATKSFPDAGQNIYAGWEPKEAIKL--------WFDENKDYSYNSDGCNGVCGHYTQVAWAKSYAVGCASVHCE----GRNGFQYKYFVVCNYGPAGNYMGEKPYKPGSACSNCP-TGSTCNDGLCSKSGAG 605
            +A  ++ +    ++  HN  R +V       +PAA +M  M W  ELA  +E  +  C+ +H + E R  + +  AG+N++A   P+  +K+        WF+E + Y+ +++GC GVCGHYTQV WA+S AVGC    CE    G        FVVC YGPAGN +G KPY  G+ACS+CP T S C + LCS  GAG
Sbjct:   28 KAIELTHEEHMYYVDMHNAKRSEV-------EPAASNMQRMFWDKELADISEKHSRTCIDKHSSRESRQNEKYSSAGENLFA-ISPEVPVKVVLEHSLKGWFNEKRFYTLDTNGCTGVCGHYTQVTWAQSVAVGCGVTTCENFDLGGKVQDVGMFVVCTYGPAGNVVGSKPYLAGTACSDCPATHSNCTENLCSIPGAG 218          
BLAST of SCP domain-containing protein vs. TrEMBL
Match: A0A564YFQ7 (SCP domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS5585 PE=3 SV=1)

HSP 1 Score: 147.132 bits (370), Expect = 1.321e-40
Identity = 71/158 (44.94%), Postives = 101/158 (63.92%), Query Frame = 3
Query:   54 FSISSDLREDFLTAHNTFRRQVAQGKVQGQPAAGDMMEMVWSDELAATAENSANRCVFQHDNDEDRATKSFPDAGQNIYAGWEPKEAIKLWFDENKDYSYNSDGCNGVCGHYTQVAWAKSYAVGCASVHCEGRNGFQYKYFVVCNYGPAGNYMGEKPY 527
            F   S  +++ L   N +RR+VA G+V  QPA+  + ++ W+ EL A+A+  A+RC FQHD+ +DR T  F   GQNI       + +K+WF+E+KDY+Y+ + C+GVCGHYTQ+ WA +  VGC    C   +GF    FVVCNYGP GN+  +KPY
Sbjct:   46 FGRLSKDKQELLDLQNQYRREVAAGRVPNQPASSKIRDLKWNTELEASAQRHADRCRFQHDSSDDRKTAEFWWVGQNIAYSSSIAQNVKMWFEEHKDYNYSHNYCSGVCGHYTQLVWANTTDVGCGVSKCNF-SGFN-AVFVVCNYGPGGNFNNQKPY 201          
BLAST of SCP domain-containing protein vs. TrEMBL
Match: A0A4E0RMR8 (Peptidase inhibitor 16 OS=Fasciola hepatica OX=6192 GN=D915_001060 PE=3 SV=1)

HSP 1 Score: 143.665 bits (361), Expect = 1.665e-39
Identity = 69/162 (42.59%), Postives = 93/162 (57.41%), Query Frame = 3
Query:   51 AFSISSDLREDFLTAHNTFRRQVAQGKVQGQPAAGDMMEMVWSDELAATAENSANRCVFQHDNDEDRATKSFPDAGQNIYAGWEPKEAIKLWFDENKDYSYNSDGCN--GVCGHYTQVAWAKSYAVGCASVHCEGRNGFQYKYFVVCNYGPAGNYMGEKPYK 530
            + S +   R  F+  HN +R  +  GKV GQP A  M  + W +ELA  A+  AN+C   HD   +R TK F   GQN    +   + ++LWF+E++ YS+  + C    +CGHYTQV WA +  VGC    C GR  F Y Y VVCNYGP GN++G KPY+
Sbjct:   22 SMSTTRVERRRFVDEHNKYRTMLMAGKVSGQPRASSMKMLTWDEELARKAQFLANKCQVGHDTLMERQTKEFHWVGQNWAGTFNVSDTVRLWFEEHRHYSFEKNSCKPGRMCGHYTQVVWASTRKVGCGYRKCPGR-AFPYGYSVVCNYGPGGNFLGAKPYR 182          
BLAST of SCP domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000042591.1 (GLI pathogenesis related 1 [Source:NCBI gene;Acc:111193446])

HSP 1 Score: 132.494 bits (332), Expect = 1.524e-37
Identity = 80/198 (40.40%), Postives = 105/198 (53.03%), Query Frame = 3
Query:   87 LTAHNTFRRQVAQGKVQGQPAAGDMMEMVWSDELAATAENSANRCVFQHDN---DEDRATKSFPDAGQNIYAG--WEPKEAIKLWFDENKDYSYNSDGCNGVCGHYTQVAWAKSYAVGCASVHCEGRNGFQYK-------YFVVCNYGPAGNYMGEKPYKPGSACSNCPTGSTCNDGLCSKS--GAGKKIDPKPDKVP 638
            +T HN  R  V       QPAA +M  M W + LA TA   A +C+F H+    +E R    F   G+N++AG  +  + AIK W DE KDYSY++  C  VCGHYTQV WA +Y VGCA  +C   NG +         +  VCNYG AGN   +KPY+ G  C +C TG  C + LC  +   A +  +  PD  P
Sbjct:   35 VTEHNQHRANV-------QPAASNMRYMTWDEGLAVTARAWARKCLFIHNTHLKEEGRVHPVFSSVGENLWAGTHFSVQGAIKSWADEVKDYSYSTMTCKQVCGHYTQVVWANTYKVGCAVQYCP--NGVEQTPFYPRQAFIFVCNYGTAGNVFNQKPYRTGPECRDC-TGELCENRLCRNTDRDALRNYNWTPDWDP 222          
BLAST of SCP domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000036030.1 (peptidase inhibitor 16 [Source:NCBI gene;Acc:103029846])

HSP 1 Score: 127.872 bits (320), Expect = 4.460e-36
Identity = 74/198 (37.37%), Postives = 105/198 (53.03%), Query Frame = 3
Query:   75 REDFLTAHNTFRRQVAQGKVQGQPAAGDMMEMVWSDELAATAENSANRCVFQHDNDEDRATKSFPDAGQNIYAGWEP---KEAIKLWFDENKDYSYNSDGC--NGVCGHYTQVAWAKSYAVGCASVHCEGRN--GFQYKYFVVCNYGPAGNYMGEKPYKPGSACSNCPTG-STCNDGLCSKSGAGKKIDPKPDKVPTK 644
            ++  +  HN  R  V       +P A DM+ M WS ELA  A+  A +C+++H+ D           G+N++    P   ++A+  WF E+K YSY+++ C  N +CGHYTQ+ WAK+  VGC S  CE     GF+    +VCNY P GNYMG+KPY+ G  CS CP     C D  C  +      D  P  +PT+
Sbjct:   30 QQRIVNLHNHHRSTV-------EPPAADMIHMKWSGELALIAKEYATKCIWEHNPDSQNIM------GENLFITTGPLDIEKALSDWFMEHKHYSYDNNTCAENEMCGHYTQMVWAKTKEVGCGSHLCETVEALGFKNATLLVCNYLPLGNYMGQKPYQVGEQCSKCPDDLKNCVDQACDSTDR----DELPSMMPTE 210          
BLAST of SCP domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000029824.1 (peptidase inhibitor 16 [Source:NCBI gene;Acc:103029846])

HSP 1 Score: 129.028 bits (323), Expect = 4.713e-36
Identity = 74/197 (37.56%), Postives = 105/197 (53.30%), Query Frame = 3
Query:   75 REDFLTAHNTFRRQVAQGKVQGQPAAGDMMEMVWSDELAATAENSANRCVFQHDNDEDRATKSFPDAGQNIYAGWEP---KEAIKLWFDENKDYSYNSDGC--NGVCGHYTQVAWAKSYAVGCASVHCEGRN--GFQYKYFVVCNYGPAGNYMGEKPYKPGSACSNCPTG-STCNDGLCSKSGAGKKIDPKPDKVPT 641
            ++  +  HN  R  V       +P A DM+ M WS ELA  A+  A +C+++H+ D           G+N++    P   ++A+  WF E+K YSY+++ C  N +CGHYTQ+ WAK+  VGC S  CE     GF+    +VCNY P GNYMG+KPY+ G  CS CP     C D  C  +         PD++PT
Sbjct:   30 QQRIVNLHNHHRSTV-------EPPAADMIHMKWSGELALIAKEYATKCIWEHNPDSQNI------MGENLFITTGPLDIEKALSDWFMEHKHYSYDNNTCAENEMCGHYTQMVWAKTKEVGCGSHLCETVEALGFKNATLLVCNYLPLGNYMGQKPYQVGEQCSKCPDDLKNCVDQACDSTD--------PDELPT 205          
BLAST of SCP domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000031557.1 (peptidase inhibitor 16 [Source:NCBI gene;Acc:103029846])

HSP 1 Score: 125.946 bits (315), Expect = 3.170e-35
Identity = 70/182 (38.46%), Postives = 99/182 (54.40%), Query Frame = 3
Query:   75 REDFLTAHNTFRRQVAQGKVQGQPAAGDMMEMVWSDELAATAENSANRCVFQHDNDEDRATKSFPDAGQNIYAGWEP---KEAIKLWFDENKDYSYNSDGC--NGVCGHYTQVAWAKSYAVGCASVHCEGRN--GFQYKYFVVCNYGPAGNYMGEKPYKPGSACSNCPTG-STCNDGLCSKS 596
            ++  +  HN  R  V       +P A DM+ M WS ELA  A+  A +C+++H+ D           G+N++    P   ++A+  WF E+K YSY+++ C  N +CGHYTQ+ WAK+  VGC S  CE     GF+    +VCNY P GNYMG+KPY+ G  CS CP     C D  C  +
Sbjct:   30 QQRIVNLHNHHRSTV-------EPPAADMIHMKWSGELALIAKEYATKCIWEHNPDSQNI------MGENLFITTGPLDIEKALSDWFMEHKHYSYDNNTCAENEMCGHYTQMVWAKTKEVGCGSHLCETVEALGFKNATLLVCNYLPLGNYMGQKPYQVGEQCSKCPDDLKNCVDQACDST 198          
BLAST of SCP domain-containing protein vs. Ensembl Cavefish
Match: crispld2 (cysteine-rich secretory protein LCCL domain containing 2 [Source:ZFIN;Acc:ZDB-GENE-130131-1])

HSP 1 Score: 114.39 bits (285), Expect = 3.287e-29
Identity = 71/207 (34.30%), Postives = 99/207 (47.83%), Query Frame = 3
Query:   75 REDFLTAHNTFRRQVAQGKVQGQPAAGDMMEMVWSDELAATAENSANRCVFQHDNDEDRATKSFPDAGQNIYAGW----EPKEAIKLWFDENKDYSYN---------SDGCNG-VCGHYTQVAWAKSYAVGCASVHCEGRNGF----QYKYFVVCNYGPAGNYMGEKPYKPGSACSNCPT--GSTCNDGLCSKSGAGKKIDPKPDKV 635
            RE+ L  HN  R  V        P A +M  MVW DEL  +A + A +C ++H   +          GQN+   W     P   ++ W+DE KDY+Y           + C+G +C HYTQ+ WA +  VGCA   C   N +    +   ++VCNY P GN++GE PY  G  CS CP   G  C D LC K    +   P+ ++V
Sbjct:   61 REEILALHNKLREGV-------YPTASNMEYMVWDDELERSATHWAEQCQWEHGPQD-----LLMSIGQNLAVHWGRYRSPAYHVQAWYDEVKDYTYPYPHECNPWCPERCSGPMCTHYTQLVWATTSRVGCAVHTCSRMNVWGEIWENAIYLVCNYSPKGNWIGEAPYAHGRPCSQCPPSYGGGCRDNLCYKGDPVRPETPEMNEV 255          
BLAST of SCP domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000374.1 (pep scaffold:Pmarinus_7.0:GL476650:75849:87118:-1 gene:ENSPMAG00000000334.1 transcript:ENSPMAT00000000374.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 107.071 bits (266), Expect = 1.301e-27
Identity = 71/196 (36.22%), Postives = 92/196 (46.94%), Query Frame = 3
Query:   60 ISSDLREDFLTAHNTFRRQVAQGKVQGQPAAGDMMEMVWSDELAATAENSANRCVFQHDNDEDRATKSFPDAGQN--IYAGWEPKEA--IKLWFDENKDYSYNSD---------GCNG-VCGHYTQVAWAKSYAVGCASVHCEGRNGFQ----YKYFVVCNYGPAGNYMGEKPYKPGSACSNCPT--GSTCNDGLC 587
            I+ D R      HN  R  V        P A DM  M W  ELA  AE  A +C + H   +          GQN  +Y G E   A  ++ WFDE + Y Y  +          C G +C HYTQ+ WA+S  VGCA   C   + +     Y  ++VCNY P GN++GE PY+ G+ CS CP   G +C  GLC
Sbjct:    1 IADDERRALTEYHNRLRASV-------HPQAADMEHMSWDWELAGMAEAWAKQCKWGHGPSDQ-----LDAIGQNLAVYVGSERPLAYHVQAWFDEEEWYQYPEEKECSPECPHTCRGPICTHYTQLVWAESRRVGCAVHTCLDISVWDAVWPYALYLVCNYSPKGNWIGEAPYRQGTPCSRCPPRYGGSCRGGLC 184          
BLAST of SCP domain-containing protein vs. Ensembl Sea Lamprey
Match: CRISP3 (cysteine rich secretory protein 3 [Source:HGNC Symbol;Acc:HGNC:16904])

HSP 1 Score: 95.9005 bits (237), Expect = 1.935e-24
Identity = 60/185 (32.43%), Postives = 89/185 (48.11%), Query Frame = 3
Query:   57 SISSDLREDFLTAHNTFRRQVAQGKVQGQPAAGDMMEMVWSDELAATAENSANRCVFQHDNDEDRATKSFPDAGQNIYAGWEP---KEAIKLWFDENKDYSYNSD---GCNGVCGHYTQVAWAKSYAVGCASVHCEGRNGFQYKYFVVCNYGPAGNYMGE--KPYKPGSACSNCPTGSTCNDGLC 587
            ++   ++   +  HN  RR V        P+AG+M++M+W  E    A + AN C F H  D  R T  +   G+NI+    P     AI+ W++E     +  D      G  GHYTQ+ W  S+ +GCA  +C    G   KY  VC+Y P GN      +PY  G++C++CP    C + LC
Sbjct:   38 TVHGSVQTFIVDLHNDLRRNVT-------PSAGNMLQMMWKKEAYLNALSWANNCTFGHSPDARRKTTQW-TCGENIFMSSAPFTWNYAIRDWYNEVISPGFQYDVGSTTTGAVGHYTQLVWYNSFQLGCAVNYCPKNPGVA-KYLYVCHYCPMGNLNTRINRPYDLGTSCASCP--KNCVNNLC 211          
BLAST of SCP domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002250.1 (pep scaffold:Pmarinus_7.0:GL477299:1626:22672:-1 gene:ENSPMAG00000002049.1 transcript:ENSPMAT00000002250.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 88.9669 bits (219), Expect = 1.612e-22
Identity = 62/183 (33.88%), Postives = 84/183 (45.90%), Query Frame = 3
Query:   96 HNTFRRQVAQGKVQGQPAAGDMMEMVWSDELAATAENSANRCVFQHDNDEDRATKSFPDAGQNIYAGWEPKE-AIKLWFDENKDYSYNSDG---------CNG-VCGHYTQVAWAKSYAVGCASVHCEGRNGF----QYKYFVVCNYGPAGNYMGEKPYKPGSACSNCPT--GSTCNDGLCSK 593
            HN  R +V        P + +M  M W  +L   A     RC+      +  A   F   GQ  +    P    ++ W+DE KDY Y  +          CNG VC HYTQ+ WA +  VGCA   C   N +    +   ++VCNY P GN++G  PYK G ACS CP   G +C + LC +
Sbjct:    3 HNKLRGEV-------HPPSSNMEYMAWVKKLIKEAARYPGRCL---RLMQPMAMIHF--LGQPHWLSHRPPSFHVQAWYDEAKDYQYPYEQECNPWCPFRCNGAVCTHYTQLVWATTNRVGCAINTCYNMNVWGQIWEKAVYLVCNYSPKGNWIGLSPYKSGRACSECPPSYGGSCRNNLCYR 173          
BLAST of SCP domain-containing protein vs. Ensembl Sea Lamprey
Match: CRISP2 (cysteine rich secretory protein 2 [Source:HGNC Symbol;Acc:HGNC:12024])

HSP 1 Score: 65.855 bits (159), Expect = 1.141e-13
Identity = 40/99 (40.40%), Postives = 54/99 (54.55%), Query Frame = 3
Query:  309 EAIKLWFDE--NKDYSYNSDGCN-GVCGHYTQVAWAKSYAVGCASVHCEGRNGFQYKYFVVCNYGPAGNYMGE--KPYKPGSACSNCPTGSTCNDGLCS 590
            EAIK+W DE  +  + Y     N G+ GHYTQ+ W  +Y VGC   +C       YKY  +C Y P GN+     KPY  G +C +CP  + C+D LC+
Sbjct:   62 EAIKVWVDEANSPGFDYGKGPRNPGIVGHYTQIIWYSTYQVGCTINYCPEE---AYKYMYLCAYCPVGNWNNRLTKPYDEGPSCQDCP--NDCDDKLCT 155          
BLAST of SCP domain-containing protein vs. Ensembl Sea Lamprey
Match: CRISP2 (cysteine rich secretory protein 2 [Source:HGNC Symbol;Acc:HGNC:12024])

HSP 1 Score: 61.2326 bits (147), Expect = 2.495e-12
Identity = 46/133 (34.59%), Postives = 66/133 (49.62%), Query Frame = 3
Query:  276 GQNIYAGWEP---KEAIKLWFDENKDYSY---NSDGCNGVCGHYTQVAWAKSYAVGCASVHCEGRNGFQYKYFVVCNYGPAGNYMGE--KPYKPGSACSNCPTGSTCNDGLCSKSGAGKKIDPKPDKVPTKTT 650
            G+NI+    P   ++A+  W++E +   +         G  GHYTQV W  S+ +GCA  +C       YKY  VC+Y PAGN      +PY  GS C +CP  + C + LCS+S   + +    D  P KT 
Sbjct:    2 GENIFLATAPLSWQDAVLDWYNEAEVPGFIFGKGPAAPGDIGHYTQVVWYSSFQLGCAVNYCPEA---IYKYVYVCHYCPAGNLNTRLSRPYNEGSPCRSCP--NDCENDLCSESCPYRNLYANCD--PMKTI 127          
BLAST of SCP domain-containing protein vs. Ensembl Yeast
Match: PRY3 (Cell wall-associated protein involved in export of acetylated sterols; member of the CAP protein superfamily (cysteine-rich secretory proteins (CRISP), antigen 5, and pathogenesis related 1 proteins); role in mating efficiency; expression of full-length transcript is daughter cell-specific; in response to alpha factor, a short transcript starting at +452 is expressed and the long form is repressed by Ste12p [Source:SGD;Acc:S000003614])

HSP 1 Score: 75.8702 bits (185), Expect = 1.814e-16
Identity = 46/154 (29.87%), Postives = 70/154 (45.45%), Query Frame = 3
Query:   69 DLREDFLTAHNTFRRQVAQGKVQGQPAAGDMMEMVWSDELAATAENSANR--C--VFQHDNDEDRATKSFPDAGQNIYAGWEPKEAIKLWFDENKDYSYNSDGCNGVCGHYTQVAWAKSYAVGCASVHCEGRNGFQYKYFVVCNYGPAGNYMGE 518
            +   D L  HN FR               D   + WSD LA  A+N A++  C  V  H +            G+N+  G+    A+  W+ E   Y+Y++ G +   GH+TQV W  +  +GC   +C    G  +  ++VC+Y P GNY+GE
Sbjct:   24 NFESDVLNEHNKFRALHV-----------DTAPLTWSDTLATYAQNYADQYDCSGVLTHSDGP---------YGENLALGYTDTGAVDAWYGEISKYNYSNPGFSESTGHFTQVVWKSTAEIGCGYKYC----GTTWNNYIVCSYNPPGNYLGE 153          
BLAST of SCP domain-containing protein vs. Ensembl Yeast
Match: PRY1 (Sterol binding protein involved in the export of acetylated sterols; secreted glycoprotein and member of the CAP protein superfamily (cysteine-rich secretory proteins (CRISP), antigen 5, and pathogenesis related 1 proteins); sterol export function is redundant with that of PRY2; may be involved in detoxification of hydrophobic compounds; PRY1 has a paralog, PRY2, that arose from the whole genome duplication [Source:SGD;Acc:S000003615])

HSP 1 Score: 66.2402 bits (160), Expect = 1.519e-13
Identity = 40/121 (33.06%), Postives = 63/121 (52.07%), Query Frame = 3
Query:  156 DMMEMVWSDELAATAENSANRCVFQHDNDEDRATKSFPDAGQNIYAGWEPKEAIKLWFDENKDYSYNSDGCNGVCGHYTQVAWAKSYAVGCASVHCEGRNGFQYKYFVVCNYGPAGNYMGE 518
            D   + WSD LA+ A++ A+       +     T S    G+N+  G++   A+  W++E  +Y +++ G +   GH+TQV W  +  VGC    C G  G     +V+C+Y PAGNY GE
Sbjct:  179 DTPALSWSDTLASYAQDYADNY-----DCSGTLTHSGGPYGENLALGYDGPAAVDAWYNEISNYDFSNPGFSSNTGHFTQVVWKSTTQVGCGIKTCGGAWGD----YVICSYDPAGNYEGE 290          
BLAST of SCP domain-containing protein vs. Ensembl Yeast
Match: PRY2 (Sterol binding protein involved in the export of acetylated sterols; secreted glycoprotein and member of the CAP protein superfamily (cysteine-rich secretory proteins (CRISP), antigen 5, and pathogenesis related 1 proteins); sterol export function is redundant with that of PRY1; may be involved in detoxification of hydrophobic compounds; PRY2 has a paralog, PRY1, that arose from the whole genome duplication [Source:SGD;Acc:S000001721])

HSP 1 Score: 62.7734 bits (151), Expect = 3.771e-12
Identity = 37/121 (30.58%), Postives = 61/121 (50.41%), Query Frame = 3
Query:  156 DMMEMVWSDELAATAENSANRCVFQHDNDEDRATKSFPDAGQNIYAGWEPKEAIKLWFDENKDYSYNSDGCNGVCGHYTQVAWAKSYAVGCASVHCEGRNGFQYKYFVVCNYGPAGNYMGE 518
            D   + WSD LA  A+N A+     +D   +      P  G+N+  G+    ++  W++E   Y Y++ G +   GH+TQV W  +  VGC    C G    ++  +++C+Y  AGN +GE
Sbjct:  209 DTGSLTWSDTLATYAQNYADS----YDCSGNLVHSGGP-YGENLALGYGTTGSVDAWYNEITSYDYSNPGFSESAGHFTQVVWKGTSEVGCGLKSCGG----EWGDYIICSYKAAGNVIGE 320          
BLAST of SCP domain-containing protein vs. Ensembl Nematostella
Match: EDO35383 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLP0])

HSP 1 Score: 59.6918 bits (143), Expect = 1.346e-11
Identity = 47/152 (30.92%), Postives = 66/152 (43.42%), Query Frame = 3
Query:   72 LREDFLTAHNTFRRQVAQGKVQGQPAAGDMMEMVWSDELAATAENSANRCVFQHDNDEDRATKSFPDAGQNIYAGWEPKE-----AIKLWFDENKDYSYNSDGCNGVCGHYTQVAWAKSYAVGCASVHCEGRNGFQYKYFVVCNYGPAGNYM 512
             ++D +  HN  R Q    KV             WSD+LA  A+  AN  + ++   E  +  S PD G+N++    P E      +  W+ E   Y +   G     GH+TQV W  +  V  AS   EG +G  Y   VV  Y PAGN +
Sbjct:    3 FQKDCIEVHNELRAQHQAPKV------------TWSDQLAKDAQAWANH-IAKNGRLEHSSPDSRPDQGENLFMS-SPGEINAGDVVDEWYSEVSKYKFGKPGWQSGTGHFTQVVWKGTKEVAMAS--AEGPDGSVY---VVGRYKPAGNVL 135          
BLAST of SCP domain-containing protein vs. Ensembl Nematostella
Match: EDO48881 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHM8])

HSP 1 Score: 58.9214 bits (141), Expect = 2.316e-11
Identity = 44/156 (28.21%), Postives = 65/156 (41.67%), Query Frame = 3
Query:   69 DLREDFLTAHNTFRRQVAQGKVQGQPAAGDMMEMVWSDELAATA----ENSANRCVFQHDNDEDRATKSFPDAGQNIYAGWEPKEAIKLWFDENKDYSYNSDGCNGVCGHYTQVAWAKSYAVGCASVHCEGRNGFQYKYFVVCNYGPAGNYMGEKP 524
            + + D L  HN +R Q       G  A      + W+  LA+ A    EN A R   QH +  +   +S       +  G   ++A  +W+ E   Y + + G +   GH+TQV WA S  +G               +FVV  Y P GN MG+ P
Sbjct:    1 EFKNDILKTHNDYRAQ------HGTKA------LKWNARLASEAQSWAENLAQRNAIQHSSSREYG-ESIAYMSGAVLTG---RKATDMWYGEVDKYRFENPGFSTSSGHFTQVVWAGSTEMGAGKATSSSG-----AHFVVARYTPPGNVMGQFP 135          
BLAST of SCP domain-containing protein vs. Ensembl Nematostella
Match: EDO48880 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHM7])

HSP 1 Score: 58.9214 bits (141), Expect = 2.780e-11
Identity = 46/150 (30.67%), Postives = 68/150 (45.33%), Query Frame = 3
Query:   87 LTAHNTFRRQVAQGKVQGQPAAGDMMEMVWSDELAAT----AENSANRCVFQHDNDEDRATKSFPDAGQNIYAGWEPKEAIKLWFDENKDYSYNSDGCNGVCGHYTQVAWAKSYAVGCASVHCEGRNGFQYKYFVVCNYGPAGNYMGEKP 524
            L +HN +R Q       G P       + WS +LA+     A++ A R   QH   E     +F  +G  +  G       ++W+DE + Y +N+ G +   GH+TQV W  S  +G A      +NG  Y    V  Y PAGN +G+ P
Sbjct:   10 LDSHNAYRAQ------HGAPP------LKWSAKLASDCDKWAKDLARRNTMQHSKGEYGENLAFA-SGYELSGG----RTTEMWYDEIQKYRFNNPGFSSGTGHFTQVVWVGSQEMGVAK--AVSKNGAHY---AVARYYPAGNVIGQFP 137          
BLAST of SCP domain-containing protein vs. Ensembl Nematostella
Match: EDO31682 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SX85])

HSP 1 Score: 58.151 bits (139), Expect = 5.392e-11
Identity = 42/155 (27.10%), Postives = 69/155 (44.52%), Query Frame = 3
Query:   69 DLREDFLTAHNTFRRQVAQGKVQGQPAAGDMMEMVWSDELAATAENSANRCVFQHDNDEDRATKSFPDAGQNIYA--GWEPKEA----IKLWFDENKDYSYNSDGCNGVCGHYTQVAWAKSYAVGCASVHCEGRNGFQYKYFVVCNYGPAGNYMG 515
            +L++  L AHN FR +   GK            + WS ELA+ A+  AN        + D  T    + G+NI+   G  P+EA    ++ W+ E K+Y + +   +    H++Q+ W  +  +G      +  N     +F+V  Y P GN  G
Sbjct:    2 ELQKQCLDAHNEFRTRHGAGK------------LAWSGELASEAQKWANHLASIDQMERDPLT----NGGENIFYMYGGNPREACERAVRNWYQEVKNYDFKNPHSDPSTSHFSQLVWKGTKKLGVGEAQSKSGN-----FFLVARYHPKGNMEG 135          
BLAST of SCP domain-containing protein vs. Ensembl Nematostella
Match: EDO49505 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGC8])

HSP 1 Score: 57.3806 bits (137), Expect = 1.114e-10
Identity = 47/156 (30.13%), Postives = 69/156 (44.23%), Query Frame = 3
Query:   66 SDLREDFLTAHNTFRRQVAQGKVQGQPAAGDMMEMVWSDELAATAENSANRCVFQHDNDEDRATKSFPDAGQNIYAGWEPKEA-----IKLWFDENKDYSYNSDGCNGVCGHYTQVAWAKSYAVGCASVHCEGRNGFQYKYFVVCNYGPAGNYMGE 518
            S+ ++D +  HN  R +    KV             WS +LAA A+  AN  + ++   E  +  S P  G+N+Y    P E      +  W+ E   Y ++  G     GH+TQV W  +  V  AS   EG +G     FVV  Y PAGN + +
Sbjct:    2 SNFQKDCVDVHNELRAKHQAPKV------------TWSAQLAADAQVWANH-IAKNGRLEHSSADSRPGQGENLYMC-SPSEINAGDIVDEWYSEISKYKFDKPGWQSGTGHFTQVVWKGTKEVAMAS--AEGADG---SVFVVGRYKPAGNVLSQ 138          
BLAST of SCP domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000023160.2 (peptidase inhibitor 16 [Source:NCBI gene;Acc:101164782])

HSP 1 Score: 124.405 bits (311), Expect = 1.371e-33
Identity = 69/194 (35.57%), Postives = 103/194 (53.09%), Query Frame = 3
Query:   51 AFSISSDLREDFLT-AHNTFRRQVAQGKVQGQPAAGDMMEMVWSDELAATAENSANRCVFQHDNDEDRATKSFPDAGQNIYAG---WEPKEAIKLWFDENKDYSYNSDGCN--GVCGHYTQVAWAKSYAVGCASVHCEGRNGFQYK--YFVVCNYGPAGNYMGEKPYKPGSACSNCPTG-STCNDGLCSKSGAG 605
             +S+ +D +E+ L   HN +R QV+       P+A  M+ + W   L   AE  A +C+++H+ +         D G+N++AG    +  EA++ WF E  DYSY ++ C+   +CGHYTQ+ WA ++ VGCA   C       +    ++VCNY PAGNY  E+PY  G  CS CP     C + LC K   G
Sbjct:   53 TWSLLTDQQEEMLVELHNHYRGQVS-------PSAAAMLPLKWDGNLKLVAEGYAAKCIWEHNTE-------LEDTGENLFAGTGKLDLSEAVEKWFLERLDYSYENNSCDEDKMCGHYTQMVWADTHRVGCAVHFCNTIENLDWNNVSYLVCNYFPAGNYDDERPYVEGDWCSRCPEDLDVCQNHLCVKKEVG 232          
BLAST of SCP domain-containing protein vs. Ensembl Medaka
Match: crispld2 (cysteine rich secretory protein LCCL domain containing 2 [Source:NCBI gene;Acc:101174090])

HSP 1 Score: 113.235 bits (282), Expect = 1.145e-28
Identity = 68/193 (35.23%), Postives = 93/193 (48.19%), Query Frame = 3
Query:   75 REDFLTAHNTFRRQVAQGKVQGQPAAGDMMEMVWSDELAATAENSANRCVFQHDNDEDRATKSFPDAGQNIYAGW----EPKEAIKLWFDENKDYSYN---------SDGCNG-VCGHYTQVAWAKSYAVGCASVHCEGRNGF----QYKYFVVCNYGPAGNYMGEKPYKPGSACSNCPT--GSTCNDGLCSK 593
            RE+ L  HN  R  V        P+A +M  MVW DEL  +A   A  C ++H   +          GQN+   W     P   ++ W+DE KDY+Y           + C+G +C HYTQ+ WA +  VGCA   C   N +    +   ++VCNY P GN++GE PY+ G  CS CP   G  C + LC K
Sbjct:   76 REEILLLHNKLRSSV-------YPSAANMEHMVWDDELERSATQWAEECRWEHGPQD-----LLMSIGQNLAVHWGRYRSPAFHVQAWYDEVKDYTYPYPSECNPWCPERCSGPMCTHYTQLVWATTNRVGCAVHVCPKMNVWGEIWETAVYLVCNYSPKGNWIGEAPYRHGRPCSQCPPSFGGGCRNNLCYK 256          
BLAST of SCP domain-containing protein vs. Ensembl Medaka
Match: crispld1a (cysteine rich secretory protein LCCL domain containing 1 [Source:NCBI gene;Acc:101172850])

HSP 1 Score: 109.383 bits (272), Expect = 2.354e-27
Identity = 71/199 (35.68%), Postives = 94/199 (47.24%), Query Frame = 3
Query:   57 SISSDLREDFLTAHNTFRRQVAQGKVQGQPAAGDMMEMVWSDELAATAENSANRCVFQHDNDEDRATKSFPDAGQNIYAGW----EPKEAIKLWFDENKDYS---------YNSDGCNG-VCGHYTQVAWAKSYAVGCASVHCEGRNGFQYKY----FVVCNYGPAGNYMGEKPYKPGSACSNCPT--GSTCNDGLCSK 593
            +I+    +  L  HN  R QV        P A +M  M+W  EL  +AE  A  C+++H           P  GQN+ A W     P   ++ W+DE KDYS         Y    C+G VC HYTQ+ WA S  +GCA   C   + +   +    ++VCNY P GN+ G  PYK G+ CS CP   G  C D LC K
Sbjct:   55 AITDSDAQLILDLHNKLRGQV-------YPPASNMEYMMWDTELERSAEEWAETCLWEHG-----PASLLPQIGQNLGAHWGRYQPPTFHVQAWYDEVKDYSFPYPQECNPYCPFRCSGPVCTHYTQLVWATSSRIGCAINLCHNMDVWGQIWAKAVYLVCNYSPKGNWWGHAPYKHGTPCSACPPSYGGGCRDNLCYK 241          
BLAST of SCP domain-containing protein vs. Ensembl Medaka
Match: crispld1a (cysteine rich secretory protein LCCL domain containing 1 [Source:NCBI gene;Acc:101172850])

HSP 1 Score: 109.383 bits (272), Expect = 2.724e-27
Identity = 71/199 (35.68%), Postives = 94/199 (47.24%), Query Frame = 3
Query:   57 SISSDLREDFLTAHNTFRRQVAQGKVQGQPAAGDMMEMVWSDELAATAENSANRCVFQHDNDEDRATKSFPDAGQNIYAGW----EPKEAIKLWFDENKDYS---------YNSDGCNG-VCGHYTQVAWAKSYAVGCASVHCEGRNGFQYKY----FVVCNYGPAGNYMGEKPYKPGSACSNCPT--GSTCNDGLCSK 593
            +I+    +  L  HN  R QV        P A +M  M+W  EL  +AE  A  C+++H           P  GQN+ A W     P   ++ W+DE KDYS         Y    C+G VC HYTQ+ WA S  +GCA   C   + +   +    ++VCNY P GN+ G  PYK G+ CS CP   G  C D LC K
Sbjct:   83 AITDSDAQLILDLHNKLRGQV-------YPPASNMEYMMWDTELERSAEEWAETCLWEHG-----PASLLPQIGQNLGAHWGRYQPPTFHVQAWYDEVKDYSFPYPQECNPYCPFRCSGPVCTHYTQLVWATSSRIGCAINLCHNMDVWGQIWAKAVYLVCNYSPKGNWWGHAPYKHGTPCSACPPSYGGGCRDNLCYK 269          
BLAST of SCP domain-containing protein vs. Ensembl Medaka
Match: pi15a (peptidase inhibitor 15 [Source:NCBI gene;Acc:101173911])

HSP 1 Score: 102.834 bits (255), Expect = 2.319e-26
Identity = 68/201 (33.83%), Postives = 101/201 (50.25%), Query Frame = 3
Query:   51 AFSISSDLREDFLTAHNTFRRQVAQGKVQGQ--PAAGDMMEMVWSDELAATAENSANRCVFQHDNDEDRATKSFPDAGQNIYAG----WEPKEAIKLWFDENKDYSYN-SDGCNG---------VCGHYTQVAWAKSYAVGCASVHCEGRNGF----QYKYFVVCNYGPAGNYMGEKPYKPGSACSNCPT--GSTCNDGLC 587
            A S+S   R  +++ ++         KV+G+  P A +M  MVW + LA TAE+ A+ C+++H       +      GQN+           + +K W+DE KDYS+     CN          +C HYTQ+ WA S  VGCA   C   N +    +   ++VCNY P GN++GE PYK G  CS CP   G +C++ +C
Sbjct:   49 ATSLSKTRRRRYISQNDMLAILDYHNKVRGKVFPPASNMEYMVWDETLAKTAEDWAHACLWEHG-----PSHLLRFLGQNLSVRTGRYRSILQLVKPWYDEVKDYSFPYPRDCNPRCPLRCYGPMCTHYTQMVWATSNKVGCAIHTCYNMNVWGSVWKRATYLVCNYSPKGNWIGEAPYKVGVPCSACPPSYGGSCSNNMC 244          
BLAST of SCP domain-containing protein vs. Planmine SMEST
Match: SMESG000004532.1 (SMESG000004532.1)

HSP 1 Score: 424.861 bits (1091), Expect = 6.004e-153
Identity = 200/201 (99.50%), Postives = 200/201 (99.50%), Query Frame = 3
Query:   48 QAFSISSDLREDFLTAHNTFRRQVAQGKVQGQPAAGDMMEMVWSDELAATAENSANRCVFQHDNDEDRATKSFPDAGQNIYAGWEPKEAIKLWFDENKDYSYNSDGCNGVCGHYTQVAWAKSYAVGCASVHCEGRNGFQYKYFVVCNYGPAGNYMGEKPYKPGSACSNCPTGSTCNDGLCSKSGAGKKIDPKPDKVPTKTT 650
            QAFSISSDLREDFLTAHNTFRRQVAQGKVQGQPAAGDMMEMVWSDELAATAENSANRCVFQHDNDEDRATKSFPDAGQNIYAGWEPKEAIKLWFDENKDYSYNSDGCNGVCGHYTQVAWAKSYAVGCASVHCEGRNGFQYKYFVVCNYGPAGNYMGEKPYKPGSACSNCPTGSTCNDGLCSKSGAGKKIDPKPDKVPTKT 
Sbjct:   15 QAFSISSDLREDFLTAHNTFRRQVAQGKVQGQPAAGDMMEMVWSDELAATAENSANRCVFQHDNDEDRATKSFPDAGQNIYAGWEPKEAIKLWFDENKDYSYNSDGCNGVCGHYTQVAWAKSYAVGCASVHCEGRNGFQYKYFVVCNYGPAGNYMGEKPYKPGSACSNCPTGSTCNDGLCSKSGAGKKIDPKPDKVPTKTI 215          
BLAST of SCP domain-containing protein vs. Planmine SMEST
Match: SMESG000024103.1 (SMESG000024103.1)

HSP 1 Score: 294.278 bits (752), Expect = 6.420e-102
Identity = 136/181 (75.14%), Postives = 149/181 (82.32%), Query Frame = 3
Query:   48 QAFSISSDLREDFLTAHNTFRRQVAQGKVQGQPAAGDMMEMVWSDELAATAENSANRCVFQHDNDEDRATKSFPDAGQNIYAGWEPKEAIKLWFDENKDYSYNSDGCNGVCGHYTQVAWAKSYAVGCASVHCEGRNGFQYKYFVVCNYGPAGNYMGEKPYKPGSACSNCPTGSTCNDGLCS 590
            QAFSI+SDLR+DFL AHN FRRQVAQGKV  QP A DMMEMVW+DELAATAE  ANRCVF HD+DE+R TKSFP  GQNIYAGWEPK+A +LWF+E+ DY+Y +D CNGVCGHYTQV WA S AVGCAS HCE  NGF+YKYFVVCNYGP GNY   KPY  G  CS CP GSTCN+GLCS
Sbjct:   15 QAFSITSDLRDDFLMAHNKFRRQVAQGKVPNQPVAADMMEMVWNDELAATAEKWANRCVFGHDSDENRQTKSFPITGQNIYAGWEPKDATELWFNEHTDYTYKNDNCNGVCGHYTQVVWANSNAVGCASSHCEKVNGFRYKYFVVCNYGPTGNYEFVKPYISGETCSKCPAGSTCNEGLCS 195          
BLAST of SCP domain-containing protein vs. Planmine SMEST
Match: SMESG000024103.1 (SMESG000024103.1)

HSP 1 Score: 266.544 bits (680), Expect = 2.171e-91
Identity = 124/166 (74.70%), Postives = 135/166 (81.33%), Query Frame = 3
Query:   93 AHNTFRRQVAQGKVQGQPAAGDMMEMVWSDELAATAENSANRCVFQHDNDEDRATKSFPDAGQNIYAGWEPKEAIKLWFDENKDYSYNSDGCNGVCGHYTQVAWAKSYAVGCASVHCEGRNGFQYKYFVVCNYGPAGNYMGEKPYKPGSACSNCPTGSTCNDGLCS 590
            AHN FRRQVAQGKV  QP A DMMEMVW+DELAATAE  ANRCVF HD+DE+R TKSFP  GQNIYAGWEPK+A +LWF+E+ DY+Y +D CNGVCGHYTQV WA S AVGCAS HCE  NGF+YKYFVVCNYGP GNY   KPY  G  CS CP GSTCN+GLCS
Sbjct:    2 AHNKFRRQVAQGKVPNQPVAADMMEMVWNDELAATAEKWANRCVFGHDSDENRQTKSFPITGQNIYAGWEPKDATELWFNEHTDYTYKNDNCNGVCGHYTQVVWANSNAVGCASSHCEKVNGFRYKYFVVCNYGPTGNYEFVKPYISGETCSKCPAGSTCNEGLCS 167          
BLAST of SCP domain-containing protein vs. Planmine SMEST
Match: SMESG000024172.1 (SMESG000024172.1)

HSP 1 Score: 232.646 bits (592), Expect = 5.456e-78
Identity = 118/182 (64.84%), Postives = 131/182 (71.98%), Query Frame = 3
Query:   48 QAFSISSDLREDFLTAHNTFRRQVAQGKVQGQPAAGDMMEMVWSDELAATAENSANRCVFQHDNDEDRATKSFPDAGQNIYAGWEPKEAIKLWFDENKDYSYNSDGCNGVCGHYTQVAWAKSYAVGCASVHCEGRNGFQYKYFVVCNYGPAGNYMGEKPYKPGSACSNCPTGSTCNDGLCSK 593
            QAFSI+SDLR+DFL AHN FRRQVAQGKV GQPAA DMMEMVWSDELAATAE  A+RCVF H  DE+R TKSFP  GQNIYAGWEPK+A KLWF+E+  Y+YN+D CNGVCGHYTQV WA +  +  +    + RN               GNY   KPY  G  CS CP GSTCNDGLCSK
Sbjct:   15 QAFSITSDLRDDFLMAHNKFRRQVAQGKVPGQPAASDMMEMVWSDELAATAEKWASRCVFGH--DENRQTKSFPITGQNIYAGWEPKDATKLWFNEHMHYTYNNDHCNGVCGHYTQVVWANNTNI-LSFATMDQRN---------------GNYQFVKPYIAGENCSKCPAGSTCNDGLCSK 178          
BLAST of SCP domain-containing protein vs. Planmine SMEST
Match: SMESG000024172.1 (SMESG000024172.1)

HSP 1 Score: 232.646 bits (592), Expect = 5.635e-78
Identity = 118/182 (64.84%), Postives = 131/182 (71.98%), Query Frame = 3
Query:   48 QAFSISSDLREDFLTAHNTFRRQVAQGKVQGQPAAGDMMEMVWSDELAATAENSANRCVFQHDNDEDRATKSFPDAGQNIYAGWEPKEAIKLWFDENKDYSYNSDGCNGVCGHYTQVAWAKSYAVGCASVHCEGRNGFQYKYFVVCNYGPAGNYMGEKPYKPGSACSNCPTGSTCNDGLCSK 593
            QAFSI+SDLR+DFL AHN FRRQVAQGKV GQPAA DMMEMVWSDELAATAE  A+RCVF H  DE+R TKSFP  GQNIYAGWEPK+A KLWF+E+  Y+YN+D CNGVCGHYTQV WA +  +  +    + RN               GNY   KPY  G  CS CP GSTCNDGLCSK
Sbjct:   14 QAFSITSDLRDDFLMAHNKFRRQVAQGKVPGQPAASDMMEMVWSDELAATAEKWASRCVFGH--DENRQTKSFPITGQNIYAGWEPKDATKLWFNEHMHYTYNNDHCNGVCGHYTQVVWANNTNI-LSFATMDQRN---------------GNYQFVKPYIAGENCSKCPAGSTCNDGLCSK 177          
The following BLAST results are available for this feature:
BLAST of SCP domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GLIPR11.137e-3540.76GLI pathogenesis related 1 [Source:HGNC Symbol;Acc... [more]
GLIPR1L12.378e-3540.80GLIPR1 like 1 [Source:HGNC Symbol;Acc:HGNC:28392][more]
GLIPR1L12.640e-3540.80GLIPR1 like 1 [Source:HGNC Symbol;Acc:HGNC:28392][more]
CRISP25.772e-3435.64cysteine rich secretory protein 2 [Source:HGNC Sym... [more]
CRISP25.772e-3435.64cysteine rich secretory protein 2 [Source:HGNC Sym... [more]
back to top
BLAST of SCP domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
scl-53.205e-2833.67SCP-Like extracellular protein [Source:UniProtKB/... [more]
scl-144.242e-2632.80SCP-Like extracellular protein [Source:UniProtKB/... [more]
scl-101.030e-2534.21SCP-Like extracellular protein [Source:UniProtKB/... [more]
scl-21.212e-2334.36SCP-Like extracellular protein [Source:UniProtKB/... [more]
scl-21.212e-2334.36SCP-Like extracellular protein [Source:UniProtKB/... [more]
back to top
BLAST of SCP domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG84831.313e-2937.24gene:FBgn0038126 transcript:FBtr0082782[more]
CG179749.519e-1832.81gene:FBgn0034624 transcript:FBtr0071611[more]
CG326792.120e-1632.61gene:FBgn0052679 transcript:FBtr0071469[more]
CG94001.639e-1529.03gene:FBgn0030562 transcript:FBtr0073920[more]
CG425647.374e-1430.48gene:FBgn0260766 transcript:FBtr0301268[more]
back to top
BLAST of SCP domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
glipr1a9.805e-3540.45GLI pathogenesis-related 1a [Source:ZFIN;Acc:ZDB-G... [more]
glipr1a2.123e-3337.69GLI pathogenesis-related 1a [Source:ZFIN;Acc:ZDB-G... [more]
crispld24.314e-3033.82cysteine-rich secretory protein LCCL domain contai... [more]
CU914487.13.699e-2936.24peptidase inhibitor 16-like [Source:NCBI gene;Acc:... [more]
crispld1a6.623e-2834.13cysteine-rich secretory protein LCCL domain contai... [more]
back to top
BLAST of SCP domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
crispld21.561e-3035.50cysteine-rich secretory protein LCCL domain contai... [more]
crispld23.404e-3035.75cysteine-rich secretory protein LCCL domain contai... [more]
crispld25.256e-3035.75cysteine-rich secretory protein LCCL domain contai... [more]
ENSXETT00000036788.11.344e-2832.26pep primary_assembly:Xenopus_tropicalis_v9.1:KV464... [more]
CRISPLD11.277e-2635.68cysteine-rich secretory protein LCCL domain contai... [more]
back to top
BLAST of SCP domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pi167.393e-3835.32peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:... [more]
Pi167.393e-3835.32peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:... [more]
Pi166.550e-3735.32peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:... [more]
Pi169.734e-3736.76peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:... [more]
Glipr1l11.401e-3437.36GLI pathogenesis-related 1 like 1 [Source:MGI Symb... [more]
back to top
BLAST of SCP domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9ET66|PI16_MOUSE4.582e-3635.32Peptidase inhibitor 16 OS=Mus musculus OX=10090 GN... [more]
sp|Q32LB5|GPRL1_BOVIN1.987e-3542.02GLIPR1-like protein 1 OS=Bos taurus OX=9913 GN=GLI... [more]
sp|Q60477|CRIS2_CAVPO5.155e-3537.23Cysteine-rich secretory protein 2 OS=Cavia porcell... [more]
sp|P48060|GLIP1_HUMAN5.460e-3540.76Glioma pathogenesis-related protein 1 OS=Homo sapi... [more]
sp|B0VXV6|CRVP_SISCA5.511e-3537.69Cysteine-rich venom protein 2 OS=Sistrurus catenat... [more]
back to top
BLAST of SCP domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A172RVP67.737e-112100.00TPX-1 protein (Fragment) OS=Schmidtea mediterranea... [more]
A0A1C9ZZV54.384e-6050.28SCP domain-containing protein (Fragment) OS=Dugesi... [more]
H2YDM64.936e-4139.70SCP domain-containing protein OS=Ciona savignyi OX... [more]
A0A564YFQ71.321e-4044.94SCP domain-containing protein OS=Hymenolepis dimin... [more]
A0A4E0RMR81.665e-3942.59Peptidase inhibitor 16 OS=Fasciola hepatica OX=619... [more]
back to top
BLAST of SCP domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000042591.11.524e-3740.40GLI pathogenesis related 1 [Source:NCBI gene;Acc:1... [more]
ENSAMXT00000036030.14.460e-3637.37peptidase inhibitor 16 [Source:NCBI gene;Acc:10302... [more]
ENSAMXT00000029824.14.713e-3637.56peptidase inhibitor 16 [Source:NCBI gene;Acc:10302... [more]
ENSAMXT00000031557.13.170e-3538.46peptidase inhibitor 16 [Source:NCBI gene;Acc:10302... [more]
crispld23.287e-2934.30cysteine-rich secretory protein LCCL domain contai... [more]
back to top
BLAST of SCP domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000374.11.301e-2736.22pep scaffold:Pmarinus_7.0:GL476650:75849:87118:-1 ... [more]
CRISP31.935e-2432.43cysteine rich secretory protein 3 [Source:HGNC Sym... [more]
ENSPMAT00000002250.11.612e-2233.88pep scaffold:Pmarinus_7.0:GL477299:1626:22672:-1 g... [more]
CRISP21.141e-1340.40cysteine rich secretory protein 2 [Source:HGNC Sym... [more]
CRISP22.495e-1234.59cysteine rich secretory protein 2 [Source:HGNC Sym... [more]
back to top
BLAST of SCP domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
PRY31.814e-1629.87Cell wall-associated protein involved in export of... [more]
PRY11.519e-1333.06Sterol binding protein involved in the export of a... [more]
PRY23.771e-1230.58Sterol binding protein involved in the export of a... [more]
back to top
BLAST of SCP domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO353831.346e-1130.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO488812.316e-1128.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO488802.780e-1130.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO316825.392e-1127.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495051.114e-1030.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SCP domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000023160.21.371e-3335.57peptidase inhibitor 16 [Source:NCBI gene;Acc:10116... [more]
crispld21.145e-2835.23cysteine rich secretory protein LCCL domain contai... [more]
crispld1a2.354e-2735.68cysteine rich secretory protein LCCL domain contai... [more]
crispld1a2.724e-2735.68cysteine rich secretory protein LCCL domain contai... [more]
pi15a2.319e-2633.83peptidase inhibitor 15 [Source:NCBI gene;Acc:10117... [more]
back to top
BLAST of SCP domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000004532.16.004e-15399.50SMESG000004532.1[more]
SMESG000024103.16.420e-10275.14SMESG000024103.1[more]
SMESG000024103.12.171e-9174.70SMESG000024103.1[more]
SMESG000024172.15.456e-7864.84SMESG000024172.1[more]
SMESG000024172.15.635e-7864.84SMESG000024172.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024356 ID=SMED30024356|Name=SCP domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=674bp
CAACAATGATTTTATTATCGATATTTTTGGTGATTTCATTGATTTCACAG
GCTTTTTCCATTTCAAGTGACCTCCGAGAAGACTTTCTAACGGCCCATAA
CACCTTTCGTAGGCAAGTAGCTCAAGGTAAAGTCCAAGGTCAACCGGCAG
CTGGGGATATGATGGAAATGGTCTGGAGCGATGAATTGGCGGCAACAGCA
GAAAATTCCGCAAACCGTTGCGTATTTCAACACGACAATGATGAAGATCG
TGCGACAAAAAGCTTTCCAGATGCAGGACAAAATATCTATGCCGGTTGGG
AACCAAAGGAAGCGATTAAGCTTTGGTTTGATGAAAACAAAGATTATTCC
TACAATAGCGACGGCTGCAATGGAGTATGTGGACATTATACTCAGGTTGC
TTGGGCAAAAAGCTATGCAGTTGGATGTGCGAGTGTACATTGTGAAGGAA
GAAACGGATTCCAGTATAAATATTTTGTCGTTTGCAATTATGGACCAGCT
GGAAATTACATGGGAGAGAAACCATATAAACCAGGAAGTGCCTGCTCAAA
TTGTCCAACAGGTTCTACATGCAATGACGGACTCTGTTCAAAATCAGGAG
CTGGCAAAAAAATAGATCCGAAACCAGATAAAGTTCCGACAAAAACAACA
AATAATAATAATAATAATAATAAT
back to top

protein sequence of SMED30024356-orf-1

>SMED30024356-orf-1 ID=SMED30024356-orf-1|Name=SMED30024356-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=224bp
TMILLSIFLVISLISQAFSISSDLREDFLTAHNTFRRQVAQGKVQGQPAA
GDMMEMVWSDELAATAENSANRCVFQHDNDEDRATKSFPDAGQNIYAGWE
PKEAIKLWFDENKDYSYNSDGCNGVCGHYTQVAWAKSYAVGCASVHCEGR
NGFQYKYFVVCNYGPAGNYMGEKPYKPGSACSNCPTGSTCNDGLCSKSGA
GKKIDPKPDKVPTKTTNNNNNNNN
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
GO:0005576extracellular region
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000420parapharyngeal region
Vocabulary: INTERPRO
TermDefinition
IPR035940CAP_sf
IPR001283CRISP-related
IPR002413V5_allergen-like
IPR014044CAP_domain
IPR018244Allrgn_V5/Tpx1_CS
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001283Cysteine-rich secretory protein-relatedPRINTSPR00837V5TPXLIKEcoord: 104..117
score: 39.77
coord: 158..171
score: 57.67
coord: 56..74
score: 39.94
coord: 126..142
score: 59.94
IPR001283Cysteine-rich secretory protein-relatedPANTHERPTHR10334CYSTEINE-RICH SECRETORY PROTEIN-RELATEDcoord: 4..199
IPR002413Venom allergen 5-likePRINTSPR00838V5ALLERGENcoord: 19..35
score: 22.79
coord: 102..117
score: 43.36
coord: 125..144
score: 52.81
IPR014044CAP domainSMARTSM00198SCP_3coord: 23..171
e-value: 7.0E-58
score: 208.3
IPR014044CAP domainPFAMPF00188CAPcoord: 29..163
e-value: 3.1E-22
score: 79.7
IPR035940CAP superfamilyGENE3DG3DSA:3.40.33.10coord: 14..204
e-value: 1.5E-64
score: 219.2
IPR035940CAP superfamilySUPERFAMILYSSF55797PR-1-likecoord: 6..178
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 201..224
NoneNo IPR availablePANTHERPTHR10334:SF220GLIPR1-LIKE PROTEIN 1coord: 4..199
NoneNo IPR availableCDDcd05380CAP_eukcoord: 25..164
e-value: 6.13007E-50
score: 157.616
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..17
score: 0.865
IPR018244Allergen V5/Tpx-1-related, conserved sitePROSITEPS01010CRISP_2coord: 158..169
IPR018244Allergen V5/Tpx-1-related, conserved sitePROSITEPS01009CRISP_1coord: 127..137