Glutathione S-transferase protein

Overview
NameGlutathione S-transferase protein
Smed IDSMED30024350
Length (bp)744
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Glutathione S-transferase protein (SMED30024350) t-SNE clustered cells

Violin plots show distribution of expression levels for Glutathione S-transferase protein (SMED30024350) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Glutathione S-transferase protein (SMED30024350) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Glutathione S-transferase protein (SMED30024350) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024350

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 15

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30024350h1SMcG0001488 Contig1715GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30024350h1SMcG0001488 Contig1715GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
nervous systemSMED30024350h1SMcG0001488 dd_Smed_v4_209_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30024350h1SMcG0001488 dd_Smed_v4_209_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30024350h1SMcG0001488 dd_Smed_v4_209_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30024350h1SMcG0001488 dd_Smed_v4_209_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30024350h1SMcG0001488 dd_Smed_v4_209_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30024350h1SMcG0001488 dd_Smed_v4_209_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30024350h1SMcG0001488 dd_Smed_v4_209_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30024350h1SMcG0001488 dd_Smed_v4_25682_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30024350h1SMcG0001488 Contig54760uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30024350h1SMcG0001488 Contig54760newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
whole organismSMED30024350h1SMcG0001488 Contig55579uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
whole organismSMED30024350h1SMcG0001488 Contig55579newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30024350h1SMcG0001488 dd_Smed_v4_209_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Glutathione S-transferase protein vs. Ensembl Human
Match: HPGDS (hematopoietic prostaglandin D synthase [Source:HGNC Symbol;Acc:HGNC:17890])

HSP 1 Score: 59.6918 bits (143), Expect = 2.449e-10
Identity = 32/101 (31.68%), Postives = 56/101 (55.45%), Query Frame = 1
Query:  115 RLHYYDCRGEAEVLRLLFKAANIKFEDKRYTEEEWETAKSAFKIKELPLVENYDGRLLTEPSAICRFYSLNRGLLGSSDWEYYMIEKCIEHADESCHILND 417
            +L Y++ RG AE++R +F   +I++ED R  + +W   KS     ++P++E  DG  L +  AI R+ + N  L G+++     +E+C  H D     L+D
Sbjct:    5 KLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILE-VDGLTLHQSLAIARYLTKNTDLAGNTE-----MEQC--HVDAIVDTLDD 97          
BLAST of Glutathione S-transferase protein vs. Ensembl Human
Match: GSTA4 (glutathione S-transferase alpha 4 [Source:HGNC Symbol;Acc:HGNC:4629])

HSP 1 Score: 50.0618 bits (118), Expect = 7.002e-7
Identity = 42/164 (25.61%), Postives = 77/164 (46.95%), Query Frame = 1
Query:  115 RLHYYDCRGEAEVLRLLFKAANIKFEDKRYTEEEWETAKSAFKIK--------ELPLVENYDGRLLTEPSAICRFYSLNRGLLGSSDWEYYMIEKCIEHADESCHILNDVVFKNITLDDHHEHALSSSLKTL-------NKVAEVNKNGFLVGKTASLADIYLL 561
            +LHY + RG  E +R +  AA ++F+     EE  ET +  +K++        ++P+VE  DG  L +  +I  + +    L G +  E  +I+  +E   +   +L  ++   +  DD  +  ++ + K +        K+   +   FLVG   SLAD+ LL
Sbjct:    6 KLHYPNGRGRMESVRWVLAAAGVEFD-----EEFLETKEQLYKLQDGNHLLFQQVPMVE-IDGMKLVQTRSILHYIADKHNLFGKNLKERTLIDMYVEGTLDLLELL--IMHPFLKPDDQQKEVVNMAQKAIIRYFPVFEKILRGHGQSFLVGNQLSLADVILL 161          
BLAST of Glutathione S-transferase protein vs. Ensembl Human
Match: GSTA4 (glutathione S-transferase alpha 4 [Source:HGNC Symbol;Acc:HGNC:4629])

HSP 1 Score: 50.0618 bits (118), Expect = 7.002e-7
Identity = 42/164 (25.61%), Postives = 77/164 (46.95%), Query Frame = 1
Query:  115 RLHYYDCRGEAEVLRLLFKAANIKFEDKRYTEEEWETAKSAFKIK--------ELPLVENYDGRLLTEPSAICRFYSLNRGLLGSSDWEYYMIEKCIEHADESCHILNDVVFKNITLDDHHEHALSSSLKTL-------NKVAEVNKNGFLVGKTASLADIYLL 561
            +LHY + RG  E +R +  AA ++F+     EE  ET +  +K++        ++P+VE  DG  L +  +I  + +    L G +  E  +I+  +E   +   +L  ++   +  DD  +  ++ + K +        K+   +   FLVG   SLAD+ LL
Sbjct:    6 KLHYPNGRGRMESVRWVLAAAGVEFD-----EEFLETKEQLYKLQDGNHLLFQQVPMVE-IDGMKLVQTRSILHYIADKHNLFGKNLKERTLIDMYVEGTLDLLELL--IMHPFLKPDDQQKEVVNMAQKAIIRYFPVFEKILRGHGQSFLVGNQLSLADVILL 161          
BLAST of Glutathione S-transferase protein vs. Ensembl Human
Match: GSTA3 (glutathione S-transferase alpha 3 [Source:HGNC Symbol;Acc:HGNC:4628])

HSP 1 Score: 49.6766 bits (117), Expect = 1.169e-6
Identity = 52/206 (25.24%), Postives = 88/206 (42.72%), Query Frame = 1
Query:  115 RLHYYDCRGEAEVLRLLFKAANIKFEDKRYTEEEWETAK----SAFKIKELPLVENYDGRLLTEPSAICRFYSLNRGLLGSSDWEYYMIEKCIEHADESCHILNDVVF---------KNITLDDHHEHALSSSLKTLNKVAEVNKNGFLVGKTASLADIYLLVLLDFAEMRAAKEHFTRFKKLHEVKKKLLNTFPEINTWITTMRP 693
            +LHY++ RG  E +R L  AA ++FE+K     E +  K     +   +++P+VE  DG  L +  AI  + +    L G    E  +I+   E   +    LN+++          K+  +    E   S       KV + +   +LVG   S ADI L+ LL + E        + F  L  +K ++ N  P +  ++    P
Sbjct:    6 KLHYFNGRGRMEPIRWLLAAAGVEFEEKFIGSAE-DLGKLRNDGSLMFQQVPMVE-IDGMKLVQTRAILNYIASKYNLYGKDIKERALIDMYTEGMAD----LNEMILLLPLCRPEEKDAKIALIKEKTKSRYFPAFEKVLQSHGQDYLVGNKLSRADISLVELLYYVE-ELDSSLISNFPLLKALKTRISN-LPTVKKFLQPGSP 203          
BLAST of Glutathione S-transferase protein vs. Ensembl Human
Match: GSTA2 (glutathione S-transferase alpha 2 [Source:HGNC Symbol;Acc:HGNC:4627])

HSP 1 Score: 49.2914 bits (116), Expect = 1.439e-6
Identity = 50/201 (24.88%), Postives = 88/201 (43.78%), Query Frame = 1
Query:  115 RLHYYDCRGEAEVLRLLFKAANIKFEDKRY-TEEEWETAKSA--FKIKELPLVENYDGRLLTEPSAICRFYSLNRGLLGSSDWEYYMIEKCIEHADESCHILNDVVFKNITLDDH-----HEHALSSSLKTLNKVAEVNKNGFLVGKTASLADIYLLVLLDFAEMRAAKEHFTRFKKLHEVKKKLLNTFPEINTWITTMRP 693
            +LHY + RG  E +R L  AA ++FE+K   + E+ +  ++      +++P+VE  DG  L +  AI  + +    L G    E  +I+  IE   +   ++  + F      D       E   +       KV + +   +LVG   S ADI+L+ LL + E        + F  L  +K ++ N  P +  ++    P
Sbjct:    6 KLHYSNIRGRMESIRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVE-IDGMKLVQTRAILNYIASKYNLYGKDIKEKALIDMYIEGIADLGEMILLLPFSQPEEQDAKLALIQEKTKNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLVELLYYVE-ELDSSLISSFPLLKALKTRISN-LPTVKKFLQPGSP 203          
BLAST of Glutathione S-transferase protein vs. Ensembl Celegans
Match: gst-38 (Glutathione S-Transferase [Source:UniProtKB/TrEMBL;Acc:O45451])

HSP 1 Score: 78.1814 bits (191), Expect = 2.178e-17
Identity = 62/209 (29.67%), Postives = 99/209 (47.37%), Query Frame = 1
Query:  115 RLHYYDCRGEAEVLRLLFKAANIKFEDKRYTEEEWETAKSAFKIK--ELPLVENYDGRLLTEPSAICRFYSLNRGLLGSSDWEYYMIEKCIEHADESCHILNDVVFKNITLDDHHEHALSSS--LKTLNK-------VAEVNKNGFLVGKTASLADIYLLVLLDFAEMRAAKEHFTRFKKLHEVK--KKLLNTFPEINTWITTMRPITD 702
            +L Y+D RG  E+ R +F AA  K+ED R T+EEWE  K+A K    +LP++E  DG+ L +  A+ R+ +   G  G S WE   +    +   +        +   +   +    AL +S  L    K         + + +GFLVG + +  D  LLV    A++   +E    F  + E+K   + + + P+I  WI T RP +D
Sbjct:    5 KLTYFDGRGAGELCRQIFAAAEQKYEDNRLTDEEWEKFKAAGKTPYNQLPMLE-VDGKPLAQSHAMARYLAREFGFNGKSRWEEAQVNSLADQYKDYYAEARPYLAVKLGYTEGDAEALYTSVYLPVFKKHYGFFVNALKASGSGFLVGNSLTFID--LLVAQHSADL-LGREKSDLFNDVPEMKAHSEKVQSIPQIKKWIET-RPASD 208          
BLAST of Glutathione S-transferase protein vs. Ensembl Celegans
Match: gst-39 (Glutathione S-Transferase [Source:UniProtKB/TrEMBL;Acc:Q9NAB0])

HSP 1 Score: 76.6406 bits (187), Expect = 8.001e-17
Identity = 61/210 (29.05%), Postives = 97/210 (46.19%), Query Frame = 1
Query:  115 RLHYYDCRGEAEVLRLLFKAANIKFEDKRYT--EEEWETAKSAFKIKELPLVENYDGRLLTEPSAICRFYSLNRGLLGSSDWEYYMIEKCIEHADESCHILNDVVFKNITLDDHHEHALSSS----------LKTLNKVAEVNKNGFLVGKTASLADIYL---LVLLDFAEMRAAKEHFTRFKKLHEVKKKLLNTFPEINTWITTMRPIT 699
            +L Y+D RG AE  R+LF  A + FED R T  +  WE  K      ++P++ + DG  + + +AI R+ +   G  G +  E    +  ++   +       ++    +     E A  SS           K LN + E +K+GFLVG   + ADI +   L  L+  +   A EH     KL  +++K ++  P I TW+ T RP T
Sbjct:    5 KLTYFDARGYAEPARILFHLAGVPFEDNRLTHGDGSWEKIKDKTPFGQVPVL-SVDGFDIPQSAAIIRYLANKFGYAGKTPEEQAWADAIVDQFKDFMGAFRQLIMAQRSGKPAEEIAKISSEVAIPARDSYFKILNGLLEKSKSGFLVGDGLTFADIVVVENLTTLEKNQFFTASEH----PKLSALREK-VHAVPAIKTWVAT-RPDT 207          
BLAST of Glutathione S-transferase protein vs. Ensembl Celegans
Match: gst-4 (Glutathione S-transferase 4 [Source:UniProtKB/Swiss-Prot;Acc:Q21355])

HSP 1 Score: 70.8626 bits (172), Expect = 1.202e-14
Identity = 56/209 (26.79%), Postives = 96/209 (45.93%), Query Frame = 1
Query:  115 RLHYYDCRGEAEVLRLLFKAANIKFEDKRYTEEEWETAKSAFKIKELPLVENYDGRLLTEPSAICRFYSLNRGLLGSSDWE-----------------YYMIEKCIEHADESCHILNDVVFKNITLDDHHEHALSSSLKTLNKVAEVNKNGFLVGKTASLADIYLLVLLDFAEMRAAKEHFTRFKKLHEVKKKLLNTFPEINTWITTMR 690
            +L Y+D R  AE +R++F   N+ +ED R + EEW   K      +LP+++  DG    +  +I R+ +   GL G +  E                 +      + +  ++ HI N V F+ +      E A    L  +NK    +K+GFLVG + + ADI +   L  + ++     F + KKL E   K +++ PEI  ++ T +
Sbjct:    5 KLLYFDARALAEPIRIMFAMLNVPYEDYRVSVEEWSKLKPTTPFGQLPILQ-VDGEQFGQSMSITRYLARKFGLAGKTAEEEAYADSIVDQYRDFIFFFRQFTSSVFYGSDADHI-NKVRFEVV------EPARDDFLAIINKFLAKSKSGFLVGDSLTWADIVIADNLT-SLLKNGFLDFNKEKKLEEFYNK-IHSIPEIKNYVATRK 203          
BLAST of Glutathione S-transferase protein vs. Ensembl Celegans
Match: gst-24 (Glutathione S-Transferase [Source:UniProtKB/TrEMBL;Acc:Q93694])

HSP 1 Score: 69.707 bits (169), Expect = 2.651e-14
Identity = 52/195 (26.67%), Postives = 91/195 (46.67%), Query Frame = 1
Query:  115 RLHYYDCRGEAEVLRLLFKAANIKFEDKRY--TEEEWETAKSAFKIKELPLVENYDGRLLTEPSAICRFYSLNRGLLGSSDWEYYMIEKCIEHADESCHILNDVVFKNITLDDHH---------EHALSSSLKTLNKVAEVNKNGFLVGKTASLADIYLLVLLDFAEMRAAKEHFTRFKKLHEVKKKLLNTFPEI 666
            +L+Y++ RG AE  R LFK A+++FED R      EW   K      +LP + + DG  + + +AI R+ +   G  G +  E   ++  ++   +    L  ++    + +              A  +  K LN + E +K+GFLVG   + AD+ +  +L   EM    +     +KL  +++K +N  PEI
Sbjct:    5 KLYYFNLRGWAEPARQLFKLAHVEFEDVRIENGTPEWGALKPKTPFGQLPFL-SVDGFEIPQSAAILRYLAKKFGYAGKTSEEEAWVDAIVDQFKDFVTPLRQLIMAQRSGNAEEIERIQKEVFAPARDTFFKILNGILEKSKSGFLVGDGVTWADLVIADILTTMEMLGVFDKHGEEQKLAALREK-VNEIPEI 197          
BLAST of Glutathione S-transferase protein vs. Ensembl Celegans
Match: gst-5 (Probable glutathione S-transferase 5 [Source:UniProtKB/Swiss-Prot;Acc:Q09596])

HSP 1 Score: 69.3218 bits (168), Expect = 3.336e-14
Identity = 56/206 (27.18%), Postives = 89/206 (43.20%), Query Frame = 1
Query:  115 RLHYYDCRGEAEVLRLLFKAANIKFEDKRYTEEEWETAKS--AFKIKELPLVENYDGRLLTEPSAICRFYSLNRGLLGSSDWEYYMIEKCIEHADESCHILNDVVFKNITLDDHHEHALSSSL---------KTLNKVAEVNKNGFLVGKTASLADIYLLVLLDFAEMRAAKEHFTRFKKLHEVKKKLLNTFPEINTWITTMRPIT 699
            +L Y++ RG  EV R +F  A  ++ED R T+E+W   K   A    +LP +E  DG+ L +  AI RF +    L G + WE   +    +   +         +  +         L   +           L    + + +GFLVG   SL  I L +    A++ A    F++F +L    +K +   P+I  WI T RP+T
Sbjct:    5 KLTYFNGRGAGEVSRQIFAYAGQQYEDNRVTQEQWPALKETCAAPFGQLPFLE-VDGKKLAQSHAIARFLAREFKLNGKTAWEEAQVNSLADQYKDYSSEARPYFYAVMGFGPGDVETLKKDIFLPAFEKFYGFLVNFLKASGSGFLVGD--SLTWIDLAIAQHSADLIAKGGDFSKFPELKAHAEK-IQAIPQIKKWIET-RPVT 205          
BLAST of Glutathione S-transferase protein vs. Ensembl Fly
Match: GstS1 (gene:FBgn0010226 transcript:FBtr0087005)

HSP 1 Score: 67.0106 bits (162), Expect = 5.189e-13
Identity = 54/209 (25.84%), Postives = 91/209 (43.54%), Query Frame = 1
Query:  118 LHYYDCRGEAEVLRLLFKAANIKFEDKRYTEEEWETAKSAFKIKELPLVENYDGRLLTEPSAICRFYSLNRGLLGSSDWEYYMIEKCIEHADESCHILNDVVFKNITLDDHHEHAL-SSSLKTLNKVAEV-------------NKNGFLVGKTASLADIYLLVLLDFAEMRAAKEHFTRFKKLHEVKKKLLNTFPEINTWITTMRPITD 702
            L Y++ +  AE LR LF   N ++ED R T +EW   K    + ++P++E  DG+ + +  ++ RF +   GL G++ WE   I+  ++        +ND   K   +    E  +    L TLN  AEV             + +G L     + AD+Y   + D+      ++    +  L  V    +N    I  WI   RP+T+
Sbjct:   52 LFYFNVKALAEPLRYLFAYGNQEYEDVRVTRDEWPALKPTMPMGQMPVLE-VDGKRVHQSISMARFLAKTVGLCGATPWEDLQIDIVVD-------TINDFRLKIAVVSYEPEDEIKEKKLVTLN--AEVIPFYLEKLEQTVKDNDGHLALGKLTWADVYFAGITDYMNYMVKRDLLEPYPALRGVVDA-VNALEPIKAWIEK-RPVTE 248          
BLAST of Glutathione S-transferase protein vs. Ensembl Fly
Match: GstS1 (gene:FBgn0010226 transcript:FBtr0100258)

HSP 1 Score: 67.0106 bits (162), Expect = 5.189e-13
Identity = 54/209 (25.84%), Postives = 91/209 (43.54%), Query Frame = 1
Query:  118 LHYYDCRGEAEVLRLLFKAANIKFEDKRYTEEEWETAKSAFKIKELPLVENYDGRLLTEPSAICRFYSLNRGLLGSSDWEYYMIEKCIEHADESCHILNDVVFKNITLDDHHEHAL-SSSLKTLNKVAEV-------------NKNGFLVGKTASLADIYLLVLLDFAEMRAAKEHFTRFKKLHEVKKKLLNTFPEINTWITTMRPITD 702
            L Y++ +  AE LR LF   N ++ED R T +EW   K    + ++P++E  DG+ + +  ++ RF +   GL G++ WE   I+  ++        +ND   K   +    E  +    L TLN  AEV             + +G L     + AD+Y   + D+      ++    +  L  V    +N    I  WI   RP+T+
Sbjct:   52 LFYFNVKALAEPLRYLFAYGNQEYEDVRVTRDEWPALKPTMPMGQMPVLE-VDGKRVHQSISMARFLAKTVGLCGATPWEDLQIDIVVD-------TINDFRLKIAVVSYEPEDEIKEKKLVTLN--AEVIPFYLEKLEQTVKDNDGHLALGKLTWADVYFAGITDYMNYMVKRDLLEPYPALRGVVDA-VNALEPIKAWIEK-RPVTE 248          
BLAST of Glutathione S-transferase protein vs. Ensembl Fly
Match: GstS1 (gene:FBgn0010226 transcript:FBtr0087006)

HSP 1 Score: 67.0106 bits (162), Expect = 5.189e-13
Identity = 54/209 (25.84%), Postives = 91/209 (43.54%), Query Frame = 1
Query:  118 LHYYDCRGEAEVLRLLFKAANIKFEDKRYTEEEWETAKSAFKIKELPLVENYDGRLLTEPSAICRFYSLNRGLLGSSDWEYYMIEKCIEHADESCHILNDVVFKNITLDDHHEHAL-SSSLKTLNKVAEV-------------NKNGFLVGKTASLADIYLLVLLDFAEMRAAKEHFTRFKKLHEVKKKLLNTFPEINTWITTMRPITD 702
            L Y++ +  AE LR LF   N ++ED R T +EW   K    + ++P++E  DG+ + +  ++ RF +   GL G++ WE   I+  ++        +ND   K   +    E  +    L TLN  AEV             + +G L     + AD+Y   + D+      ++    +  L  V    +N    I  WI   RP+T+
Sbjct:   52 LFYFNVKALAEPLRYLFAYGNQEYEDVRVTRDEWPALKPTMPMGQMPVLE-VDGKRVHQSISMARFLAKTVGLCGATPWEDLQIDIVVD-------TINDFRLKIAVVSYEPEDEIKEKKLVTLN--AEVIPFYLEKLEQTVKDNDGHLALGKLTWADVYFAGITDYMNYMVKRDLLEPYPALRGVVDA-VNALEPIKAWIEK-RPVTE 248          
BLAST of Glutathione S-transferase protein vs. Ensembl Fly
Match: GstS1 (gene:FBgn0010226 transcript:FBtr0333551)

HSP 1 Score: 65.4698 bits (158), Expect = 2.367e-12
Identity = 48/202 (23.76%), Postives = 90/202 (44.55%), Query Frame = 1
Query:  118 LHYYDCRGEAEVLRLLFKAANIKFEDKRYTEEEWETAKSAFKIKELPLVENYDGRLLTEPSAICRFYSLNRGLLGSSDWEYYMIEKCIE-------HADESCHILNDVVFKNITLDDHHEHALSSSLKTLNKVAEVNKNGFLVGKTASLADIYLLVLLDFAEMRAAKEHFTRFKKLHEVKKKLLNTFPEINTWITTMRPITD 702
            L Y++ +  AE LR LF   N ++ED R T +EW   K    + ++P++E  DG+ + +  ++ RF +   GL G++ WE   I+  ++        +++      +   K   L   +   +   L+ L +  + N     +GK  + AD+Y   + D+      ++    +  L  V    +N    I  WI   RP+T+
Sbjct:   52 LFYFNVKALAEPLRYLFAYGNQEYEDVRVTRDEWPALKPTMPMGQMPVLE-VDGKRVHQSISMARFLAKTVGLCGATPWEDLQIDIVVDTINDFRLSSEQFVSYEPEDEIKEKKLVTLNAEVIPFYLEKLEQTVKDNDGHLALGKL-TWADVYFAGITDYMNYMVKRDLLEPYPALRGVVDA-VNALEPIKAWIEK-RPVTE 249          
BLAST of Glutathione S-transferase protein vs. Ensembl Zebrafish
Match: gsta.1 (glutathione S-transferase, alpha tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2720])

HSP 1 Score: 57.3806 bits (137), Expect = 1.672e-9
Identity = 60/212 (28.30%), Postives = 91/212 (42.92%), Query Frame = 1
Query:  100 MNKFVRLHYYDCRGEAEVLRLLFKAANIKFEDKRYTEEEW---ETAKSAFKIKELPLVENYDGRLLTEPSAICRFYSLNRGLLGSSDWEYYMIEKCIEHADESCHIL----------NDVVFKNITLDDHHEHALSSSLKTLNKVAEVNKNGFLVGKTASLADIYLL--VLLDFAEMRAAKEHFTRFKKLHEVKKKLLNTFPEINTWITTMR 690
            M+  V LHY++ RG+ E +R L  AA ++FE+   TE+E      +  A   +++PLVE  DG  L +  AI  + +    L G    E  MI+   E   +   ++           + VF NI      E A    L    K   +  + FLVGK  S AD++LL   L+                 L E+   +L TFP+I  +   M+
Sbjct:    1 MSGKVVLHYFNGRGKMESIRWLLAAAGVQFEEVFLTEKEQFDKLLSDGALTFQQVPLVE-IDGMKLVQSKAILNYIAGKYNLYGKDLKERAMIDIYSEGLIDLMEMIMVSPFTPAENKEKVFSNI-----EEKAKVRFLPVFEKA--LANSSFLVGKQLSRADVHLLEATLM-----------------LQELFPSILATFPKIQAFQEQMK 187          
BLAST of Glutathione S-transferase protein vs. Ensembl Zebrafish
Match: gsta.1 (glutathione S-transferase, alpha tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2720])

HSP 1 Score: 57.3806 bits (137), Expect = 1.672e-9
Identity = 60/212 (28.30%), Postives = 91/212 (42.92%), Query Frame = 1
Query:  100 MNKFVRLHYYDCRGEAEVLRLLFKAANIKFEDKRYTEEEW---ETAKSAFKIKELPLVENYDGRLLTEPSAICRFYSLNRGLLGSSDWEYYMIEKCIEHADESCHIL----------NDVVFKNITLDDHHEHALSSSLKTLNKVAEVNKNGFLVGKTASLADIYLL--VLLDFAEMRAAKEHFTRFKKLHEVKKKLLNTFPEINTWITTMR 690
            M+  V LHY++ RG+ E +R L  AA ++FE+   TE+E      +  A   +++PLVE  DG  L +  AI  + +    L G    E  MI+   E   +   ++           + VF NI      E A    L    K   +  + FLVGK  S AD++LL   L+                 L E+   +L TFP+I  +   M+
Sbjct:    1 MSGKVVLHYFNGRGKMESIRWLLAAAGVQFEEVFLTEKEQFDKLLSDGALTFQQVPLVE-IDGMKLVQSKAILNYIAGKYNLYGKDLKERAMIDIYSEGLIDLMEMIMVSPFTPAENKEKVFSNI-----EEKAKVRFLPVFEKA--LANSSFLVGKQLSRADVHLLEATLM-----------------LQELFPSILATFPKIQAFQEQMK 187          
BLAST of Glutathione S-transferase protein vs. Ensembl Zebrafish
Match: AL929536.3 (pep chromosome:GRCz11:13:835390:840787:1 gene:ENSDARG00000113274.1 transcript:ENSDART00000171329.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:AL929536.3)

HSP 1 Score: 55.8398 bits (133), Expect = 5.188e-9
Identity = 58/207 (28.02%), Postives = 88/207 (42.51%), Query Frame = 1
Query:  100 MNKFVRLHYYDCRGEAEVLRLLFKAANIKFEDKRYTEEEW---ETAKSAFKIKELPLVENYDGRLLTEPSAICRFYSLNRGLLGSSDWEYYMIEKCIEHADESCHILNDVVF-----KNITLDDHHEHALSSSLKTLNKVAEVNKNGFLVGKTASLADIYLL--VLLDFAEMRAAKEHFTRFKKLHEVKKKLLNTFPEINTWITTMR 690
            M+  V LHY++ RG  E +R L  AA ++FE+   TE+E      +      +++PLVE  DG  L +  AI  + +    L G    E  MI+   E   +   ++    F     K  T  +  E A    L    K   +  + FLVGK  S AD++LL   L+                 L E+   +L TFP+I  +   M+
Sbjct:    1 MSGKVVLHYFNGRGRMESIRWLLAAAGVQFEEVFLTEKEQFDKLLSDGVLTFQQVPLVE-IDGMKLVQSKAILNYIAGKYNLYGKDLKERAMIDIYSEGLIDLMGMIIMAPFTPAENKEETFRNIEEKAKVRFLPVFEKA--LANSSFLVGKQLSRADVHLLEATLM-----------------LQELFPSILATFPKIQAFQDQMK 187          
BLAST of Glutathione S-transferase protein vs. Ensembl Zebrafish
Match: AL929536.1 (pep chromosome:GRCz11:CHR_ALT_CTG13_1_1:843683:849080:1 gene:ENSDARG00000110578.1 transcript:ENSDART00000182617.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:AL929536.1)

HSP 1 Score: 55.8398 bits (133), Expect = 5.188e-9
Identity = 58/207 (28.02%), Postives = 88/207 (42.51%), Query Frame = 1
Query:  100 MNKFVRLHYYDCRGEAEVLRLLFKAANIKFEDKRYTEEEW---ETAKSAFKIKELPLVENYDGRLLTEPSAICRFYSLNRGLLGSSDWEYYMIEKCIEHADESCHILNDVVF-----KNITLDDHHEHALSSSLKTLNKVAEVNKNGFLVGKTASLADIYLL--VLLDFAEMRAAKEHFTRFKKLHEVKKKLLNTFPEINTWITTMR 690
            M+  V LHY++ RG  E +R L  AA ++FE+   TE+E      +      +++PLVE  DG  L +  AI  + +    L G    E  MI+   E   +   ++    F     K  T  +  E A    L    K   +  + FLVGK  S AD++LL   L+                 L E+   +L TFP+I  +   M+
Sbjct:    1 MSGKVVLHYFNGRGRMESIRWLLAAAGVQFEEVFLTEKEQFDKLLSDGVLTFQQVPLVE-IDGMKLVQSKAILNYIAGKYNLYGKDLKERAMIDIYSEGLIDLMGMIIMAPFTPAENKEETFRNIEEKAKVRFLPVFEKA--LANSSFLVGKQLSRADVHLLEATLM-----------------LQELFPSILATFPKIQAFQDQMK 187          
BLAST of Glutathione S-transferase protein vs. Ensembl Zebrafish
Match: gsta.2 (glutathione S-transferase, alpha tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-070822-30])

HSP 1 Score: 53.9138 bits (128), Expect = 2.665e-8
Identity = 54/210 (25.71%), Postives = 91/210 (43.33%), Query Frame = 1
Query:  100 MNKFVRLHYYDCRGEAEVLRLLFKAANIKFEDKRYTEEEWETA---KSAFKIKELPLVENYDGRLLTEPSAICRFYSLNRGLLGSSDWEYYMIEKCIEHADESCHILNDVVFKNITLDDHHEHALSSS--------LKTLNKVAEVNKNGFLVGKTASLADIYLL--VLLDFAEMRAAKEHFTRFKKLHEVKKKLLNTFPEINTWITTMR 690
            M+  V LHY++ RG  E +R L   A ++FE+  +T++E         A   +++PLVE  DG  L +  AI  + +    L G    E  MI+    +++    ++  ++   +   D+ +   SS         L    K   +  + FLVGK  S AD++LL   L+                 L E+   +L TFP+I  +   M+
Sbjct:    1 MSGKVVLHYFNGRGRMESIRWLLAVAGVQFEEVFFTKKEQFDKLLNDGALTFQQVPLVE-IDGMKLVQSKAILNYIAGKYNLYGKDLKERAMIDI---YSEGLIDLMEMIIMAPLGPADNIQKTYSSIEEKAKVRFLPVFEKA--LANSSFLVGKQLSRADVHLLEATLM-----------------LQELFPSILATFPKIQAFQEQMK 187          
BLAST of Glutathione S-transferase protein vs. Ensembl Xenopus
Match: hpgds (hematopoietic prostaglandin D synthase [Source:NCBI gene;Acc:448666])

HSP 1 Score: 62.003 bits (149), Expect = 2.951e-11
Identity = 51/191 (26.70%), Postives = 84/191 (43.98%), Query Frame = 1
Query:  118 LHYYDCRGEAEVLRLLFKAANIKFEDKRYTEEEWETAKSAFKIKELPLVENYDGRLLTEPSAICRFYSLNRGLLGSSDWEYYMIEKCIEHADE---SCHILNDVVFKNITLDDHHEHALSSSLKTLNKVAEVNKNGFLVGKTASLADIYLLVLLDFAEMRAAKEHFTR-FKKLHEVKKKLLNTFPEINTWI 678
            L Y++  G  E+LR LF  ++I FED+R    +W   K      +LP+VE  DG +  +  A+ R+ +   GL+G +D +   ++  I+  D+       ++    K   ++      LS   KTL        N + VG + + AD Y     D  E       F + + KL  +K + +   P I  WI
Sbjct:    6 LKYFNLEGRGEILRYLFSYSDIPFEDQRIEFADWPALKPKIPYGQLPVVE-IDGVIYNQSLAVGRYLAKKGGLIGKNDLDEIRVDALIDTIDDFFSKFPWMDTEKAKKEFMEKSGPQLLSYLEKTL------GNNSWFVGDSVTWADFYWDTCSDSFENYVP--GFAKDYPKLLALKDR-VKAIPAIAAWI 186          
BLAST of Glutathione S-transferase protein vs. Ensembl Xenopus
Match: gsta4 (glutathione S-transferase alpha 4 [Source:NCBI gene;Acc:549430])

HSP 1 Score: 62.003 bits (149), Expect = 5.132e-11
Identity = 57/215 (26.51%), Postives = 99/215 (46.05%), Query Frame = 1
Query:  100 MNKFVRLHYYDCRGEAEVLRLLFKAANIKFEDKRY-TEEEWET--AKSAFKIKELPLVENYDGRLLTEPSAICRFYSLNRGLLGSSDWEYYMIEKCIEHADESCHILNDVVF-----KNITLDDHHEHALSSSLKTLNKVAEVNKNGFLVGKTASLADIYLLVLLDFAEMRAAKEHFTRFKKLHEVKKKLLNTFPEINTWI---TTMRPITDN*Y 711
            M++  +LHY++ RG+ E +R L  AA ++FE++   T E++E          K++P+VE  DG  L +  AI ++ +    L G    E  +I+  +E   E   ++    F       + +D   + A    L    KV   +   FLVG   S ADI LL  +   E ++A    + F  L + K++ ++  P I  ++   +  +P  D  Y
Sbjct:    1 MSEKPKLHYFNGRGKMESIRWLLAAAGVEFEEEMIETREQFEALFQDGNLPFKQVPVVE-MDGMKLVQTKAILQYIAAKYNLYGKDIVERVLIDMYVEGTTEFMEVIMSQPFLQNVEPGMQIDVLVQKAKMCYLPVYEKVLRDHGQDFLVGNQFSWADIQLLEAILMIEEKSAN-VLSNFPLLQDFKER-ISEIPTIKAFLLPGSKRKPQPDEKY 212          
BLAST of Glutathione S-transferase protein vs. Ensembl Xenopus
Match: gnrhr (gonadotropin releasing hormone receptor [Source:Xenbase;Acc:XB-GENE-5753573])

HSP 1 Score: 55.0694 bits (131), Expect = 1.383e-8
Identity = 56/205 (27.32%), Postives = 93/205 (45.37%), Query Frame = 1
Query:  118 LHYYDCRGEAEVLRLLFKAANIKFEDKRYTEEEWETAKSAFK----IKELPLVENYDGRLLTEPSAICRFYSLNRGLLGSSDWEYYMIEKCIEHADESCHILNDVVFKNI-TLDDHHEHALSSSLKTLNKVAEVNKNG--FLVGKTASLADIYLLVLLDFAEMRAAKEHFTRFKKLHEVKKKLLNTFPEINTWITT----MRPIT 699
            L Y+  RG AE +RLL     + F+D+      W   K   K      +LP  +N D   L + ++I R+     GL GS+D E   I+   +  ++       ++F    T  D +  AL   L+   ++   N NG  F+VG+  S AD Y L+ L    +  + +  + F  L    ++ LN+ P++N ++ +     RPIT
Sbjct:    6 LTYFPVRGRAEAIRLLLADQGVAFKDEEAQIPLWFAGKDDRKKHAVFGQLPQFKNGD-YTLYQSNSILRYLGRKHGLNGSNDEELGHIDMVNDGVEDLRQKYVRLIFTEYDTGKDKYLEALPQQLEFFERILSKNHNGSKFIVGQKISYAD-YNLLDLLHCHLDLSPKSLSAFPLLSAYVER-LNSRPKLNEYLKSEARNRRPIT 207          
BLAST of Glutathione S-transferase protein vs. Ensembl Xenopus
Match: gnrhr (gonadotropin releasing hormone receptor [Source:Xenbase;Acc:XB-GENE-5753573])

HSP 1 Score: 51.6026 bits (122), Expect = 2.324e-7
Identity = 60/221 (27.15%), Postives = 96/221 (43.44%), Query Frame = 1
Query:  118 LHYYDCRGEAEVLRLLFKAANIKFEDKRYTEEEW------ETAKSAFKIKELPLVENYDGRLLTEPSAICRFYSLNRGLLGSSDWEYYMIEKCIEHADESCHI--LNDVV---------FKNITLDDHHE----HALSSSLKTLNKVAEVNKNG--FLVGKTASLADIYLLVLLDFAEMRAAKEHFTRFKKLHEVKKKLLNTFPEINTWITT----MRPIT 699
            L YY  RG AE +RLL    +I +E+     ++W      E  K+ F    LP  +N D  +L + ++I R+ +   GL G +D             +ES HI  +ND V         F   T  +  +      L   L+   +V   N NG  F+VG+  S AD  L+ LL    +  + E  + F  L    ++L++  P ++ ++ +     RPIT
Sbjct:   22 LTYYPVRGRAEAIRLLLADQDIPWEEDEVQWQDWCSGNHDERKKAVF--GRLPQFQNGD-FVLCQSNSILRYLAHKHGLTGDND-------------EESAHIDMVNDSVEDLRKKYGRFIYFTCQEKGKGKYLEGLPQQLEFFERVLSKNHNGSKFVVGQKISYADYNLVDLLQ-CHLDLSPECLSAFPLLRAYLERLVSQ-PTLSDYLNSDARKRRPIT 224          
BLAST of Glutathione S-transferase protein vs. Ensembl Xenopus
Match: gnrhr (gonadotropin releasing hormone receptor [Source:Xenbase;Acc:XB-GENE-5753573])

HSP 1 Score: 49.6766 bits (117), Expect = 8.972e-7
Identity = 59/221 (26.70%), Postives = 96/221 (43.44%), Query Frame = 1
Query:  118 LHYYDCRGEAEVLRLLFKAANIKFEDKRYTEEEW------ETAKSAFKIKELPLVENYDGRLLTEPSAICRFYSLNRGLLGSSDWEYYMIEKCIEHADESCHI--LNDVV---------FKNITLDDHHE----HALSSSLKTLNKVAEVNKNG--FLVGKTASLADIYLLVLLDFAEMRAAKEHFTRFKKLHEVKKKLLNTFPEINTWITT----MRPIT 699
            L Y+  RG AE +RLL    +I +E+     ++W      E  K+ F    LP  +N D  +L + ++I R+ +   GL G +D             +ES HI  +ND V         F   T  +  +      L   L+   +V   N NG  F+VG+  S AD  L+ LL    +  + E  + F  L    ++L++  P ++ ++ +     RPIT
Sbjct:    6 LTYFPVRGRAEAIRLLLADQDIPWEEDEVQWQDWCSGNHDERKKAVF--GRLPQFQNGD-FVLCQSNSILRYLAHKHGLTGDND-------------EESAHIDMVNDSVEDLRKKYGRFIYFTCQEKGKGKYLEGLPQQLEFFERVLSKNHNGSKFVVGQKISYADYNLVDLLQ-CHLDLSPECLSAFPLLRAYLERLVSQ-PTLSDYLNSDARKRRPIT 208          
BLAST of Glutathione S-transferase protein vs. Ensembl Mouse
Match: Hpgds (hematopoietic prostaglandin D synthase [Source:MGI Symbol;Acc:MGI:1859384])

HSP 1 Score: 55.4546 bits (132), Expect = 6.408e-9
Identity = 50/206 (24.27%), Postives = 87/206 (42.23%), Query Frame = 1
Query:  115 RLHYYDCRGEAEVLRLLFKAANIKFEDKRYTEEEWETAKSAFKIKELPLVENYDGRLLTEPSAICRFYSLNRGLLGSSDWEYYMIEKCIEHADESCHIL----NDVVFKNITLDDHHEHALSSSLKTLNKVAEVNKNGFLVGKTASLADIY-------LLVLLDFAEMRAAKEHFTRFKKLHEVKKKLLNTFPEINTWITTMRPIT 699
            +L Y++ RG AE++R +F   +IK+ED R  + +W   K      ++P++E  +G  + +  AI R+ + N  L G +  E    +  ++  D+   +      D   K    ++   H     LK L+    +    + +G   + AD Y       LLVL               + KL  ++ K +   P I+ WI   RP T
Sbjct:    5 KLLYFNMRGRAEIIRYIFAYLDIKYEDHRIEQADWPKIKPTLPFGKIPVLE-VEGLTIHQSLAIARYLTKNTDLAGKTALEQCQADAVVDTLDDFMSLFPWAEKDQDLKERMFNELLTHQAPRLLKDLD--TYLGDKEWFIGNYVTWADFYWDICSTTLLVL--------KPGLLDIYPKLVSLRNK-VQAIPAISAWILK-RPQT 197          
BLAST of Glutathione S-transferase protein vs. Ensembl Mouse
Match: Gsta4 (glutathione S-transferase, alpha 4 [Source:MGI Symbol;Acc:MGI:1309515])

HSP 1 Score: 53.9138 bits (128), Expect = 2.262e-8
Identity = 55/197 (27.92%), Postives = 87/197 (44.16%), Query Frame = 1
Query:  115 RLHYYDCRGEAEVLRLLFKAANIKFEDKRY-TEEEWETAK--SAFKIKELPLVENYDGRLLTEPSAICRFYSLNRGLLGSSDWEYYMIEKCIEHADESCHILNDVVFKNITLDDHHEHALSSSLKT-----LNKVAEVNKNGFLVGKTASLADIYLL------------VLLDFAEMRAAKEHFTRFKKLHEVKKKL 645
            +L+Y++ RG  E +R L  AA ++FE++   T E++E  +        ++PLVE  DG +LT+  AI  + +    L G    E   I+   +   +   ++    FK     +     + S  KT       K+ + +   FLVG   S ADI LL            VL DF  ++A K   TR   +  +KK L
Sbjct:    6 KLYYFNGRGRMESIRWLLAAAGVEFEEEFLETREQYEKMQKDGHLLFGQVPLVE-IDGMMLTQTRAILSYLAAKYNLYGKDLKERVRIDMYADGTQDLMMMIAVAPFKTPKEKEESYDLILSRAKTRYFPVFEKILKDHGEAFLVGNQLSWADIQLLEAILMVEELSAPVLSDFPLLQAFK---TRISNIPTIKKFL 198          
BLAST of Glutathione S-transferase protein vs. Ensembl Mouse
Match: Gsta3 (glutathione S-transferase, alpha 3 [Source:MGI Symbol;Acc:MGI:95856])

HSP 1 Score: 49.2914 bits (116), Expect = 1.067e-6
Identity = 48/159 (30.19%), Postives = 72/159 (45.28%), Query Frame = 1
Query:  118 LHYYDCRGEAEVLRLLFKAANIKFEDKRY-TEEEWETAKS--AFKIKELPLVENYDGRLLTEPSAICRFYSLNRGLLGSSDWEYYMIEKCIEH-ADESCHIL----NDVVFKNITLDDHHEHALSSSLKTLNKVAEVNKNGFLVGKTASLADIYLLVLL 570
            LHY+D RG  E +R L  AA ++FE+K   T ++    +S  +   +++P+VE  DG  L +  AI  + +    L G    E  +I+   E  AD    IL         K  +L    E   +       KV + +   +LVG   S ADI L+ LL
Sbjct:    7 LHYFDGRGRMEPIRWLLAAAGVEFEEKFLKTRDDLARLRSDGSLMFQQVPMVE-IDGMKLVQTKAILNYIASKYNLYGKDMKERAIIDMYTEGVADLEIMILYYPHMPPEEKEASLAKIKEQTRNRYFPAFEKVLKSHGQDYLVGNRLSRADIALVELL 164          
BLAST of Glutathione S-transferase protein vs. Ensembl Mouse
Match: Gsta3 (glutathione S-transferase, alpha 3 [Source:MGI Symbol;Acc:MGI:95856])

HSP 1 Score: 49.2914 bits (116), Expect = 1.067e-6
Identity = 48/159 (30.19%), Postives = 72/159 (45.28%), Query Frame = 1
Query:  118 LHYYDCRGEAEVLRLLFKAANIKFEDKRY-TEEEWETAKS--AFKIKELPLVENYDGRLLTEPSAICRFYSLNRGLLGSSDWEYYMIEKCIEH-ADESCHIL----NDVVFKNITLDDHHEHALSSSLKTLNKVAEVNKNGFLVGKTASLADIYLLVLL 570
            LHY+D RG  E +R L  AA ++FE+K   T ++    +S  +   +++P+VE  DG  L +  AI  + +    L G    E  +I+   E  AD    IL         K  +L    E   +       KV + +   +LVG   S ADI L+ LL
Sbjct:    7 LHYFDGRGRMEPIRWLLAAAGVEFEEKFLKTRDDLARLRSDGSLMFQQVPMVE-IDGMKLVQTKAILNYIASKYNLYGKDMKERAIIDMYTEGVADLEIMILYYPHMPPEEKEASLAKIKEQTRNRYFPAFEKVLKSHGQDYLVGNRLSRADIALVELL 164          
BLAST of Glutathione S-transferase protein vs. Ensembl Mouse
Match: Gsta1 (glutathione S-transferase, alpha 1 (Ya) [Source:MGI Symbol;Acc:MGI:1095417])

HSP 1 Score: 47.7506 bits (112), Expect = 3.304e-6
Identity = 54/201 (26.87%), Postives = 89/201 (44.28%), Query Frame = 1
Query:  118 LHYYDCRGEAEVLRLLFKAANIKFEDK-RYTEEEWETAK--SAFKIKELPLVENYDGRLLTEPSAICRFYSLNRGLLGSSDWEYYMIEKCIEHADESCHILNDVVFKNITLDDHHEH--ALSSS------LKTLNKVAEVNKNGFLVGKTASLADIYLL-VLLDFAEMRAAKEHFTRFKKLHEVKKKLLNTFPEINTWITT 684
            LHY++ RG  E +R L  AA ++FE+K   + E+ E  K        ++P+VE  DG  L +  AI  + +    L G    E  +I+   E   +   ++  +V   +   D  E   AL+        L    KV + +   +LVG   +  DI+LL VLL   E  A+    T F  L   K + +++ P +  ++  
Sbjct:    7 LHYFNARGRMECIRWLLAAAGVEFEEKFIQSPEDLEKLKKDGNLMFDQVPMVE-IDGMKLAQTRAILNYIATKYDLYGKDMKERALIDMYSEGILDLTEMIGQLV---LCPPDQREAKTALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLEVLLYVEEFDAS--LLTPFPLLKAFKSR-ISSLPNVKKFLQP 200          
BLAST of Glutathione S-transferase protein vs. UniProt/SwissProt
Match: sp|P46428|GST_ANOGA (Glutathione S-transferase OS=Anopheles gambiae OX=7165 GN=GstS1 PE=2 SV=4)

HSP 1 Score: 85.5001 bits (210), Expect = 4.711e-19
Identity = 58/205 (28.29%), Postives = 102/205 (49.76%), Query Frame = 1
Query:  115 RLHYYDCRGEAEVLRLLFKAANIKFEDKRYTEEEWETAKSAFKIKELPLVENYDGRLLTEPSAICRFYSLNRGLLGSSDWEYYMIEKCIEHADE-------SCHILNDVV--FKNITLDDHHEHALSSSLKTLNKVAEVNKNGFLVGKTASLADIYLLVLLDFAEMRAAKEHFTRFKKLHEVKKKLLNTFPEINTWITTMRPITD 702
            +++Y++ +   E LR L    N+ F+D R T EEW   K    + ++P++E  DG+ + +  A+ R+ +   GL G+ DWE  MI+  ++  ++         +  +D+V   K +TL++     +   L  LN +A+ N NG LV    + AD+Y   +LD+            F  L EV +K+L+    +  +I   RPIT+
Sbjct:    5 KVYYFNVKALGEPLRFLLSYGNLPFDDVRITREEWPALKPTMPMGQMPVLE-VDGKKVHQSVAMSRYLANQVGLAGADDWENLMIDTVVDTVNDFRLKIAIVAYEPDDMVKEKKMVTLNN---EVIPFYLTKLNVIAKEN-NGHLVLGKPTWADVYFAGILDYLNYLTKTNLLENFPNLQEVVQKVLDN-ENVKAYIAK-RPITE 202          
BLAST of Glutathione S-transferase protein vs. UniProt/SwissProt
Match: sp|P26624|GST28_SCHJA (Glutathione S-transferase class-mu 28 kDa isozyme (Fragment) OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 2.728e-16
Identity = 54/204 (26.47%), Postives = 100/204 (49.02%), Query Frame = 1
Query:  112 VRLHYYDCRGEAEVLRLLFKAANIKFEDKRYTEEEWETAKSAFKIKELPLVENYDGR----LLTEPSAICRFYSLNRGLLGSSDWEYYMIEKCIEHADESCHILNDVVFKNITLDDHHEHALSSS---------LKTLNKVAEVNKNGFLVGKTASLADIYLLVLLDFAEMRAAKEHFT-RFKKLHEVKKKLLNTFPEINTWIT 681
            V+L Y++ RG AE +R++  AA ++FED+R   ++W   K       LP+V+  D R     ++E  AI RF +    ++G +D EYY+IEK I   ++    +     K +      +  +S           L+ + +  + +     VG   +LAD+ L+  +D       KE  T ++ ++H+ +K LL T P++  +++
Sbjct:    1 VKLIYFNGRGRAEPIRMILVAAGVEFEDERIEFQDWPKIKPTIPGGRLPIVKITDKRGDVKTMSESLAIARFIARKHNMMGDTDDEYYIIEKMIGQVED----VESEYHKTLIKPPEEKEKISKEILNGKVPILLQAICETLKESTGNLTVGDKVTLADVVLIASIDHI-TDLDKEFLTGKYPEIHKHRKHLLATSPKLAKYLS 199          
BLAST of Glutathione S-transferase protein vs. UniProt/SwissProt
Match: sp|P09792|GST28_SCHMA (Glutathione S-transferase class-mu 28 kDa isozyme OS=Schistosoma mansoni OX=6183 GN=GST28 PE=1 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 2.806e-14
Identity = 54/213 (25.35%), Postives = 101/213 (47.42%), Query Frame = 1
Query:  103 NKFVRLHYYDCRGEAEVLRLLFKAANIKFEDKRYTEEEWETAKSAFKIKELPLVENYDG----RLLTEPSAICRFYSLNRGLLGSSDWEYYMIEKCIEHADESCHILNDVVFK------NITLDDHHEHALSSSLKT-LNKVAEVNKNG---FLVGKTASLADIYLLVLLDFAEMRAAKEHFTRFKKLHEVKKKLLNTFPEINTWITTMRPIT 699
             + +++ Y+D RG AE +R+   AA + +ED+R + ++W   K       LP V+  D     + + E  AI R+ +    ++G +D EYY +EK I  A++  H  +  + K       IT     +  L+  +   LN + E  K       VG   +LAD+ L+ ++D            ++ ++H+ ++ LL + P +  +++  RP T
Sbjct:    3 GEHIKVIYFDGRGRAESIRMTLVAAGVDYEDERISFQDWPKIKPTIPGGRLPAVKVTDDHGHVKWMLESLAIARYMAKKHHMMGETDEEYYSVEKLIGQAEDVEHEYHKTLMKPQEEKEKIT-----KEILNGKVPVLLNMICESLKGSTGKLAVGDKVTLADLVLIAVIDHVTDLDKGFLTGKYPEIHKHRENLLASSPRLAKYLSN-RPAT 209          
BLAST of Glutathione S-transferase protein vs. UniProt/SwissProt
Match: sp|O18598|GST1_BLAGE (Glutathione S-transferase OS=Blattella germanica OX=6973 PE=1 SV=3)

HSP 1 Score: 70.8626 bits (172), Expect = 1.223e-13
Identity = 53/207 (25.60%), Postives = 86/207 (41.55%), Query Frame = 1
Query:  100 MNKFVRLHYYDCRGEAEVLRLLFKAANIKFEDKRYTEEEWETAKSAFKIKELPLVENYDGRLLTEPSAICRFYSLNRGLLGSSDWEYYMIEKCIE------HADESCHILNDVVFKNITLDDHHEHALSSSLKTLNKVAEVNKNGFLVGKTASLADIYLLVLLDFAEMRAAKEHFTRFKKLHEVKKKLLNTFPEINTWITTMRPITD 702
            M    +L Y   +   E +R L       FED R+ E +W   K +    + P++E  DG+   +  AI R+     GL G  DWE   I+  ++       A  + H   D   K    D   +  +    K  ++V + N  G+L     + AD Y + +LD+    A ++       L  +++K+L   P I  W+   RP TD
Sbjct:    1 MAPSYKLTYCPVKALGEPIRFLLSYGEKDFEDYRFQEGDWPNLKPSMPFGKTPVLE-IDGKQTHQSVAISRYLGKQFGLSGKDDWENLEIDMIVDTISDFRAAIANYHYDADENSKQKKWDPLKKETIPYYTKKFDEVVKAN-GGYLAAGKLTWADFYFVAILDYLNHMAKEDLVANQPNLKALREKVLG-LPAIKAWVAK-RPPTD 203          
BLAST of Glutathione S-transferase protein vs. UniProt/SwissProt
Match: sp|Q21355|GST4_CAEEL (Glutathione S-transferase 4 OS=Caenorhabditis elegans OX=6239 GN=gst-4 PE=2 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 1.529e-13
Identity = 56/209 (26.79%), Postives = 96/209 (45.93%), Query Frame = 1
Query:  115 RLHYYDCRGEAEVLRLLFKAANIKFEDKRYTEEEWETAKSAFKIKELPLVENYDGRLLTEPSAICRFYSLNRGLLGSSDWE-----------------YYMIEKCIEHADESCHILNDVVFKNITLDDHHEHALSSSLKTLNKVAEVNKNGFLVGKTASLADIYLLVLLDFAEMRAAKEHFTRFKKLHEVKKKLLNTFPEINTWITTMR 690
            +L Y+D R  AE +R++F   N+ +ED R + EEW   K      +LP+++  DG    +  +I R+ +   GL G +  E                 +      + +  ++ HI N V F+ +      E A    L  +NK    +K+GFLVG + + ADI +   L  + ++     F + KKL E   K +++ PEI  ++ T +
Sbjct:    5 KLLYFDARALAEPIRIMFAMLNVPYEDYRVSVEEWSKLKPTTPFGQLPILQ-VDGEQFGQSMSITRYLARKFGLAGKTAEEEAYADSIVDQYRDFIFFFRQFTSSVFYGSDADHI-NKVRFEVV------EPARDDFLAIINKFLAKSKSGFLVGDSLTWADIVIADNLT-SLLKNGFLDFNKEKKLEEFYNK-IHSIPEIKNYVATRK 203          
BLAST of Glutathione S-transferase protein vs. TrEMBL
Match: A0A5A4MJP5 (Glutathione S-transferase OS=Dugesia japonica OX=6161 GN=GST PE=2 SV=1)

HSP 1 Score: 110.538 bits (275), Expect = 4.201e-26
Identity = 64/202 (31.68%), Postives = 113/202 (55.94%), Query Frame = 1
Query:  112 VRLHYYDCRGEAEVLRLLFKAANIKFEDKRYTEEEWETAKSAFKIKELPLVENYDGRLLTEPSAICRFYSLNRGLLGSSDWEYYMIEKCIEHADESCHILNDVVF-----KNITLDDHHEHALSSSLKTLNKVAEVNKNGFLVGKTASLADIYLLVLLDFAEMRAAKEHFTRFKKLHEVKKKLLNTFPEINTWITTMRPITD 702
            V++ Y++ RG AE++RL+ KA+ ++FED R T+E+W   K      +LP+VE ++G+ LT+  AI R  +   G +G  D EYY+IE+ I    +    +  + F     K     +    +   +LKTL     + ++GF VG+  +LA+++ +VL D+ E     + +  F KL E+++++L    ++  W+ T RP+TD
Sbjct:    4 VKVTYFNARGRAEIIRLVLKASKVEFEDVRLTKEQWAEVKPTTPTGKLPIVE-HEGKKLTQSMAIARAIARKYGFMGEDDKEYYLIERAIGQMVDVLEGMYKIYFAPEEKKEELRTEFVTTSGRDNLKTLEGF--IKESGFFVGEKITLAELFFVVLSDYLE--KMPKLYDDFPKLKELRERVLKANTDVEDWVKT-RPVTD 199          
BLAST of Glutathione S-transferase protein vs. TrEMBL
Match: I1ZI99 (Glutathione S transferase-1 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 108.997 bits (271), Expect = 1.412e-25
Identity = 61/200 (30.50%), Postives = 110/200 (55.00%), Query Frame = 1
Query:  112 VRLHYYDCRGEAEVLRLLFKAANIKFEDKRYTEEEWETAKSAFKIKELPLVENYDGRLLTEPSAICRFYSLNRGLLGSSDWEYYMIEKCIEHADESCHILNDVVFKNITLDD--HHEHALSSSLKTLNKVAE-VNKNGFLVGKTASLADIYLLVLLDFAEMRAAKEHFTRFKKLHEVKKKLLNTFPEINTWITTMRPITD 702
            V++ Y+D RG AE++RL+ KA+ I+FED R T+++W   K      +LP+VE Y+G+ LT+  AI R  +   G +G  D EYY++E+ I    +    L  + F      +    E+  +S    L  +   + + GF  G+  +LA+++ LV+ D+  +    + +  F KL E+++++L    ++  W+ T RP+T+
Sbjct:    4 VKVTYFDARGRAELIRLVLKASKIEFEDVRITKDKWPEVKPTTPTGKLPVVE-YEGKQLTQSMAIARVVARKHGFMGEDDKEYYLVERAIGQMVDVLEGLYKIYFAPEEKKEELRAEYVATSGRDNLKALEGFIKETGFFAGEKITLAELFFLVVSDY--LVKLPQLYDDFPKLKELRERILKANTDVEEWVNT-RPVTE 199          
BLAST of Glutathione S-transferase protein vs. TrEMBL
Match: A0A267DQQ2 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig031684g1 PE=4 SV=1)

HSP 1 Score: 104.76 bits (260), Expect = 1.013e-23
Identity = 60/200 (30.00%), Postives = 101/200 (50.50%), Query Frame = 1
Query:  115 RLHYYDCRGEAEVLRLLFKAANIKFEDKRYTEEEWETAKSAFKIKELPLVENYDGRLLTEPSAICRFYSLNRGLLGSSDWEYYMIEKCIEHADESCHILNDVVF-----KNITLDDHHEHALSSSLKTLNKVAEVNKNGFLVGKTASLADIYLLVLLDFAEMRAAKEHFTRFKKLHEVKKKLLNTFPEINTWITTMRPIT 699
            ++ Y++ RG AE++RL   A  ++F+D R+T EEW   K        P VE  +G+L+ +  AI RF +   GL G  DWE+Y++E+ +   D+    L  + F     K+  +           ++ L K  E   +GF  GK+ +LAD+  + ++D  ++    E   +F +L   KK++L   P++  WI   RP T
Sbjct:   26 KVCYFNARGRAELIRLALTAGGVEFDDVRFTREEWPEKKKIAPTGVAPWVETPNGKLV-QSGAIARFIAKKHGLYGEGDWEFYLVERALAQIDDVATELMKMYFAPEDKKSELVKQFQTEKGPKLIEGLLKFIEDGGSGFFAGKSVTLADLASVNMVD--QLALVPELLAKFPQLEAHKKRVLEAKPKVAEWIKN-RPQT 221          
BLAST of Glutathione S-transferase protein vs. TrEMBL
Match: A0A267H4F2 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig005819g2 PE=4 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 9.243e-23
Identity = 61/200 (30.50%), Postives = 101/200 (50.50%), Query Frame = 1
Query:  115 RLHYYDCRGEAEVLRLLFKAANIKFEDKRYTEEEWETAKSAFKIKELPLVENYDGRLLTEPSAICRFYSLNRGLLGSSDWEYYMIEKCIEHADESCHILNDVVF----KNITLDDHHEHALSSSL-KTLNKVAEVNKNGFLVGKTASLADIYLLVLLDFAEMRAAKEHFTRFKKLHEVKKKLLNTFPEINTWITTMRPIT 699
            ++ Y++ RG AE++RL   A  ++F+D R+T EEW   K        P VE  +G+L+ +  AI RF +   GL G  DWE+Y++E+ +   ++    L  + F    K   L    +      L + L K  E   +GF  GK+ +LAD+  + ++D  ++    E   +F +L   KK++L   P++  WI   RP T
Sbjct:   24 KVCYFNARGRAELIRLALTAGGVEFDDVRFTREEWPEKKKIAPTGVAPWVETPNGKLV-QSGAIARFIAKKHGLYGEGDWEFYLVERALAQIEDVATELMKMYFAPEDKKAELVKQFQTEKGPKLIEGLLKFIEDGGSGFFAGKSVTLADLASVNMVD--QLALVPELLAKFPQLEAHKKRVLEAKPKVAEWIKN-RPQT 219          
BLAST of Glutathione S-transferase protein vs. TrEMBL
Match: A0A267GL96 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig005819g1 PE=4 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 1.342e-22
Identity = 61/200 (30.50%), Postives = 101/200 (50.50%), Query Frame = 1
Query:  115 RLHYYDCRGEAEVLRLLFKAANIKFEDKRYTEEEWETAKSAFKIKELPLVENYDGRLLTEPSAICRFYSLNRGLLGSSDWEYYMIEKCIEHADESCHILNDVVF----KNITLDDHHEHALSSSL-KTLNKVAEVNKNGFLVGKTASLADIYLLVLLDFAEMRAAKEHFTRFKKLHEVKKKLLNTFPEINTWITTMRPIT 699
            ++ Y++ RG AE++RL   A  ++F+D R+T EEW   K        P VE  +G+L+ +  AI RF +   GL G  DWE+Y++E+ +   ++    L  + F    K   L    +      L + L K  E   +GF  GK+ +LAD+  + ++D  ++    E   +F +L   KK++L   P++  WI   RP T
Sbjct:   35 KVCYFNARGRAELIRLALTAGGVEFDDVRFTREEWPEKKKIAPTGVAPWVETPNGKLV-QSGAIARFIAKKHGLYGEGDWEFYLVERALAQIEDVATELMKMYFAPEDKKAELVKQFQTEKGPKLIEGLLKFIEDGGSGFFAGKSVTLADLASVNMVD--QLALVPELLAKFPQLEAHKKRVLEAKPKVAEWIKN-RPQT 230          
BLAST of Glutathione S-transferase protein vs. Ensembl Cavefish
Match: gsta.1 (glutathione S-transferase A4-like [Source:NCBI gene;Acc:103033890])

HSP 1 Score: 58.9214 bits (141), Expect = 3.964e-10
Identity = 58/207 (28.02%), Postives = 93/207 (44.93%), Query Frame = 1
Query:  100 MNKFVRLHYYDCRGEAEVLRLLFKAANIKFEDKRY-TEEEWE--TAKSAFKIKELPLVENYDGRLLTEPSAICRFYSLNRGLLGSSDWEYYMIEKCIEHADESCHILNDVVF-----KNITLDDHHEHALSSSLKTLNKVAEVNKNGFLVGKTASLADIYLLVLLDFAEMRAAKEHFTRFKKLHEVKKKLLNTFPEINTWITTMRPI 696
            M+  V LHY+  RG+ E +R L   A ++FE+K + T+EE++           ++PL+E  DG  + +  AI  + +    L G    E  MI+   E A +   ++  V F     K  TL++    A   SL    K   ++ + +LVG   S AD+    L + A M            L E+   +L+TFP I  +   M+ I
Sbjct:    1 MSGKVVLHYFIGRGKMESIRWLLTVAGVEFEEKFFSTKEEFQKLVESGDLLFHQVPLIE-MDGMKMVQTKAILNYIAGKYNLYGKDLKERLMIDTYAEGARDIMDLIMGVPFTPPEKKQSTLNNLETKAKVRSLPAYEKA--LSSSQYLVGNQLSCADVS---LFEVALM------------LEELFPTILSTFPNIQAFQKRMKAI 189          
BLAST of Glutathione S-transferase protein vs. Ensembl Cavefish
Match: ENSAMXT00000030565.1 (glutathione S-transferase Mu 3 [Source:NCBI gene;Acc:103025109])

HSP 1 Score: 46.595 bits (109), Expect = 6.244e-6
Identity = 29/90 (32.22%), Postives = 48/90 (53.33%), Query Frame = 1
Query:  112 VRLHYYDCRGEAEVLRLLFKAANIKFEDKRYTEEE--------WETAKSAFKI--KELPLVENYDGRLLTEPSAICRFYSLNRGLLGSSD 351
            ++LHY+D RG A+ +RLL +   +K+EDK Y+  E        W   K   K+    LP +E+ D R +++ +AI R+      L G ++
Sbjct:    1 MKLHYWDIRGLAQPIRLLLEYTGVKYEDKFYSCGEAPDYDKSCWFNEKPKLKMDFPNLPYLEDGD-RKISQSNAIMRYIGRKHNLCGETE 89          
BLAST of Glutathione S-transferase protein vs. Ensembl Cavefish
Match: ENSAMXT00000048694.1 (glutathione S-transferase Mu 3 [Source:NCBI gene;Acc:103025109])

HSP 1 Score: 46.595 bits (109), Expect = 6.244e-6
Identity = 29/90 (32.22%), Postives = 48/90 (53.33%), Query Frame = 1
Query:  112 VRLHYYDCRGEAEVLRLLFKAANIKFEDKRYTEEE--------WETAKSAFKI--KELPLVENYDGRLLTEPSAICRFYSLNRGLLGSSD 351
            ++LHY+D RG A+ +RLL +   +K+EDK Y+  E        W   K   K+    LP +E+ D R +++ +AI R+      L G ++
Sbjct:    1 MKLHYWDIRGLAQPIRLLLEYTGVKYEDKFYSCGEAPDYDKSCWFNEKPKLKMDFPNLPYLEDGD-RKISQSNAIMRYIGRKHNLCGETE 89          
BLAST of Glutathione S-transferase protein vs. Ensembl Nematostella
Match: EDO33767 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SR87])

HSP 1 Score: 71.2478 bits (173), Expect = 4.502e-15
Identity = 51/164 (31.10%), Postives = 77/164 (46.95%), Query Frame = 1
Query:  100 MNKFVRLHYYDCRGEAEVLRLLFKAANIKFEDKRYTEEEWETAKSAFKIK--ELPLVENYDGRLLTEPSAICRFYSLNRGLLGSSDWEYYMIEKCIEHADESCHIL---------NDVVFKNITLDDHHEHALSSSLKTLNKVAEVNKN--GFLVGKTASLADI 552
            M    R+ Y+D R  AE +R+L   A++ F D+R    +W   K++ +    ELPL+E  DGR L +  AI RF +   GL  S   + Y   +C    D +  ++          D   K     + HE  L   L+ +NK+ + NK   G+LVG   + ADI
Sbjct:    1 MAPTYRVVYFDARARAECIRVLLHLADVPFTDERVAPPDWAAMKTSGRCPFGELPLLEISDGRKLAQSHAIFRFLAKEHGLAPS---DSYSQARCDMFLDNTKDMIEKVGTAFWEKDEKLKEQKSKEFHEETLPKRLEFINKLFQENKGGKGYLVGDKITYADI 161          
BLAST of Glutathione S-transferase protein vs. Ensembl Nematostella
Match: EDO45159 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTW9])

HSP 1 Score: 66.6254 bits (161), Expect = 1.881e-13
Identity = 63/208 (30.29%), Postives = 95/208 (45.67%), Query Frame = 1
Query:  115 RLHYYDCRGEAEVLRLLFKAANIKFEDKRYTEEEWETAKSAF--KIKELPLVENYDGRLLTEPSAICRFYSLNRGLLGSSDWEYYMIEKC--IEHADE-------SCHILNDVVFKNITLDDHHEHA-LSSSLKTLNKVAEVNKNGFLVGKTASLADIYLLVLLDFAEMRAAKEHFTRFKKLHEVKKKLLNTFPEINTWITTMRPITD 702
            +L+Y++ RG AE  RL+F AA I+FED R    EW   K        ++PL+   D   L +  AI  F +   GL  S+  +   I KC  I  A+E        CH   D   K   LD+  ++  L + +  L K+ E N  GFLV    + ADI +    +  +   A + F + K+ H+     + + P I  ++   RP TD
Sbjct:    5 KLYYFNARGRAEPARLVFAAAGIEFEDNRMAMGEWPKVKKELHAPFGQVPLLVIDDKIKLAQSLAIMTFIAREGGLAPSNSLD---IAKCDMIVGAEEDFLTKKIQCHFEKDEA-KKKELDEAIQNTHLPAFMGALTKILEENGTGFLVTDKMTYADIIVFNACNNLD-SGALDKFPKLKQHHD----RIASNPGIKAYLEK-RPKTD 202          
BLAST of Glutathione S-transferase protein vs. Ensembl Nematostella
Match: EDO38608 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCI4])

HSP 1 Score: 63.929 bits (154), Expect = 1.751e-12
Identity = 59/209 (28.23%), Postives = 90/209 (43.06%), Query Frame = 1
Query:  115 RLHYYDCRGEAEVLRLLFKAANIKFEDKRY-TEEEWETAKSAF--KIKELPLVENYDGRLLTEPSAICRFYSLNRGLLGSSDWEYYMIEKCIEHADESCHILNDVVFKNITLDDHHEHAL-----------SSSLKTLNKVAEVNKNGFLVGKTASLADIYLLVLLDFAEMRAAKEHFTRFKKLHEVKKKLLNTFPEINTWITTMRPIT 699
            +LHY++ RG AE  RL F AA I++EDKR+   EEW   K        ++PL+   D   L +  AI  + +   GL  ++  +  M +  +    +    LN    K     D  +  L            + L+ ++K  E N  GFLV    + ADI +  + D A     K+   + K+ HE    L+   P I  W+   RP T
Sbjct:    5 KLHYFNARGRAEPARLAFAAAGIEYEDKRFEGREEWLRVKPELDPPFGQVPLLVIDDKIKLAQSMAILAYVAREGGLAPTNSLDIAMCDMIVGVEGD----LNSKGMKWFMEKDEKKKVLKLREELDTTHIPAFLEAMSKFLEKNGTGFLVTDKLTYADILVFNVCDNAPAEVLKK-CPKMKEFHE----LIAAIPGIKAWLEK-RPKT 203          
BLAST of Glutathione S-transferase protein vs. Ensembl Nematostella
Match: EDO47468 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMA1])

HSP 1 Score: 55.4546 bits (132), Expect = 1.622e-9
Identity = 55/195 (28.21%), Postives = 79/195 (40.51%), Query Frame = 1
Query:  115 RLHYYDCRGEAEVLRLLFKAANIKFEDKRYTEEEWETAKSAF--KIKELPLVENYDGRLLTEPSAICRFYSLNRGLLGSSDWEYYMIEKCIEHADE------SCHILNDVVFK---NITLDDHHEHALSSSLKTLNKVAEVNKNGFLVGKTASLADIYLLVLLDFAEMRAAKEHFTRFKKLHEVKKKLLNTFPEI 666
            +L+Y+D RG AE  RL F AA I++EDKR   EEW   K        ++PL+   D   L +  AI  + +   GL   +  +  M +  +   ++        H   D   K      L+  H  A   +L  + K  + NK GFLV    + ADI +               F  F  L       L+ FPEI
Sbjct:    5 KLYYFDGRGRAEPARLAFAAAGIEYEDKRMQFEEWPKIKKEIDAPFGQVPLLVIDDKIKLAQSLAIMTYIAREGGLAPVNSLDIAMCDMIVGAEEDFVQKQYKWHFEKDEAKKTELGEALEKTHLPAFVEALTRILKKND-NKTGFLVTDKMTYADIVV---------------FNVFNNLSSTDGFSLDKFPEI 183          
BLAST of Glutathione S-transferase protein vs. Ensembl Nematostella
Match: EDO45327 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RT47])

HSP 1 Score: 53.5286 bits (127), Expect = 8.497e-9
Identity = 61/206 (29.61%), Postives = 83/206 (40.29%), Query Frame = 1
Query:  115 RLHYYDCRGEAEVLRLLFKAANIKFEDKRYTEEEWETAKSAFK--IKELPLVENYDGRLLTEPSAICRFYSLNRGLLGSSDWEYYMIEKCIEHADESCHILNDVVFKNITLDDHHEHALSSSLKT--LNK---------VAEVNKNG---FLVGKTASLADIYLLVLLD-FAEMRAAK-EHFTRFKKLHEVKKKLLNTFPEINTWI 678
            +L Y++ RG AE  RL F A  I +ED R T EEW   K+  K  +  LP++E  DG    E  AI R  +   GL  +  +E     +C    D S  +    +      D   +  L    K   LNK          A+ N +G   + VG   + ADI L    D F  M     E+F   + L     K +   P I  WI
Sbjct:    5 KLIYFNTRGRAEPTRLCFAAGGIPYEDVRLTGEEWTKMKAENKTIMGYLPVLE-VDGIQYCESMAIFRLAAKLAGLCPTCPYEQ---ARCDMVVDCSSDLFAKAMKFFFEKDQEQKKKLQEEFKEQHLNKFWDIMERLLTAKCNLDGSAQYFVGNKLTYADIILFSTSDTFESMFPGMLENFPGLRDLF----KRVGENPGIKAWI 202          
BLAST of Glutathione S-transferase protein vs. Planmine SMEST
Match: SMESG000032177.1 (SMESG000032177.1)

HSP 1 Score: 417.157 bits (1071), Expect = 3.302e-150
Identity = 202/202 (100.00%), Postives = 202/202 (100.00%), Query Frame = 1
Query:  100 MNKFVRLHYYDCRGEAEVLRLLFKAANIKFEDKRYTEEEWETAKSAFKIKELPLVENYDGRLLTEPSAICRFYSLNRGLLGSSDWEYYMIEKCIEHADESCHILNDVVFKNITLDDHHEHALSSSLKTLNKVAEVNKNGFLVGKTASLADIYLLVLLDFAEMRAAKEHFTRFKKLHEVKKKLLNTFPEINTWITTMRPITDN 705
            MNKFVRLHYYDCRGEAEVLRLLFKAANIKFEDKRYTEEEWETAKSAFKIKELPLVENYDGRLLTEPSAICRFYSLNRGLLGSSDWEYYMIEKCIEHADESCHILNDVVFKNITLDDHHEHALSSSLKTLNKVAEVNKNGFLVGKTASLADIYLLVLLDFAEMRAAKEHFTRFKKLHEVKKKLLNTFPEINTWITTMRPITDN
Sbjct:    1 MNKFVRLHYYDCRGEAEVLRLLFKAANIKFEDKRYTEEEWETAKSAFKIKELPLVENYDGRLLTEPSAICRFYSLNRGLLGSSDWEYYMIEKCIEHADESCHILNDVVFKNITLDDHHEHALSSSLKTLNKVAEVNKNGFLVGKTASLADIYLLVLLDFAEMRAAKEHFTRFKKLHEVKKKLLNTFPEINTWITTMRPITDN 202          
BLAST of Glutathione S-transferase protein vs. Planmine SMEST
Match: SMESG000003087.1 (SMESG000003087.1)

HSP 1 Score: 108.997 bits (271), Expect = 3.926e-29
Identity = 61/200 (30.50%), Postives = 110/200 (55.00%), Query Frame = 1
Query:  112 VRLHYYDCRGEAEVLRLLFKAANIKFEDKRYTEEEWETAKSAFKIKELPLVENYDGRLLTEPSAICRFYSLNRGLLGSSDWEYYMIEKCIEHADESCHILNDVVFKNITLDD--HHEHALSSSLKTLNKVAE-VNKNGFLVGKTASLADIYLLVLLDFAEMRAAKEHFTRFKKLHEVKKKLLNTFPEINTWITTMRPITD 702
            V++ Y+D RG AE++RL+ KA+ I+FED R T+++W   K      +LP+VE Y+G+ LT+  AI R  +   G +G  D EYY++E+ I    +    L  + F      +    E+  +S    L  +   + + GF  G+  +LA+++ LV+ D+  +    + +  F KL E+++++L    ++  W+ T RP+T+
Sbjct:    4 VKVTYFDARGRAELIRLVLKASKIEFEDVRITKDKWPEVKPTTPTGKLPVVE-YEGKQLTQSMAIARVVARKHGFMGEDDKEYYLVERAIGQMVDVLEGLYKIYFAPEEKKEELRAEYVATSGRDNLKALEGFIKETGFFAGEKITLAELFFLVVSDY--LVKLPQLYDDFPKLKELRERILKANTDVEEWVNT-RPVTE 199          
BLAST of Glutathione S-transferase protein vs. Planmine SMEST
Match: SMESG000016836.1 (SMESG000016836.1)

HSP 1 Score: 89.7373 bits (221), Expect = 9.112e-22
Identity = 64/209 (30.62%), Postives = 99/209 (47.37%), Query Frame = 1
Query:  115 RLHYYDCRGEAEVLRLLFKAANIKFEDKRYTEEEWETAKSAFKIKELPLVENYDGRLLTEPSAICRFYSLNRGLLGSSDWEYYMIEKCIEHADESCHILNDVVFKNITL----DDHHEHALSSSLK---------TLNKVAEVNKNGFLVGKTASLADIYLLVLLD-FAEMRAAKEHFTRFKKLHEVKKKLLNTFPEINTWITTMRPIT 699
            +L Y+D RG  E++R +  + N KF+D+R T E+W   K +    +LP++    G  L E  AI RF +    L G  + E Y I++ I+        +ND+  K +      D+  +  +   LK          L K  +  K  FL G  ASLAD++L V+LD   E + A      F KL  +  K++ ++P I   + T RP T
Sbjct:    5 KLTYFDGRGRGELIRFILHSQNEKFDDERLTFEQWGARKPSVTYGQLPVLTLECGTQLNESMAISRFLARKAKLYGKDEMETYRIDRAID-------TINDLYLKAVQSIFEKDEKKKAEMQKDLKEKFVPQYFGNLVKYIDEGKGAFLAGANASLADLFLCVILDSLPEAKPA------FPKLENIYNKVMTSYPGIKKHVET-RPQT 199          
BLAST of Glutathione S-transferase protein vs. Planmine SMEST
Match: SMESG000016846.1 (SMESG000016846.1)

HSP 1 Score: 77.411 bits (189), Expect = 4.540e-17
Identity = 57/210 (27.14%), Postives = 105/210 (50.00%), Query Frame = 1
Query:  100 MNKFVRLHYYDCRGEAEVLRLLFKAANIKFEDKRYTEEEWETAKSAFKIKELPLVENYDGRLLTEPSAICRFYSLNRGLLGSSDWEYYMIEKCIEHADESCHILNDVVFKNITLDDHHEHALSSS--LKT----------LNKVAEV---NKNGFLVGKTASLADIYLLVLLDFAEMRAAKEHFTRFKKLHEVKKKLLNTFPEINTWITT 684
            M + +++ Y++ + +AE++RL+  A+N+ FEDKR   E+W   K +    +LP+V+   G +L E  AI R+++    L GS + E Y        AD +   L+D+  K   +D  HE  +  S  L+T          LN+V+     +   F +G   S AD+ L+ ++D  E    +  +  + K+ +  +++L  FP++  +  T
Sbjct:    1 MAEKIKITYFNAKAKAELIRLILVASNVDFEDKRIEFEDWPQLKPSIPSGQLPVVQLTCGTILNESLAIARYFAKKYHLAGSGEIEEY-------KADRAVCTLDDLFTK--IVDIFHEKDVEKSKLLRTELNETHLAIFLNRVSGYFTEHDGDFFLGSKPSYADLQLVNIMDHFE----ESQYQNYPKIVKCYQQVLEHFPKVKEYKAT 197          
BLAST of Glutathione S-transferase protein vs. Planmine SMEST
Match: SMESG000066038.1 (SMESG000066038.1)

HSP 1 Score: 71.633 bits (174), Expect = 3.490e-15
Identity = 42/189 (22.22%), Postives = 93/189 (49.21%), Query Frame = 1
Query:  112 VRLHYYDCRGEAEVLRLLFKAANIKFEDKRYTEEEWETAKSAFKIKELPLVENYDGRLLTEPSAICRFYSLNRGLLGSSDWEYYMIEKCIEHADESCHILNDVVFKNITLDDHHEHALSSSLKTLNKVAEVNKNGFLVGKTASLADIYLLVLLDFAEMRAAKEHFTRFKKLHEVKKKLLNTFPEINTWI 678
            ++L++       +++ +   A  + +ED R +++     K        P +EN +G++L +  AI +FY+  +  +G  DW+ Y IEK I    +   +L+ ++ +   + +  ++     L+ + K+   N +GFLV K  +L D+Y LV++++ +     +          V +K+L T P++  ++
Sbjct:    3 LKLYWNPKNPTHQLIPITLIATGVVYEDIRLSDDNTHHGKHP------PYIENAEGKVLDKTLAIAKFYAKRKNCMGKDDWDLYCIEKGISLISKIVRLLSSILNRKCEISEWDKNK-EMYLRHIEKLITENGHGFLVTKGITLTDLYFLVMMNYLKFTTFSKTLENHPNFITVHEKILATLPQVKEYL 184          
The following BLAST results are available for this feature:
BLAST of Glutathione S-transferase protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HPGDS2.449e-1031.68hematopoietic prostaglandin D synthase [Source:HGN... [more]
GSTA47.002e-725.61glutathione S-transferase alpha 4 [Source:HGNC Sym... [more]
GSTA47.002e-725.61glutathione S-transferase alpha 4 [Source:HGNC Sym... [more]
GSTA31.169e-625.24glutathione S-transferase alpha 3 [Source:HGNC Sym... [more]
GSTA21.439e-624.88glutathione S-transferase alpha 2 [Source:HGNC Sym... [more]
back to top
BLAST of Glutathione S-transferase protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gst-382.178e-1729.67Glutathione S-Transferase [Source:UniProtKB/TrEMB... [more]
gst-398.001e-1729.05Glutathione S-Transferase [Source:UniProtKB/TrEMB... [more]
gst-41.202e-1426.79Glutathione S-transferase 4 [Source:UniProtKB/Swi... [more]
gst-242.651e-1426.67Glutathione S-Transferase [Source:UniProtKB/TrEMB... [more]
gst-53.336e-1427.18Probable glutathione S-transferase 5 [Source:UniP... [more]
back to top
BLAST of Glutathione S-transferase protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
GstS15.189e-1325.84gene:FBgn0010226 transcript:FBtr0087005[more]
GstS15.189e-1325.84gene:FBgn0010226 transcript:FBtr0100258[more]
GstS15.189e-1325.84gene:FBgn0010226 transcript:FBtr0087006[more]
GstS12.367e-1223.76gene:FBgn0010226 transcript:FBtr0333551[more]
back to top
BLAST of Glutathione S-transferase protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gsta.11.672e-928.30glutathione S-transferase, alpha tandem duplicate ... [more]
gsta.11.672e-928.30glutathione S-transferase, alpha tandem duplicate ... [more]
AL929536.35.188e-928.02pep chromosome:GRCz11:13:835390:840787:1 gene:ENSD... [more]
AL929536.15.188e-928.02pep chromosome:GRCz11:CHR_ALT_CTG13_1_1:843683:849... [more]
gsta.22.665e-825.71glutathione S-transferase, alpha tandem duplicate ... [more]
back to top
BLAST of Glutathione S-transferase protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hpgds2.951e-1126.70hematopoietic prostaglandin D synthase [Source:NCB... [more]
gsta45.132e-1126.51glutathione S-transferase alpha 4 [Source:NCBI gen... [more]
gnrhr1.383e-827.32gonadotropin releasing hormone receptor [Source:Xe... [more]
gnrhr2.324e-727.15gonadotropin releasing hormone receptor [Source:Xe... [more]
gnrhr8.972e-726.70gonadotropin releasing hormone receptor [Source:Xe... [more]
back to top
BLAST of Glutathione S-transferase protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hpgds6.408e-924.27hematopoietic prostaglandin D synthase [Source:MGI... [more]
Gsta42.262e-827.92glutathione S-transferase, alpha 4 [Source:MGI Sym... [more]
Gsta31.067e-630.19glutathione S-transferase, alpha 3 [Source:MGI Sym... [more]
Gsta31.067e-630.19glutathione S-transferase, alpha 3 [Source:MGI Sym... [more]
Gsta13.304e-626.87glutathione S-transferase, alpha 1 (Ya) [Source:MG... [more]
back to top
BLAST of Glutathione S-transferase protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P46428|GST_ANOGA4.711e-1928.29Glutathione S-transferase OS=Anopheles gambiae OX=... [more]
sp|P26624|GST28_SCHJA2.728e-1626.47Glutathione S-transferase class-mu 28 kDa isozyme ... [more]
sp|P09792|GST28_SCHMA2.806e-1425.35Glutathione S-transferase class-mu 28 kDa isozyme ... [more]
sp|O18598|GST1_BLAGE1.223e-1325.60Glutathione S-transferase OS=Blattella germanica O... [more]
sp|Q21355|GST4_CAEEL1.529e-1326.79Glutathione S-transferase 4 OS=Caenorhabditis eleg... [more]
back to top
BLAST of Glutathione S-transferase protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5A4MJP54.201e-2631.68Glutathione S-transferase OS=Dugesia japonica OX=6... [more]
I1ZI991.412e-2530.50Glutathione S transferase-1 OS=Schmidtea mediterra... [more]
A0A267DQQ21.013e-2330.00Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267H4F29.243e-2330.50Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267GL961.342e-2230.50Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
back to top
BLAST of Glutathione S-transferase protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
gsta.13.964e-1028.02glutathione S-transferase A4-like [Source:NCBI gen... [more]
ENSAMXT00000030565.16.244e-632.22glutathione S-transferase Mu 3 [Source:NCBI gene;A... [more]
ENSAMXT00000048694.16.244e-632.22glutathione S-transferase Mu 3 [Source:NCBI gene;A... [more]
back to top
BLAST of Glutathione S-transferase protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glutathione S-transferase protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glutathione S-transferase protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO337674.502e-1531.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO451591.881e-1330.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO386081.751e-1228.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO474681.622e-928.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO453278.497e-929.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Glutathione S-transferase protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glutathione S-transferase protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000032177.13.302e-150100.00SMESG000032177.1[more]
SMESG000003087.13.926e-2930.50SMESG000003087.1[more]
SMESG000016836.19.112e-2230.62SMESG000016836.1[more]
SMESG000016846.14.540e-1727.14SMESG000016846.1[more]
SMESG000066038.13.490e-1522.22SMESG000066038.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024350 ID=SMED30024350|Name=Glutathione S-transferase protein|organism=Schmidtea mediterranea sexual|type=transcript|length=744bp
CAACACTTTTGCTGAATTTGTTTTTTATCAATTAATGCAATTTATTATGA
TAAGAAAATTATTTTGATTAAATTGATTATAAAGAATATTGAAATTCGAA
TGAATAAGTTTGTTAGATTACACTATTACGATTGTCGAGGCGAAGCGGAA
GTTCTTCGGCTTTTATTTAAAGCTGCAAATATTAAATTTGAAGATAAACG
CTATACCGAAGAAGAATGGGAAACTGCAAAAAGTGCGTTTAAGATTAAAG
AATTACCTTTAGTTGAAAATTATGATGGTCGACTATTAACTGAACCTTCA
GCTATATGTAGGTTTTATTCATTAAATCGAGGTTTGCTGGGATCATCTGA
TTGGGAATACTATATGATAGAAAAATGTATTGAACATGCAGATGAATCTT
GTCATATACTTAATGATGTTGTTTTTAAAAATATTACTTTAGATGACCAT
CATGAACATGCTTTAAGTAGCTCTCTCAAGACATTGAATAAAGTAGCAGA
AGTAAACAAGAATGGATTTTTAGTTGGAAAAACTGCTTCTTTAGCAGACA
TTTATTTGCTTGTATTATTAGATTTTGCGGAAATGAGAGCCGCCAAAGAA
CATTTCACCAGATTTAAGAAATTACATGAAGTTAAAAAAAAATTATTAAA
TACCTTTCCTGAAATAAATACATGGATAACTACAATGCGTCCAATTACAG
ATAATTAATATAGCTCAAGCTGTTCATAGAATATTTCATTTTAG
back to top

protein sequence of SMED30024350-orf-1

>SMED30024350-orf-1 ID=SMED30024350-orf-1|Name=SMED30024350-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=203bp
MNKFVRLHYYDCRGEAEVLRLLFKAANIKFEDKRYTEEEWETAKSAFKIK
ELPLVENYDGRLLTEPSAICRFYSLNRGLLGSSDWEYYMIEKCIEHADES
CHILNDVVFKNITLDDHHEHALSSSLKTLNKVAEVNKNGFLVGKTASLAD
IYLLVLLDFAEMRAAKEHFTRFKKLHEVKKKLLNTFPEINTWITTMRPIT
DN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000136whole organism
Vocabulary: INTERPRO
TermDefinition
IPR036249Thioredoxin-like_sf
IPR040079Glutathione_S-Trfase
IPR036282Glutathione-S-Trfase_C_sf
IPR004046GST_C
IPR004045Glutathione_S-Trfase_N
IPR010987Glutathione-S-Trfase_C-like
IPR012336Thioredoxin-like_fold
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0016740transferase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR036249Thioredoxin-like superfamilyGENE3DG3DSA:3.40.30.10coord: 3..82
e-value: 1.1E-18
score: 69.0
IPR036249Thioredoxin-like superfamilySUPERFAMILYSSF52833Thioredoxin-likecoord: 5..72
NoneNo IPR availableGENE3DG3DSA:1.20.1050.10coord: 83..201
e-value: 8.7E-16
score: 60.6
NoneNo IPR availablePANTHERPTHR11571:SF206HEMATOPOIETIC PROSTAGLANDIN D SYNTHASEcoord: 3..195
NoneNo IPR availablePANTHERPTHR11571GLUTATHIONE S-TRANSFERASEcoord: 3..195
NoneNo IPR availableCDDcd03039GST_N_Sigma_likecoord: 5..72
e-value: 8.64547E-18
score: 72.1964
IPR004045Glutathione S-transferase, N-terminalPFAMPF02798GST_Ncoord: 7..71
e-value: 4.3E-5
score: 23.8
IPR004045Glutathione S-transferase, N-terminalPROSITEPS50404GST_NTERcoord: 3..81
score: 14.883
IPR004046Glutathione S-transferase, C-terminalPFAMPF14497GST_C_3coord: 115..193
e-value: 8.7E-8
score: 32.3
IPR040079Glutathione Transferase familySFLDSFLDS00019Glutathione_Transferase_(cytocoord: 5..177
e-value: 8.6E-23
score: 75.8
IPR010987Glutathione S-transferase, C-terminal-likePROSITEPS50405GST_CTERcoord: 83..202
score: 10.707
IPR036282Glutathione S-transferase, C-terminal domain superfamilySUPERFAMILYSSF47616GST C-terminal domain-likecoord: 79..198