Four and A half lim domains

Overview
NameFour and A half lim domains
Smed IDSMED30024345
Length (bp)1980
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Four and A half lim domains (SMED30024345) t-SNE clustered cells

Violin plots show distribution of expression levels for Four and A half lim domains (SMED30024345) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024345

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
testisSMED30024345h1SMcG0005745 Contig4229_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
early male germ cellSMED30024345h1SMcG0005745 Contig4229_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism asexual adult cDNA to DNA expression microarray evidence
testis primordiumSMED30024345h1SMcG0005745 Contig4229_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile stagecDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Four and A half lim domains vs. Ensembl Human
Match: FHL2 (four and a half LIM domains 2 [Source:HGNC Symbol;Acc:HGNC:3703])

HSP 1 Score: 340.502 bits (872), Expect = 2.512e-112
Identity = 150/273 (54.95%), Postives = 204/273 (74.73%), Query Frame = 2
Query:  842 FACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGGVTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGELFAKKCSKCTKPITGFGGCKFISFEDRHWHSECFTCYKCNISLVGKGFLTNDDKIICPDCGR 1660
            F C  C+ SL G +YIL+++ P C+ C+E+ +AN C++C   IGCD KDLS+KDRHWHE CF C +C +SLVD+PFA K++ L C+DCY N+++++C  C K    G RK EY+G  WHE CF+C  C+QPIGTKSFIP++    CVPCYE+++A +C +C   I  GGVTY+  PWHKECF CT C KQL+G +FT++++  YC  C+ +L+AKKC+ CT PI+G GG K+ISFE+R WH++CF C KC++SLVG+GFLT  D I+CPDCG+
Sbjct:    5 FDCHHCNESLFGKKYILREESPYCVVCFETLFANTCEECGKPIGCDCKDLSYKDRHWHEACFHCSQCRNSLVDKPFAAKEDQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGSSWHETCFICHRCQQPIGTKSFIPKDNQNFCVPCYEKQHAMQCVQCKKPITTGGVTYREQPWHKECFVCTACRKQLSGQRFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDCGK 277          

HSP 2 Score: 155.606 bits (392), Expect = 3.677e-42
Identity = 88/277 (31.77%), Postives = 133/277 (48.01%), Query Frame = 2
Query:  662 FKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEH-HPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGG----VTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGEL 1477
            F C  C+E L    Y      PYCV  +  L    C  C + I  +    + +  H H A F C  C NSL    +  K+DQ LC  CY ++Y++ CQ+C   I   ++ + +K   WHE CF C  C   +  + F  KDN  +C  CY+ + A +C  C K    G     YR + WH+ECF+C  CR+ +  + F  R+    C+ C+ + YA+KC  C   I   G    ++++   WH +CF C  CS  L G  F ++ +   C +C  ++
Sbjct:    5 FDCHHCNESLFGKKYILREESPYCVVCFETLFANTCEECGKPIGCDCKDLSYKDRHWHEACFHCSQCRNSLVDKPFAAKEDQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGSSWHETCFICHRCQQPIGTKSFIPKDNQNFCVPCYEKQHAMQCVQCKKPITTG--GVTYREQPWHKECFVCTACRKQLSGQRFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDCGKDI 279          

HSP 3 Score: 115.931 bits (289), Expect = 3.259e-28
Identity = 66/219 (30.14%), Postives = 104/219 (47.49%), Query Frame = 2
Query:  647 WHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAH---FACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFK--AGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPC 1288
            WH  CF C++C   LVD  +    ++  C   Y+     +C  C + I     TR ME +    H   F C  C   +    +I KD+Q  C+ CYE Q+A  C QC   I   +  ++++++ WH++CF C  C   L  Q F  +D+  YC +C+ + +A +C GC        G +   +  +QWH +CF C  C   +  + F+    DI+C  C
Sbjct:   61 WHEACFHCSQCRNSLVDKPFAAKEDQLLCTDCYSNEYSSKCQECKKTIMPG--TRKMEYKGSSWHETCFICHRCQQPIGTKSFIPKDNQNFCVPCYEKQHAMQCVQCKKPI--TTGGVTYREQPWHKECFVCTACRKQLSGQRFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDC 275          

HSP 4 Score: 91.6633 bits (226), Expect = 8.020e-20
Identity = 57/181 (31.49%), Postives = 88/181 (48.62%), Query Frame = 2
Query:  569 CTQCQSSIQAGQLAVRVEHAANTQMSWHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIG--CDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDC 1105
            C +C+ +I  G   +  + +     SWH  CF C  C + +    +    N+ +CV  Y +    +C  C + I T   T   EQ  H   F C +C   L+G R+  +DD   C+ C+   YA  C  C+  I     +K +SF++R WH  CF C +CS SLV + F T+ +++ C DC
Sbjct:  101 CQECKKTIMPGTRKMEYKGS-----SWHETCFICHRCQQPIGTKSFIPKDNQNFCVPCYEKQHAMQCVQCKKPITTGGVT-YREQPWHKECFVCTACRKQLSGQRFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDC 275          

HSP 5 Score: 54.299 bits (129), Expect = 2.881e-7
Identity = 36/124 (29.03%), Postives = 52/124 (41.94%), Query Frame = 2
Query:  560 ALPCTQCQSSIQAGQLAVRVEHAANTQMSWHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIF---TEEYTRAMEQEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGC 922
            A+ C QC+  I  G +  R       +  WH  CF CT C + L    +    +  YC+  +  L   +CA C   I      +Y    E++ H   F CK C  SL G  ++ + D  LC  C
Sbjct:  159 AMQCVQCKKPITTGGVTYR-------EQPWHKECFVCTACRKQLSGQRFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDC 275          
BLAST of Four and A half lim domains vs. Ensembl Human
Match: FHL2 (four and a half LIM domains 2 [Source:HGNC Symbol;Acc:HGNC:3703])

HSP 1 Score: 340.502 bits (872), Expect = 2.512e-112
Identity = 150/273 (54.95%), Postives = 204/273 (74.73%), Query Frame = 2
Query:  842 FACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGGVTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGELFAKKCSKCTKPITGFGGCKFISFEDRHWHSECFTCYKCNISLVGKGFLTNDDKIICPDCGR 1660
            F C  C+ SL G +YIL+++ P C+ C+E+ +AN C++C   IGCD KDLS+KDRHWHE CF C +C +SLVD+PFA K++ L C+DCY N+++++C  C K    G RK EY+G  WHE CF+C  C+QPIGTKSFIP++    CVPCYE+++A +C +C   I  GGVTY+  PWHKECF CT C KQL+G +FT++++  YC  C+ +L+AKKC+ CT PI+G GG K+ISFE+R WH++CF C KC++SLVG+GFLT  D I+CPDCG+
Sbjct:    5 FDCHHCNESLFGKKYILREESPYCVVCFETLFANTCEECGKPIGCDCKDLSYKDRHWHEACFHCSQCRNSLVDKPFAAKEDQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGSSWHETCFICHRCQQPIGTKSFIPKDNQNFCVPCYEKQHAMQCVQCKKPITTGGVTYREQPWHKECFVCTACRKQLSGQRFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDCGK 277          

HSP 2 Score: 155.606 bits (392), Expect = 3.677e-42
Identity = 88/277 (31.77%), Postives = 133/277 (48.01%), Query Frame = 2
Query:  662 FKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEH-HPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGG----VTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGEL 1477
            F C  C+E L    Y      PYCV  +  L    C  C + I  +    + +  H H A F C  C NSL    +  K+DQ LC  CY ++Y++ CQ+C   I   ++ + +K   WHE CF C  C   +  + F  KDN  +C  CY+ + A +C  C K    G     YR + WH+ECF+C  CR+ +  + F  R+    C+ C+ + YA+KC  C   I   G    ++++   WH +CF C  CS  L G  F ++ +   C +C  ++
Sbjct:    5 FDCHHCNESLFGKKYILREESPYCVVCFETLFANTCEECGKPIGCDCKDLSYKDRHWHEACFHCSQCRNSLVDKPFAAKEDQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGSSWHETCFICHRCQQPIGTKSFIPKDNQNFCVPCYEKQHAMQCVQCKKPITTG--GVTYREQPWHKECFVCTACRKQLSGQRFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDCGKDI 279          

HSP 3 Score: 115.931 bits (289), Expect = 3.259e-28
Identity = 66/219 (30.14%), Postives = 104/219 (47.49%), Query Frame = 2
Query:  647 WHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAH---FACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFK--AGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPC 1288
            WH  CF C++C   LVD  +    ++  C   Y+     +C  C + I     TR ME +    H   F C  C   +    +I KD+Q  C+ CYE Q+A  C QC   I   +  ++++++ WH++CF C  C   L  Q F  +D+  YC +C+ + +A +C GC        G +   +  +QWH +CF C  C   +  + F+    DI+C  C
Sbjct:   61 WHEACFHCSQCRNSLVDKPFAAKEDQLLCTDCYSNEYSSKCQECKKTIMPG--TRKMEYKGSSWHETCFICHRCQQPIGTKSFIPKDNQNFCVPCYEKQHAMQCVQCKKPI--TTGGVTYREQPWHKECFVCTACRKQLSGQRFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDC 275          

HSP 4 Score: 91.6633 bits (226), Expect = 8.020e-20
Identity = 57/181 (31.49%), Postives = 88/181 (48.62%), Query Frame = 2
Query:  569 CTQCQSSIQAGQLAVRVEHAANTQMSWHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIG--CDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDC 1105
            C +C+ +I  G   +  + +     SWH  CF C  C + +    +    N+ +CV  Y +    +C  C + I T   T   EQ  H   F C +C   L+G R+  +DD   C+ C+   YA  C  C+  I     +K +SF++R WH  CF C +CS SLV + F T+ +++ C DC
Sbjct:  101 CQECKKTIMPGTRKMEYKGS-----SWHETCFICHRCQQPIGTKSFIPKDNQNFCVPCYEKQHAMQCVQCKKPITTGGVT-YREQPWHKECFVCTACRKQLSGQRFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDC 275          

HSP 5 Score: 54.299 bits (129), Expect = 2.881e-7
Identity = 36/124 (29.03%), Postives = 52/124 (41.94%), Query Frame = 2
Query:  560 ALPCTQCQSSIQAGQLAVRVEHAANTQMSWHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIF---TEEYTRAMEQEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGC 922
            A+ C QC+  I  G +  R       +  WH  CF CT C + L    +    +  YC+  +  L   +CA C   I      +Y    E++ H   F CK C  SL G  ++ + D  LC  C
Sbjct:  159 AMQCVQCKKPITTGGVTYR-------EQPWHKECFVCTACRKQLSGQRFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDC 275          
BLAST of Four and A half lim domains vs. Ensembl Human
Match: FHL2 (four and a half LIM domains 2 [Source:HGNC Symbol;Acc:HGNC:3703])

HSP 1 Score: 340.502 bits (872), Expect = 2.512e-112
Identity = 150/273 (54.95%), Postives = 204/273 (74.73%), Query Frame = 2
Query:  842 FACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGGVTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGELFAKKCSKCTKPITGFGGCKFISFEDRHWHSECFTCYKCNISLVGKGFLTNDDKIICPDCGR 1660
            F C  C+ SL G +YIL+++ P C+ C+E+ +AN C++C   IGCD KDLS+KDRHWHE CF C +C +SLVD+PFA K++ L C+DCY N+++++C  C K    G RK EY+G  WHE CF+C  C+QPIGTKSFIP++    CVPCYE+++A +C +C   I  GGVTY+  PWHKECF CT C KQL+G +FT++++  YC  C+ +L+AKKC+ CT PI+G GG K+ISFE+R WH++CF C KC++SLVG+GFLT  D I+CPDCG+
Sbjct:    5 FDCHHCNESLFGKKYILREESPYCVVCFETLFANTCEECGKPIGCDCKDLSYKDRHWHEACFHCSQCRNSLVDKPFAAKEDQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGSSWHETCFICHRCQQPIGTKSFIPKDNQNFCVPCYEKQHAMQCVQCKKPITTGGVTYREQPWHKECFVCTACRKQLSGQRFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDCGK 277          

HSP 2 Score: 155.606 bits (392), Expect = 3.677e-42
Identity = 88/277 (31.77%), Postives = 133/277 (48.01%), Query Frame = 2
Query:  662 FKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEH-HPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGG----VTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGEL 1477
            F C  C+E L    Y      PYCV  +  L    C  C + I  +    + +  H H A F C  C NSL    +  K+DQ LC  CY ++Y++ CQ+C   I   ++ + +K   WHE CF C  C   +  + F  KDN  +C  CY+ + A +C  C K    G     YR + WH+ECF+C  CR+ +  + F  R+    C+ C+ + YA+KC  C   I   G    ++++   WH +CF C  CS  L G  F ++ +   C +C  ++
Sbjct:    5 FDCHHCNESLFGKKYILREESPYCVVCFETLFANTCEECGKPIGCDCKDLSYKDRHWHEACFHCSQCRNSLVDKPFAAKEDQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGSSWHETCFICHRCQQPIGTKSFIPKDNQNFCVPCYEKQHAMQCVQCKKPITTG--GVTYREQPWHKECFVCTACRKQLSGQRFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDCGKDI 279          

HSP 3 Score: 115.931 bits (289), Expect = 3.259e-28
Identity = 66/219 (30.14%), Postives = 104/219 (47.49%), Query Frame = 2
Query:  647 WHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAH---FACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFK--AGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPC 1288
            WH  CF C++C   LVD  +    ++  C   Y+     +C  C + I     TR ME +    H   F C  C   +    +I KD+Q  C+ CYE Q+A  C QC   I   +  ++++++ WH++CF C  C   L  Q F  +D+  YC +C+ + +A +C GC        G +   +  +QWH +CF C  C   +  + F+    DI+C  C
Sbjct:   61 WHEACFHCSQCRNSLVDKPFAAKEDQLLCTDCYSNEYSSKCQECKKTIMPG--TRKMEYKGSSWHETCFICHRCQQPIGTKSFIPKDNQNFCVPCYEKQHAMQCVQCKKPI--TTGGVTYREQPWHKECFVCTACRKQLSGQRFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDC 275          

HSP 4 Score: 91.6633 bits (226), Expect = 8.020e-20
Identity = 57/181 (31.49%), Postives = 88/181 (48.62%), Query Frame = 2
Query:  569 CTQCQSSIQAGQLAVRVEHAANTQMSWHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIG--CDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDC 1105
            C +C+ +I  G   +  + +     SWH  CF C  C + +    +    N+ +CV  Y +    +C  C + I T   T   EQ  H   F C +C   L+G R+  +DD   C+ C+   YA  C  C+  I     +K +SF++R WH  CF C +CS SLV + F T+ +++ C DC
Sbjct:  101 CQECKKTIMPGTRKMEYKGS-----SWHETCFICHRCQQPIGTKSFIPKDNQNFCVPCYEKQHAMQCVQCKKPITTGGVT-YREQPWHKECFVCTACRKQLSGQRFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDC 275          

HSP 5 Score: 54.299 bits (129), Expect = 2.881e-7
Identity = 36/124 (29.03%), Postives = 52/124 (41.94%), Query Frame = 2
Query:  560 ALPCTQCQSSIQAGQLAVRVEHAANTQMSWHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIF---TEEYTRAMEQEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGC 922
            A+ C QC+  I  G +  R       +  WH  CF CT C + L    +    +  YC+  +  L   +CA C   I      +Y    E++ H   F CK C  SL G  ++ + D  LC  C
Sbjct:  159 AMQCVQCKKPITTGGVTYR-------EQPWHKECFVCTACRKQLSGQRFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDC 275          
BLAST of Four and A half lim domains vs. Ensembl Human
Match: FHL2 (four and a half LIM domains 2 [Source:HGNC Symbol;Acc:HGNC:3703])

HSP 1 Score: 340.502 bits (872), Expect = 2.512e-112
Identity = 150/273 (54.95%), Postives = 204/273 (74.73%), Query Frame = 2
Query:  842 FACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGGVTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGELFAKKCSKCTKPITGFGGCKFISFEDRHWHSECFTCYKCNISLVGKGFLTNDDKIICPDCGR 1660
            F C  C+ SL G +YIL+++ P C+ C+E+ +AN C++C   IGCD KDLS+KDRHWHE CF C +C +SLVD+PFA K++ L C+DCY N+++++C  C K    G RK EY+G  WHE CF+C  C+QPIGTKSFIP++    CVPCYE+++A +C +C   I  GGVTY+  PWHKECF CT C KQL+G +FT++++  YC  C+ +L+AKKC+ CT PI+G GG K+ISFE+R WH++CF C KC++SLVG+GFLT  D I+CPDCG+
Sbjct:    5 FDCHHCNESLFGKKYILREESPYCVVCFETLFANTCEECGKPIGCDCKDLSYKDRHWHEACFHCSQCRNSLVDKPFAAKEDQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGSSWHETCFICHRCQQPIGTKSFIPKDNQNFCVPCYEKQHAMQCVQCKKPITTGGVTYREQPWHKECFVCTACRKQLSGQRFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDCGK 277          

HSP 2 Score: 155.606 bits (392), Expect = 3.677e-42
Identity = 88/277 (31.77%), Postives = 133/277 (48.01%), Query Frame = 2
Query:  662 FKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEH-HPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGG----VTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGEL 1477
            F C  C+E L    Y      PYCV  +  L    C  C + I  +    + +  H H A F C  C NSL    +  K+DQ LC  CY ++Y++ CQ+C   I   ++ + +K   WHE CF C  C   +  + F  KDN  +C  CY+ + A +C  C K    G     YR + WH+ECF+C  CR+ +  + F  R+    C+ C+ + YA+KC  C   I   G    ++++   WH +CF C  CS  L G  F ++ +   C +C  ++
Sbjct:    5 FDCHHCNESLFGKKYILREESPYCVVCFETLFANTCEECGKPIGCDCKDLSYKDRHWHEACFHCSQCRNSLVDKPFAAKEDQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGSSWHETCFICHRCQQPIGTKSFIPKDNQNFCVPCYEKQHAMQCVQCKKPITTG--GVTYREQPWHKECFVCTACRKQLSGQRFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDCGKDI 279          

HSP 3 Score: 115.931 bits (289), Expect = 3.259e-28
Identity = 66/219 (30.14%), Postives = 104/219 (47.49%), Query Frame = 2
Query:  647 WHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAH---FACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFK--AGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPC 1288
            WH  CF C++C   LVD  +    ++  C   Y+     +C  C + I     TR ME +    H   F C  C   +    +I KD+Q  C+ CYE Q+A  C QC   I   +  ++++++ WH++CF C  C   L  Q F  +D+  YC +C+ + +A +C GC        G +   +  +QWH +CF C  C   +  + F+    DI+C  C
Sbjct:   61 WHEACFHCSQCRNSLVDKPFAAKEDQLLCTDCYSNEYSSKCQECKKTIMPG--TRKMEYKGSSWHETCFICHRCQQPIGTKSFIPKDNQNFCVPCYEKQHAMQCVQCKKPI--TTGGVTYREQPWHKECFVCTACRKQLSGQRFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDC 275          

HSP 4 Score: 91.6633 bits (226), Expect = 8.020e-20
Identity = 57/181 (31.49%), Postives = 88/181 (48.62%), Query Frame = 2
Query:  569 CTQCQSSIQAGQLAVRVEHAANTQMSWHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIG--CDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDC 1105
            C +C+ +I  G   +  + +     SWH  CF C  C + +    +    N+ +CV  Y +    +C  C + I T   T   EQ  H   F C +C   L+G R+  +DD   C+ C+   YA  C  C+  I     +K +SF++R WH  CF C +CS SLV + F T+ +++ C DC
Sbjct:  101 CQECKKTIMPGTRKMEYKGS-----SWHETCFICHRCQQPIGTKSFIPKDNQNFCVPCYEKQHAMQCVQCKKPITTGGVT-YREQPWHKECFVCTACRKQLSGQRFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDC 275          

HSP 5 Score: 54.299 bits (129), Expect = 2.881e-7
Identity = 36/124 (29.03%), Postives = 52/124 (41.94%), Query Frame = 2
Query:  560 ALPCTQCQSSIQAGQLAVRVEHAANTQMSWHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIF---TEEYTRAMEQEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGC 922
            A+ C QC+  I  G +  R       +  WH  CF CT C + L    +    +  YC+  +  L   +CA C   I      +Y    E++ H   F CK C  SL G  ++ + D  LC  C
Sbjct:  159 AMQCVQCKKPITTGGVTYR-------EQPWHKECFVCTACRKQLSGQRFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDC 275          
BLAST of Four and A half lim domains vs. Ensembl Human
Match: FHL2 (four and a half LIM domains 2 [Source:HGNC Symbol;Acc:HGNC:3703])

HSP 1 Score: 340.502 bits (872), Expect = 2.512e-112
Identity = 150/273 (54.95%), Postives = 204/273 (74.73%), Query Frame = 2
Query:  842 FACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGGVTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGELFAKKCSKCTKPITGFGGCKFISFEDRHWHSECFTCYKCNISLVGKGFLTNDDKIICPDCGR 1660
            F C  C+ SL G +YIL+++ P C+ C+E+ +AN C++C   IGCD KDLS+KDRHWHE CF C +C +SLVD+PFA K++ L C+DCY N+++++C  C K    G RK EY+G  WHE CF+C  C+QPIGTKSFIP++    CVPCYE+++A +C +C   I  GGVTY+  PWHKECF CT C KQL+G +FT++++  YC  C+ +L+AKKC+ CT PI+G GG K+ISFE+R WH++CF C KC++SLVG+GFLT  D I+CPDCG+
Sbjct:    5 FDCHHCNESLFGKKYILREESPYCVVCFETLFANTCEECGKPIGCDCKDLSYKDRHWHEACFHCSQCRNSLVDKPFAAKEDQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGSSWHETCFICHRCQQPIGTKSFIPKDNQNFCVPCYEKQHAMQCVQCKKPITTGGVTYREQPWHKECFVCTACRKQLSGQRFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDCGK 277          

HSP 2 Score: 155.606 bits (392), Expect = 3.677e-42
Identity = 88/277 (31.77%), Postives = 133/277 (48.01%), Query Frame = 2
Query:  662 FKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEH-HPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGG----VTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGEL 1477
            F C  C+E L    Y      PYCV  +  L    C  C + I  +    + +  H H A F C  C NSL    +  K+DQ LC  CY ++Y++ CQ+C   I   ++ + +K   WHE CF C  C   +  + F  KDN  +C  CY+ + A +C  C K    G     YR + WH+ECF+C  CR+ +  + F  R+    C+ C+ + YA+KC  C   I   G    ++++   WH +CF C  CS  L G  F ++ +   C +C  ++
Sbjct:    5 FDCHHCNESLFGKKYILREESPYCVVCFETLFANTCEECGKPIGCDCKDLSYKDRHWHEACFHCSQCRNSLVDKPFAAKEDQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGSSWHETCFICHRCQQPIGTKSFIPKDNQNFCVPCYEKQHAMQCVQCKKPITTG--GVTYREQPWHKECFVCTACRKQLSGQRFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDCGKDI 279          

HSP 3 Score: 115.931 bits (289), Expect = 3.259e-28
Identity = 66/219 (30.14%), Postives = 104/219 (47.49%), Query Frame = 2
Query:  647 WHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAH---FACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFK--AGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPC 1288
            WH  CF C++C   LVD  +    ++  C   Y+     +C  C + I     TR ME +    H   F C  C   +    +I KD+Q  C+ CYE Q+A  C QC   I   +  ++++++ WH++CF C  C   L  Q F  +D+  YC +C+ + +A +C GC        G +   +  +QWH +CF C  C   +  + F+    DI+C  C
Sbjct:   61 WHEACFHCSQCRNSLVDKPFAAKEDQLLCTDCYSNEYSSKCQECKKTIMPG--TRKMEYKGSSWHETCFICHRCQQPIGTKSFIPKDNQNFCVPCYEKQHAMQCVQCKKPI--TTGGVTYREQPWHKECFVCTACRKQLSGQRFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDC 275          

HSP 4 Score: 91.6633 bits (226), Expect = 8.020e-20
Identity = 57/181 (31.49%), Postives = 88/181 (48.62%), Query Frame = 2
Query:  569 CTQCQSSIQAGQLAVRVEHAANTQMSWHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIG--CDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDC 1105
            C +C+ +I  G   +  + +     SWH  CF C  C + +    +    N+ +CV  Y +    +C  C + I T   T   EQ  H   F C +C   L+G R+  +DD   C+ C+   YA  C  C+  I     +K +SF++R WH  CF C +CS SLV + F T+ +++ C DC
Sbjct:  101 CQECKKTIMPGTRKMEYKGS-----SWHETCFICHRCQQPIGTKSFIPKDNQNFCVPCYEKQHAMQCVQCKKPITTGGVT-YREQPWHKECFVCTACRKQLSGQRFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDC 275          

HSP 5 Score: 54.299 bits (129), Expect = 2.881e-7
Identity = 36/124 (29.03%), Postives = 52/124 (41.94%), Query Frame = 2
Query:  560 ALPCTQCQSSIQAGQLAVRVEHAANTQMSWHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIF---TEEYTRAMEQEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGC 922
            A+ C QC+  I  G +  R       +  WH  CF CT C + L    +    +  YC+  +  L   +CA C   I      +Y    E++ H   F CK C  SL G  ++ + D  LC  C
Sbjct:  159 AMQCVQCKKPITTGGVTYR-------EQPWHKECFVCTACRKQLSGQRFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDC 275          
BLAST of Four and A half lim domains vs. Ensembl Celegans
Match: lim-9 (LIM domain family [Source:UniProtKB/TrEMBL;Acc:G5EDJ5])

HSP 1 Score: 549.666 bits (1415), Expect = 0.000e+0
Identity = 255/516 (49.42%), Postives = 347/516 (67.25%), Query Frame = 2
Query:  131 GFKIHGWRKTCLGCDCSVDRHDITDESPLPILEEMKL---ADKPYYNLFMESLKMARKYGLSWLPIGLQASEVEQFTSIVGGNIASRA---GEKLRKQKLRRQIPVHDRCVEKFSHLETPTERQEAEKFLQFRNNQDLGVGHVYRLDMAALPCTQCQSSIQAGQLAVRVEHAANTQMSWHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGGVTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGELFAKKCSKCTKPITGFGGCKFISFEDRHWHSECFTCYKCNISLVGKGFLTNDDKIICPDCGR 1660
            G+K H WRK C+ C      H++     L +   + +   A  P   +    +  +  +G +W+P GL   +VE++ S +  N+  R    GEKLR+++L  Q+P  D  V    HL + TER+  E+F+  RN   L +G+V      A+ C +C   ++  ++AV      ++   WHP CF C  C+++LVD  YC   N+ YC RHYA+L +PRC+ CDELIF  EYT+AM ++ H  HF C  CD +LTG RYI++D+QP CI CYE  +AN C +C+  IG DSKDLS+KD+HWHE CF C  C  SLVD PF +K++ ++CS+CYD  FATRCDGC+++F+AGM+K EY+GKQWH++CF C  C+  IGTKSFIP+  D+ C PCYEEK+A +C+KC  VI  GGVTYK  PWH+ECF CT+C+  LAG +FTSK+EKPYCA CYG+LFAK+C+ CTKPITG GG KFISFEDRHWH++CF C +C  SLVGKGF+T+  +I+CP+C +
Sbjct:  271 GWKQHPWRKVCVHCKSDRSDHELPPNQALNVYNRLGIQPPAGMPQSGVAEPEVPGSVGHGYAWVPPGLSRKKVEEYMSQLPNNVVPRTNSNGEKLREKQLLLQLPRQDLSVAYCRHLTSQTERKVYEEFVNARNEIALDIGYVSSNINKAMECHKCSGILETNEMAVIAPKLGDS-TGWHPACFTCQACEQLLVDLTYCVKDNQIYCERHYAELHKPRCSACDELIFAGEYTKAMNKDWHSDHFCCWQCDQTLTGQRYIMRDEQPYCIKCYEDVFANQCDECAKPIGIDSKDLSYKDKHWHEHCFLCSMCKISLVDMPFGSKNDRIFCSNCYDQAFATRCDGCNEIFRAGMKKMEYKGKQWHDKCFCCAHCKLAIGTKSFIPKNDDVFCGPCYEEKFATRCSKCKKVITAGGVTYKNEPWHRECFCCTNCNSSLAGQRFTSKDEKPYCANCYGDLFAKRCNACTKPITGIGGAKFISFEDRHWHNDCFICAQCTTSLVGKGFITDGHEILCPECAK 785          
BLAST of Four and A half lim domains vs. Ensembl Celegans
Match: lim-9 (LIM domain family [Source:UniProtKB/TrEMBL;Acc:G5EDJ5])

HSP 1 Score: 548.895 bits (1413), Expect = 0.000e+0
Identity = 255/516 (49.42%), Postives = 347/516 (67.25%), Query Frame = 2
Query:  131 GFKIHGWRKTCLGCDCSVDRHDITDESPLPILEEMKL---ADKPYYNLFMESLKMARKYGLSWLPIGLQASEVEQFTSIVGGNIASRA---GEKLRKQKLRRQIPVHDRCVEKFSHLETPTERQEAEKFLQFRNNQDLGVGHVYRLDMAALPCTQCQSSIQAGQLAVRVEHAANTQMSWHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGGVTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGELFAKKCSKCTKPITGFGGCKFISFEDRHWHSECFTCYKCNISLVGKGFLTNDDKIICPDCGR 1660
            G+K H WRK C+ C      H++     L +   + +   A  P   +    +  +  +G +W+P GL   +VE++ S +  N+  R    GEKLR+++L  Q+P  D  V    HL + TER+  E+F+  RN   L +G+V      A+ C +C   ++  ++AV      ++   WHP CF C  C+++LVD  YC   N+ YC RHYA+L +PRC+ CDELIF  EYT+AM ++ H  HF C  CD +LTG RYI++D+QP CI CYE  +AN C +C+  IG DSKDLS+KD+HWHE CF C  C  SLVD PF +K++ ++CS+CYD  FATRCDGC+++F+AGM+K EY+GKQWH++CF C  C+  IGTKSFIP+  D+ C PCYEEK+A +C+KC  VI  GGVTYK  PWH+ECF CT+C+  LAG +FTSK+EKPYCA CYG+LFAK+C+ CTKPITG GG KFISFEDRHWH++CF C +C  SLVGKGF+T+  +I+CP+C +
Sbjct:  241 GWKQHPWRKVCVHCKSDRSDHELPPNQALNVYNRLGIQPPAGMPQSGVAEPEVPGSVGHGYAWVPPGLSRKKVEEYMSQLPNNVVPRTNSNGEKLREKQLLLQLPRQDLSVAYCRHLTSQTERKVYEEFVNARNEIALDIGYVSSNINKAMECHKCSGILETNEMAVIAPKLGDS-TGWHPACFTCQACEQLLVDLTYCVKDNQIYCERHYAELHKPRCSACDELIFAGEYTKAMNKDWHSDHFCCWQCDQTLTGQRYIMRDEQPYCIKCYEDVFANQCDECAKPIGIDSKDLSYKDKHWHEHCFLCSMCKISLVDMPFGSKNDRIFCSNCYDQAFATRCDGCNEIFRAGMKKMEYKGKQWHDKCFCCAHCKLAIGTKSFIPKNDDVFCGPCYEEKFATRCSKCKKVITAGGVTYKNEPWHRECFCCTNCNSSLAGQRFTSKDEKPYCANCYGDLFAKRCNACTKPITGIGGAKFISFEDRHWHNDCFICAQCTTSLVGKGFITDGHEILCPECAK 755          
BLAST of Four and A half lim domains vs. Ensembl Celegans
Match: lim-9 (LIM domain family [Source:UniProtKB/TrEMBL;Acc:G5EDJ5])

HSP 1 Score: 547.354 bits (1409), Expect = 0.000e+0
Identity = 255/516 (49.42%), Postives = 347/516 (67.25%), Query Frame = 2
Query:  131 GFKIHGWRKTCLGCDCSVDRHDITDESPLPILEEMKL---ADKPYYNLFMESLKMARKYGLSWLPIGLQASEVEQFTSIVGGNIASRA---GEKLRKQKLRRQIPVHDRCVEKFSHLETPTERQEAEKFLQFRNNQDLGVGHVYRLDMAALPCTQCQSSIQAGQLAVRVEHAANTQMSWHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGGVTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGELFAKKCSKCTKPITGFGGCKFISFEDRHWHSECFTCYKCNISLVGKGFLTNDDKIICPDCGR 1660
            G+K H WRK C+ C      H++     L +   + +   A  P   +    +  +  +G +W+P GL   +VE++ S +  N+  R    GEKLR+++L  Q+P  D  V    HL + TER+  E+F+  RN   L +G+V      A+ C +C   ++  ++AV      ++   WHP CF C  C+++LVD  YC   N+ YC RHYA+L +PRC+ CDELIF  EYT+AM ++ H  HF C  CD +LTG RYI++D+QP CI CYE  +AN C +C+  IG DSKDLS+KD+HWHE CF C  C  SLVD PF +K++ ++CS+CYD  FATRCDGC+++F+AGM+K EY+GKQWH++CF C  C+  IGTKSFIP+  D+ C PCYEEK+A +C+KC  VI  GGVTYK  PWH+ECF CT+C+  LAG +FTSK+EKPYCA CYG+LFAK+C+ CTKPITG GG KFISFEDRHWH++CF C +C  SLVGKGF+T+  +I+CP+C +
Sbjct:  134 GWKQHPWRKVCVHCKSDRSDHELPPNQALNVYNRLGIQPPAGMPQSGVAEPEVPGSVGHGYAWVPPGLSRKKVEEYMSQLPNNVVPRTNSNGEKLREKQLLLQLPRQDLSVAYCRHLTSQTERKVYEEFVNARNEIALDIGYVSSNINKAMECHKCSGILETNEMAVIAPKLGDS-TGWHPACFTCQACEQLLVDLTYCVKDNQIYCERHYAELHKPRCSACDELIFAGEYTKAMNKDWHSDHFCCWQCDQTLTGQRYIMRDEQPYCIKCYEDVFANQCDECAKPIGIDSKDLSYKDKHWHEHCFLCSMCKISLVDMPFGSKNDRIFCSNCYDQAFATRCDGCNEIFRAGMKKMEYKGKQWHDKCFCCAHCKLAIGTKSFIPKNDDVFCGPCYEEKFATRCSKCKKVITAGGVTYKNEPWHRECFCCTNCNSSLAGQRFTSKDEKPYCANCYGDLFAKRCNACTKPITGIGGAKFISFEDRHWHNDCFICAQCTTSLVGKGFITDGHEILCPECAK 648          
BLAST of Four and A half lim domains vs. Ensembl Celegans
Match: lim-9 (LIM domain family [Source:UniProtKB/TrEMBL;Acc:G5EDJ5])

HSP 1 Score: 545.814 bits (1405), Expect = 0.000e+0
Identity = 255/516 (49.42%), Postives = 347/516 (67.25%), Query Frame = 2
Query:  131 GFKIHGWRKTCLGCDCSVDRHDITDESPLPILEEMKL---ADKPYYNLFMESLKMARKYGLSWLPIGLQASEVEQFTSIVGGNIASRA---GEKLRKQKLRRQIPVHDRCVEKFSHLETPTERQEAEKFLQFRNNQDLGVGHVYRLDMAALPCTQCQSSIQAGQLAVRVEHAANTQMSWHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGGVTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGELFAKKCSKCTKPITGFGGCKFISFEDRHWHSECFTCYKCNISLVGKGFLTNDDKIICPDCGR 1660
            G+K H WRK C+ C      H++     L +   + +   A  P   +    +  +  +G +W+P GL   +VE++ S +  N+  R    GEKLR+++L  Q+P  D  V    HL + TER+  E+F+  RN   L +G+V      A+ C +C   ++  ++AV      ++   WHP CF C  C+++LVD  YC   N+ YC RHYA+L +PRC+ CDELIF  EYT+AM ++ H  HF C  CD +LTG RYI++D+QP CI CYE  +AN C +C+  IG DSKDLS+KD+HWHE CF C  C  SLVD PF +K++ ++CS+CYD  FATRCDGC+++F+AGM+K EY+GKQWH++CF C  C+  IGTKSFIP+  D+ C PCYEEK+A +C+KC  VI  GGVTYK  PWH+ECF CT+C+  LAG +FTSK+EKPYCA CYG+LFAK+C+ CTKPITG GG KFISFEDRHWH++CF C +C  SLVGKGF+T+  +I+CP+C +
Sbjct:   42 GWKQHPWRKVCVHCKSDRSDHELPPNQALNVYNRLGIQPPAGMPQSGVAEPEVPGSVGHGYAWVPPGLSRKKVEEYMSQLPNNVVPRTNSNGEKLREKQLLLQLPRQDLSVAYCRHLTSQTERKVYEEFVNARNEIALDIGYVSSNINKAMECHKCSGILETNEMAVIAPKLGDS-TGWHPACFTCQACEQLLVDLTYCVKDNQIYCERHYAELHKPRCSACDELIFAGEYTKAMNKDWHSDHFCCWQCDQTLTGQRYIMRDEQPYCIKCYEDVFANQCDECAKPIGIDSKDLSYKDKHWHEHCFLCSMCKISLVDMPFGSKNDRIFCSNCYDQAFATRCDGCNEIFRAGMKKMEYKGKQWHDKCFCCAHCKLAIGTKSFIPKNDDVFCGPCYEEKFATRCSKCKKVITAGGVTYKNEPWHRECFCCTNCNSSLAGQRFTSKDEKPYCANCYGDLFAKRCNACTKPITGIGGAKFISFEDRHWHNDCFICAQCTTSLVGKGFITDGHEILCPECAK 556          
BLAST of Four and A half lim domains vs. Ensembl Celegans
Match: lim-9 (LIM domain family [Source:UniProtKB/TrEMBL;Acc:G5EDJ5])

HSP 1 Score: 545.814 bits (1405), Expect = 0.000e+0
Identity = 255/516 (49.42%), Postives = 347/516 (67.25%), Query Frame = 2
Query:  131 GFKIHGWRKTCLGCDCSVDRHDITDESPLPILEEMKL---ADKPYYNLFMESLKMARKYGLSWLPIGLQASEVEQFTSIVGGNIASRA---GEKLRKQKLRRQIPVHDRCVEKFSHLETPTERQEAEKFLQFRNNQDLGVGHVYRLDMAALPCTQCQSSIQAGQLAVRVEHAANTQMSWHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGGVTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGELFAKKCSKCTKPITGFGGCKFISFEDRHWHSECFTCYKCNISLVGKGFLTNDDKIICPDCGR 1660
            G+K H WRK C+ C      H++     L +   + +   A  P   +    +  +  +G +W+P GL   +VE++ S +  N+  R    GEKLR+++L  Q+P  D  V    HL + TER+  E+F+  RN   L +G+V      A+ C +C   ++  ++AV      ++   WHP CF C  C+++LVD  YC   N+ YC RHYA+L +PRC+ CDELIF  EYT+AM ++ H  HF C  CD +LTG RYI++D+QP CI CYE  +AN C +C+  IG DSKDLS+KD+HWHE CF C  C  SLVD PF +K++ ++CS+CYD  FATRCDGC+++F+AGM+K EY+GKQWH++CF C  C+  IGTKSFIP+  D+ C PCYEEK+A +C+KC  VI  GGVTYK  PWH+ECF CT+C+  LAG +FTSK+EKPYCA CYG+LFAK+C+ CTKPITG GG KFISFEDRHWH++CF C +C  SLVGKGF+T+  +I+CP+C +
Sbjct:   42 GWKQHPWRKVCVHCKSDRSDHELPPNQALNVYNRLGIQPPAGMPQSGVAEPEVPGSVGHGYAWVPPGLSRKKVEEYMSQLPNNVVPRTNSNGEKLREKQLLLQLPRQDLSVAYCRHLTSQTERKVYEEFVNARNEIALDIGYVSSNINKAMECHKCSGILETNEMAVIAPKLGDS-TGWHPACFTCQACEQLLVDLTYCVKDNQIYCERHYAELHKPRCSACDELIFAGEYTKAMNKDWHSDHFCCWQCDQTLTGQRYIMRDEQPYCIKCYEDVFANQCDECAKPIGIDSKDLSYKDKHWHEHCFLCSMCKISLVDMPFGSKNDRIFCSNCYDQAFATRCDGCNEIFRAGMKKMEYKGKQWHDKCFCCAHCKLAIGTKSFIPKNDDVFCGPCYEEKFATRCSKCKKVITAGGVTYKNEPWHRECFCCTNCNSSLAGQRFTSKDEKPYCANCYGDLFAKRCNACTKPITGIGGAKFISFEDRHWHNDCFICAQCTTSLVGKGFITDGHEILCPECAK 556          
BLAST of Four and A half lim domains vs. Ensembl Fly
Match: Lmpt (gene:FBgn0261565 transcript:FBtr0302779)

HSP 1 Score: 528.48 bits (1360), Expect = 0.000e+0
Identity = 256/526 (48.67%), Postives = 341/526 (64.83%), Query Frame = 2
Query:   95 GTPCLDCVDKCRGFKIHGWRKTCLGCDCSVDRHDITDESPLPILEEMKLADKPYYNLFMESLKMARKYGLSWLPIGLQASE-VEQFTSIVGGNIASRAGEK---LRKQKLRRQIPVHDRCVEKFSHLETPTERQEAEKFLQFRNNQDLGVGHVYRLDMAALPCTQCQSSIQAGQLAVRVEHAANTQMSWHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGGVTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGELFAKKCSKCTKPITGFGGCKFISFEDRHWHSECFTCYKCNISLVGKGFLTNDDKIICPDCGR 1660
            G  C  C   C GF  H WRKTC  C C  + H I  +    + E +        +  +E    AR  G +W+P G++AS  + ++   +   +  R G +    R++++  Q+P  D  +E   HLE   E    E F+  RN   L + ++         C  C + I AG+L V       + M WHP+CF C+ C+ +LVD  YC + +K YC RHYA++++PRCA CDELIF+ EYT+AM+++ H  HF C  CD SLTG RY+++DD P CI CYE+ +AN C++C+  IG DSKDLS+KD+HWHE CF CF+C  SLVD+ F  K + +YC +CYD +FA+RCDGC +VF+AG +K EY+ +QWHE CF C  C+  IGTKSFIPREQ+I C  CYEEK+A +C KC  VI  GGVTYK  PWH+ECFTCTHC+  LAG +FTS++EKPYCAEC+GELFAK+C+ C KPITG GG +FISFEDRHWH +CF C  C  SLVG+GF+T+   I+CPDC +
Sbjct:   37 GVRCEQCKSDCPGFAAHDWRKTCQSCKCPREAHAIYQQQTTNVHERLGFKLVSPADSGVE----ARDLGFTWVPPGVRASSRINRYFEQLPDEMVPRLGSEGACSRERQISYQLPKQDLSLEHCKHLEVQHE-ASFEDFVTARNEIALDIAYIKDAPYDE-HCAHCDNEIAAGELVVAAPKFVESVM-WHPKCFTCSTCNSLLVDLTYCVHDDKVYCERHYAEMLKPRCAGCDELIFSGEYTKAMDKDWHSGHFCCWQCDESLTGQRYVIRDDHPYCIKCYENVFANTCEECNKIIGIDSKDLSYKDKHWHEACFLCFKCHLSLVDKQFGAKADKIYCGNCYDAQFASRCDGCGEVFRAGTKKMEYKTRQWHENCFCCCVCKTAIGTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECFTCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRFISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAK 555          

HSP 2 Score: 122.094 bits (305), Expect = 6.679e-29
Identity = 70/223 (31.39%), Postives = 110/223 (49.33%), Query Frame = 2
Query:  647 WHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAME---QEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKA--GMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEK 1300
            WH  CF C +C   LVD  +   ++K YC   Y      RC  C E+      T+ ME   ++ H   F C  C  ++    +I ++ +  C GCYE ++A  C +C+  I   S  +++K+  WH +CF C  C+ +L  Q F ++D   YC++C+   FA RC  C K      G R   +  + WH +CF+C  C+  +  + FI    DI+C  C ++K
Sbjct:  339 WHEACFLCFKCHLSLVDKQFGAKADKIYCGNCYDAQFASRCDGCGEVF--RAGTKKMEYKTRQWHENCFCCCVCKTAIGTKSFIPREQEIYCAGCYEEKFATRCIKCNKVI--TSGGVTYKNEPWHRECFTCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRFISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQK 557          

HSP 3 Score: 87.4261 bits (215), Expect = 1.017e-17
Identity = 50/160 (31.25%), Postives = 74/160 (46.25%), Query Frame = 2
Query:  647 WHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGC--DSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKF 1120
            WH  CF C  C   +    +     + YC   Y +    RC  C+++I +   T   E  H    F C  C+ +L G R+  +D++P C  C+   +A  C  C   I     ++ +SF+DRHWH  CF C  C +SLV + F T   ++ C DC   K 
Sbjct:  400 WHENCFCCCVCKTAIGTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHREC-FTCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRFISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKL 558          
BLAST of Four and A half lim domains vs. Ensembl Fly
Match: Lmpt (gene:FBgn0261565 transcript:FBtr0302781)

HSP 1 Score: 528.48 bits (1360), Expect = 0.000e+0
Identity = 256/526 (48.67%), Postives = 341/526 (64.83%), Query Frame = 2
Query:   95 GTPCLDCVDKCRGFKIHGWRKTCLGCDCSVDRHDITDESPLPILEEMKLADKPYYNLFMESLKMARKYGLSWLPIGLQASE-VEQFTSIVGGNIASRAGEK---LRKQKLRRQIPVHDRCVEKFSHLETPTERQEAEKFLQFRNNQDLGVGHVYRLDMAALPCTQCQSSIQAGQLAVRVEHAANTQMSWHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGGVTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGELFAKKCSKCTKPITGFGGCKFISFEDRHWHSECFTCYKCNISLVGKGFLTNDDKIICPDCGR 1660
            G  C  C   C GF  H WRKTC  C C  + H I  +    + E +        +  +E    AR  G +W+P G++AS  + ++   +   +  R G +    R++++  Q+P  D  +E   HLE   E    E F+  RN   L + ++         C  C + I AG+L V       + M WHP+CF C+ C+ +LVD  YC + +K YC RHYA++++PRCA CDELIF+ EYT+AM+++ H  HF C  CD SLTG RY+++DD P CI CYE+ +AN C++C+  IG DSKDLS+KD+HWHE CF CF+C  SLVD+ F  K + +YC +CYD +FA+RCDGC +VF+AG +K EY+ +QWHE CF C  C+  IGTKSFIPREQ+I C  CYEEK+A +C KC  VI  GGVTYK  PWH+ECFTCTHC+  LAG +FTS++EKPYCAEC+GELFAK+C+ C KPITG GG +FISFEDRHWH +CF C  C  SLVG+GF+T+   I+CPDC +
Sbjct:   37 GVRCEQCKSDCPGFAAHDWRKTCQSCKCPREAHAIYQQQTTNVHERLGFKLVSPADSGVE----ARDLGFTWVPPGVRASSRINRYFEQLPDEMVPRLGSEGACSRERQISYQLPKQDLSLEHCKHLEVQHE-ASFEDFVTARNEIALDIAYIKDAPYDE-HCAHCDNEIAAGELVVAAPKFVESVM-WHPKCFTCSTCNSLLVDLTYCVHDDKVYCERHYAEMLKPRCAGCDELIFSGEYTKAMDKDWHSGHFCCWQCDESLTGQRYVIRDDHPYCIKCYENVFANTCEECNKIIGIDSKDLSYKDKHWHEACFLCFKCHLSLVDKQFGAKADKIYCGNCYDAQFASRCDGCGEVFRAGTKKMEYKTRQWHENCFCCCVCKTAIGTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECFTCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRFISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAK 555          

HSP 2 Score: 122.094 bits (305), Expect = 6.679e-29
Identity = 70/223 (31.39%), Postives = 110/223 (49.33%), Query Frame = 2
Query:  647 WHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAME---QEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKA--GMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEK 1300
            WH  CF C +C   LVD  +   ++K YC   Y      RC  C E+      T+ ME   ++ H   F C  C  ++    +I ++ +  C GCYE ++A  C +C+  I   S  +++K+  WH +CF C  C+ +L  Q F ++D   YC++C+   FA RC  C K      G R   +  + WH +CF+C  C+  +  + FI    DI+C  C ++K
Sbjct:  339 WHEACFLCFKCHLSLVDKQFGAKADKIYCGNCYDAQFASRCDGCGEVF--RAGTKKMEYKTRQWHENCFCCCVCKTAIGTKSFIPREQEIYCAGCYEEKFATRCIKCNKVI--TSGGVTYKNEPWHRECFTCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRFISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQK 557          

HSP 3 Score: 87.4261 bits (215), Expect = 1.017e-17
Identity = 50/160 (31.25%), Postives = 74/160 (46.25%), Query Frame = 2
Query:  647 WHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGC--DSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKF 1120
            WH  CF C  C   +    +     + YC   Y +    RC  C+++I +   T   E  H    F C  C+ +L G R+  +D++P C  C+   +A  C  C   I     ++ +SF+DRHWH  CF C  C +SLV + F T   ++ C DC   K 
Sbjct:  400 WHENCFCCCVCKTAIGTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHREC-FTCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRFISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKL 558          
BLAST of Four and A half lim domains vs. Ensembl Fly
Match: Lmpt (gene:FBgn0261565 transcript:FBtr0306704)

HSP 1 Score: 528.48 bits (1360), Expect = 0.000e+0
Identity = 256/526 (48.67%), Postives = 341/526 (64.83%), Query Frame = 2
Query:   95 GTPCLDCVDKCRGFKIHGWRKTCLGCDCSVDRHDITDESPLPILEEMKLADKPYYNLFMESLKMARKYGLSWLPIGLQASE-VEQFTSIVGGNIASRAGEK---LRKQKLRRQIPVHDRCVEKFSHLETPTERQEAEKFLQFRNNQDLGVGHVYRLDMAALPCTQCQSSIQAGQLAVRVEHAANTQMSWHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGGVTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGELFAKKCSKCTKPITGFGGCKFISFEDRHWHSECFTCYKCNISLVGKGFLTNDDKIICPDCGR 1660
            G  C  C   C GF  H WRKTC  C C  + H I  +    + E +        +  +E    AR  G +W+P G++AS  + ++   +   +  R G +    R++++  Q+P  D  +E   HLE   E    E F+  RN   L + ++         C  C + I AG+L V       + M WHP+CF C+ C+ +LVD  YC + +K YC RHYA++++PRCA CDELIF+ EYT+AM+++ H  HF C  CD SLTG RY+++DD P CI CYE+ +AN C++C+  IG DSKDLS+KD+HWHE CF CF+C  SLVD+ F  K + +YC +CYD +FA+RCDGC +VF+AG +K EY+ +QWHE CF C  C+  IGTKSFIPREQ+I C  CYEEK+A +C KC  VI  GGVTYK  PWH+ECFTCTHC+  LAG +FTS++EKPYCAEC+GELFAK+C+ C KPITG GG +FISFEDRHWH +CF C  C  SLVG+GF+T+   I+CPDC +
Sbjct:   37 GVRCEQCKSDCPGFAAHDWRKTCQSCKCPREAHAIYQQQTTNVHERLGFKLVSPADSGVE----ARDLGFTWVPPGVRASSRINRYFEQLPDEMVPRLGSEGACSRERQISYQLPKQDLSLEHCKHLEVQHE-ASFEDFVTARNEIALDIAYIKDAPYDE-HCAHCDNEIAAGELVVAAPKFVESVM-WHPKCFTCSTCNSLLVDLTYCVHDDKVYCERHYAEMLKPRCAGCDELIFSGEYTKAMDKDWHSGHFCCWQCDESLTGQRYVIRDDHPYCIKCYENVFANTCEECNKIIGIDSKDLSYKDKHWHEACFLCFKCHLSLVDKQFGAKADKIYCGNCYDAQFASRCDGCGEVFRAGTKKMEYKTRQWHENCFCCCVCKTAIGTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECFTCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRFISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAK 555          

HSP 2 Score: 122.094 bits (305), Expect = 6.679e-29
Identity = 70/223 (31.39%), Postives = 110/223 (49.33%), Query Frame = 2
Query:  647 WHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAME---QEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKA--GMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEK 1300
            WH  CF C +C   LVD  +   ++K YC   Y      RC  C E+      T+ ME   ++ H   F C  C  ++    +I ++ +  C GCYE ++A  C +C+  I   S  +++K+  WH +CF C  C+ +L  Q F ++D   YC++C+   FA RC  C K      G R   +  + WH +CF+C  C+  +  + FI    DI+C  C ++K
Sbjct:  339 WHEACFLCFKCHLSLVDKQFGAKADKIYCGNCYDAQFASRCDGCGEVF--RAGTKKMEYKTRQWHENCFCCCVCKTAIGTKSFIPREQEIYCAGCYEEKFATRCIKCNKVI--TSGGVTYKNEPWHRECFTCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRFISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQK 557          

HSP 3 Score: 87.4261 bits (215), Expect = 1.017e-17
Identity = 50/160 (31.25%), Postives = 74/160 (46.25%), Query Frame = 2
Query:  647 WHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGC--DSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKF 1120
            WH  CF C  C   +    +     + YC   Y +    RC  C+++I +   T   E  H    F C  C+ +L G R+  +D++P C  C+   +A  C  C   I     ++ +SF+DRHWH  CF C  C +SLV + F T   ++ C DC   K 
Sbjct:  400 WHENCFCCCVCKTAIGTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHREC-FTCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRFISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKL 558          
BLAST of Four and A half lim domains vs. Ensembl Fly
Match: Lmpt (gene:FBgn0261565 transcript:FBtr0332703)

HSP 1 Score: 513.457 bits (1321), Expect = 1.663e-176
Identity = 248/507 (48.92%), Postives = 333/507 (65.68%), Query Frame = 2
Query:  152 RKTCLGCDCSVDRHDITDESPLPILEEMKLADKPYYNLFMESLKMARKYGLSWLPIGLQASE-VEQFTSIVGGNIASRAGEK---LRKQKLRRQIPVHDRCVEKFSHLETPTERQEAEKFLQFRNNQDLGVGHVYRLDMAALPCTQCQSSIQAGQLAVRVEHAANTQMSWHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGGVTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGELFAKKCSKCTKPITGFGGCKFISFEDRHWHSECFTCYKCNISLVGKGFLTNDDKIICPDCGR 1660
            RKTC  C C  + H I  +    + E +        +  +E    AR  G +W+P G++AS  + ++   +   +  R G +    R++++  Q+P  D  +E   HLE   E    E F+  RN   L + ++         C  C + I AG+L V       + M WHP+CF C+ C+ +LVD  YC + +K YC RHYA++++PRCA CDELIF+ EYT+AM+++ H  HF C  CD SLTG RY+++DD P CI CYE+ +AN C++C+  IG DSKDLS+KD+HWHE CF CF+C  SLVD+ F  K + +YC +CYD +FA+RCDGC +VF+AG +K EY+ +QWHE CF C  C+  IGTKSFIPREQ+I C  CYEEK+A +C KC  VI  GGVTYK  PWH+ECFTCTHC+  LAG +FTS++EKPYCAEC+GELFAK+C+ C KPITG GG +FISFEDRHWH +CF C  C  SLVG+GF+T+   I+CPDC +
Sbjct:   26 RKTCQSCKCPREAHAIYQQQTTNVHERLGFKLVSPADSGVE----ARDLGFTWVPPGVRASSRINRYFEQLPDEMVPRLGSEGACSRERQISYQLPKQDLSLEHCKHLEVQHE-ASFEDFVTARNEIALDIAYIKDAPYDE-HCAHCDNEIAAGELVVAAPKFVESVM-WHPKCFTCSTCNSLLVDLTYCVHDDKVYCERHYAEMLKPRCAGCDELIFSGEYTKAMDKDWHSGHFCCWQCDESLTGQRYVIRDDHPYCIKCYENVFANTCEECNKIIGIDSKDLSYKDKHWHEACFLCFKCHLSLVDKQFGAKADKIYCGNCYDAQFASRCDGCGEVFRAGTKKMEYKTRQWHENCFCCCVCKTAIGTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECFTCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRFISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAK 525          

HSP 2 Score: 122.479 bits (306), Expect = 3.928e-29
Identity = 70/223 (31.39%), Postives = 110/223 (49.33%), Query Frame = 2
Query:  647 WHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAME---QEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKA--GMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEK 1300
            WH  CF C +C   LVD  +   ++K YC   Y      RC  C E+      T+ ME   ++ H   F C  C  ++    +I ++ +  C GCYE ++A  C +C+  I   S  +++K+  WH +CF C  C+ +L  Q F ++D   YC++C+   FA RC  C K      G R   +  + WH +CF+C  C+  +  + FI    DI+C  C ++K
Sbjct:  309 WHEACFLCFKCHLSLVDKQFGAKADKIYCGNCYDAQFASRCDGCGEVF--RAGTKKMEYKTRQWHENCFCCCVCKTAIGTKSFIPREQEIYCAGCYEEKFATRCIKCNKVI--TSGGVTYKNEPWHRECFTCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRFISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQK 527          

HSP 3 Score: 87.8113 bits (216), Expect = 8.139e-18
Identity = 50/160 (31.25%), Postives = 74/160 (46.25%), Query Frame = 2
Query:  647 WHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGC--DSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKF 1120
            WH  CF C  C   +    +     + YC   Y +    RC  C+++I +   T   E  H    F C  C+ +L G R+  +D++P C  C+   +A  C  C   I     ++ +SF+DRHWH  CF C  C +SLV + F T   ++ C DC   K 
Sbjct:  370 WHENCFCCCVCKTAIGTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHREC-FTCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRFISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKL 528          
BLAST of Four and A half lim domains vs. Ensembl Fly
Match: Lmpt (gene:FBgn0261565 transcript:FBtr0302780)

HSP 1 Score: 513.457 bits (1321), Expect = 4.140e-176
Identity = 248/507 (48.92%), Postives = 333/507 (65.68%), Query Frame = 2
Query:  152 RKTCLGCDCSVDRHDITDESPLPILEEMKLADKPYYNLFMESLKMARKYGLSWLPIGLQASE-VEQFTSIVGGNIASRAGEK---LRKQKLRRQIPVHDRCVEKFSHLETPTERQEAEKFLQFRNNQDLGVGHVYRLDMAALPCTQCQSSIQAGQLAVRVEHAANTQMSWHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGGVTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGELFAKKCSKCTKPITGFGGCKFISFEDRHWHSECFTCYKCNISLVGKGFLTNDDKIICPDCGR 1660
            RKTC  C C  + H I  +    + E +        +  +E    AR  G +W+P G++AS  + ++   +   +  R G +    R++++  Q+P  D  +E   HLE   E    E F+  RN   L + ++         C  C + I AG+L V       + M WHP+CF C+ C+ +LVD  YC + +K YC RHYA++++PRCA CDELIF+ EYT+AM+++ H  HF C  CD SLTG RY+++DD P CI CYE+ +AN C++C+  IG DSKDLS+KD+HWHE CF CF+C  SLVD+ F  K + +YC +CYD +FA+RCDGC +VF+AG +K EY+ +QWHE CF C  C+  IGTKSFIPREQ+I C  CYEEK+A +C KC  VI  GGVTYK  PWH+ECFTCTHC+  LAG +FTS++EKPYCAEC+GELFAK+C+ C KPITG GG +FISFEDRHWH +CF C  C  SLVG+GF+T+   I+CPDC +
Sbjct:   55 RKTCQSCKCPREAHAIYQQQTTNVHERLGFKLVSPADSGVE----ARDLGFTWVPPGVRASSRINRYFEQLPDEMVPRLGSEGACSRERQISYQLPKQDLSLEHCKHLEVQHE-ASFEDFVTARNEIALDIAYIKDAPYDE-HCAHCDNEIAAGELVVAAPKFVESVM-WHPKCFTCSTCNSLLVDLTYCVHDDKVYCERHYAEMLKPRCAGCDELIFSGEYTKAMDKDWHSGHFCCWQCDESLTGQRYVIRDDHPYCIKCYENVFANTCEECNKIIGIDSKDLSYKDKHWHEACFLCFKCHLSLVDKQFGAKADKIYCGNCYDAQFASRCDGCGEVFRAGTKKMEYKTRQWHENCFCCCVCKTAIGTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECFTCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRFISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAK 554          

HSP 2 Score: 122.479 bits (306), Expect = 5.732e-29
Identity = 70/223 (31.39%), Postives = 110/223 (49.33%), Query Frame = 2
Query:  647 WHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAME---QEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKA--GMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEK 1300
            WH  CF C +C   LVD  +   ++K YC   Y      RC  C E+      T+ ME   ++ H   F C  C  ++    +I ++ +  C GCYE ++A  C +C+  I   S  +++K+  WH +CF C  C+ +L  Q F ++D   YC++C+   FA RC  C K      G R   +  + WH +CF+C  C+  +  + FI    DI+C  C ++K
Sbjct:  338 WHEACFLCFKCHLSLVDKQFGAKADKIYCGNCYDAQFASRCDGCGEVF--RAGTKKMEYKTRQWHENCFCCCVCKTAIGTKSFIPREQEIYCAGCYEEKFATRCIKCNKVIT--SGGVTYKNEPWHRECFTCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRFISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQK 556          

HSP 3 Score: 87.4261 bits (215), Expect = 1.137e-17
Identity = 50/160 (31.25%), Postives = 74/160 (46.25%), Query Frame = 2
Query:  647 WHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGC--DSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKF 1120
            WH  CF C  C   +    +     + YC   Y +    RC  C+++I +   T   E  H    F C  C+ +L G R+  +D++P C  C+   +A  C  C   I     ++ +SF+DRHWH  CF C  C +SLV + F T   ++ C DC   K 
Sbjct:  399 WHENCFCCCVCKTAIGTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHREC-FTCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRFISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKL 557          
BLAST of Four and A half lim domains vs. Ensembl Zebrafish
Match: fhl5 (four and a half LIM domains 5 [Source:ZFIN;Acc:ZDB-GENE-040822-3])

HSP 1 Score: 338.576 bits (867), Expect = 6.930e-112
Identity = 154/273 (56.41%), Postives = 198/273 (72.53%), Query Frame = 2
Query:  842 FACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGGVTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGELFAKKCSKCTKPITGFGGCKFISFEDRHWHSECFTCYKCNISLVGKGFLTNDDKIICPDCGR 1660
            F C  C ++L G +YILK+D   C  CYE+ +AN C+ CS  IGC+ KDLS+KDRHWHE CFKC +CS SLVD+PFA KD  + C++CY ++++++C  C K    G RK EY+G  WHE CFLC  C+QPIGTKSFIP++ +  CVPC+E+++A +C  C   I  GGVTY   PWH+ECFTC  C +QLAG +FTS+E  PYC +C+  L+AKKC  CTK IT   G K+ISFE+R WHSECFTC +C++SLVG+GFLT  D I+C DCGR
Sbjct:    6 FDCHYCKDTLLGKKYILKEDTQYCTKCYENLFANCCEVCSLPIGCNCKDLSYKDRHWHENCFKCAKCSRSLVDKPFAAKDELMLCTECYSHEYSSKCSTCKKTVMPGSRKMEYKGNSWHETCFLCQRCQQPIGTKSFIPKDNNYFCVPCFEKQFAYQCCACKKAITTGGVTYHDKPWHRECFTCIGCKRQLAGQRFTSRENYPYCLDCFSNLYAKKCVGCTKAITSLAGAKYISFEERQWHSECFTCMQCSVSLVGRGFLTQRDDILCTDCGR 278          

HSP 2 Score: 148.673 bits (374), Expect = 6.375e-40
Identity = 84/273 (30.77%), Postives = 122/273 (44.69%), Query Frame = 2
Query:  662 FKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEH-HPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGG----VTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAEC 1465
            F C  C + L+   Y    +  YC + Y  L    C  C   I       + +  H H   F C  C  SL    +  KD+  LC  CY  +Y++ C  C   +   S+ + +K   WHE CF C  C   +  + F  KDNN +C  C++ +FA +C  C K    G     Y  K WH ECF C+ C++ +  + F  RE    C+ C+   YA+KC  C   I        ++++   WH ECFTC  CS  L G  F ++ +   C +C
Sbjct:    6 FDCHYCKDTLLGKKYILKEDTQYCTKCYENLFANCCEVCSLPIGCNCKDLSYKDRHWHENCFKCAKCSRSLVDKPFAAKDELMLCTECYSHEYSSKCSTCKKTVMPGSRKMEYKGNSWHETCFLCQRCQQPIGTKSFIPKDNNYFCVPCFEKQFAYQCCACKKAITTG--GVTYHDKPWHRECFTCIGCKRQLAGQRFTSRENYPYCLDCFSNLYAKKCVGCTKAITSLAGAKYISFEERQWHSECFTCMQCSVSLVGRGFLTQRDDILCTDC 276          

HSP 3 Score: 134.42 bits (337), Expect = 8.296e-35
Identity = 79/273 (28.94%), Postives = 125/273 (45.79%), Query Frame = 2
Query:  518 QDLGVGHVYRLDMAALPCTQCQSSIQAG-------QLAVRVEHAANTQMSWHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAH---FACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFK--AGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEK 1300
            +D  +G  Y L      CT+C  ++ A         +    +  +     WH  CFKC +C   LVD  +        C   Y+     +C+TC + +     +R ME + +  H   F C+ C   +    +I KD+   C+ C+E Q+A  C  C   I   +  +++ D+ WH +CF C  C   L  Q F +++N  YC DC+ N +A +C GC K     AG +   +  +QWH ECF C+ C   +  + F+ +  DI+C  C  EK
Sbjct:   12 KDTLLGKKYILKEDTQYCTKCYENLFANCCEVCSLPIGCNCKDLSYKDRHWHENCFKCAKCSRSLVDKPFAAKDELMLCTECYSHEYSSKCSTCKKTVMPG--SRKMEYKGNSWHETCFLCQRCQQPIGTKSFIPKDNNYFCVPCFEKQFAYQCCACKKAI--TTGGVTYHDKPWHRECFTCIGCKRQLAGQRFTSRENYPYCLDCFSNLYAKKCVGCTKAITSLAGAKYISFEERQWHSECFTCMQCSVSLVGRGFLTQRDDILCTDCGREK 280          
BLAST of Four and A half lim domains vs. Ensembl Zebrafish
Match: fhl2a (four and a half LIM domains 2a [Source:ZFIN;Acc:ZDB-GENE-040808-49])

HSP 1 Score: 336.65 bits (862), Expect = 4.911e-111
Identity = 148/273 (54.21%), Postives = 201/273 (73.63%), Query Frame = 2
Query:  842 FACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGGVTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGELFAKKCSKCTKPITGFGGCKFISFEDRHWHSECFTCYKCNISLVGKGFLTNDDKIICPDCGR 1660
            + C  C  SL G +Y+L++D P C+ CYES Y+N C++C   IGC+S+DLS+KDRHWHE CF CF+C  SLVD+PF+TKD  L C++CY N+++++C  C K    G RK E++G  WHE CF C  C+QPIGTKSFIP++    CVPCYE+++A +C  C   I  GGVTY   PWHK+CF CT C +QL+G +FTS+++  YC  C+  L+AKKC+ CT PI+G GG K+ISFE+R WH++CF C KC++SLVG+GFLT+ D I+CP+CG+
Sbjct:    5 YDCHYCKESLFGKKYVLREDNPYCVKCYESLYSNTCEECKKPIGCNSRDLSYKDRHWHEDCFHCFQCKRSLVDKPFSTKDEQLLCTECYSNEYSSKCHECKKTIMPGSRKMEHKGNSWHETCFTCQRCQQPIGTKSFIPKDNHNYCVPCYEKQFAMQCVHCKKPITTGGVTYHDQPWHKDCFLCTGCKQQLSGQRFTSRDDFAYCLNCFCNLYAKKCASCTSPISGLGGSKYISFEERQWHNDCFNCKKCSVSLVGRGFLTDRDDILCPECGK 277          

HSP 2 Score: 151.369 bits (381), Expect = 7.008e-41
Identity = 88/273 (32.23%), Postives = 126/273 (46.15%), Query Frame = 2
Query:  662 FKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEH-HPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGG----VTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAEC 1465
            + C  C E L    Y    + PYCV+ Y  L    C  C + I       + +  H H   F C  C  SL    +  KD+Q LC  CY ++Y++ C +C   I   S+ +  K   WHE CF C  C   +  + F  KDN+ YC  CY+ +FA +C  C K    G     Y  + WH++CFLC  C+Q +  + F  R+    C+ C+   YA+KC  C   I   G    ++++   WH +CF C  CS  L G  F +  +   C EC
Sbjct:    5 YDCHYCKESLFGKKYVLREDNPYCVKCYESLYSNTCEECKKPIGCNSRDLSYKDRHWHEDCFHCFQCKRSLVDKPFSTKDEQLLCTECYSNEYSSKCHECKKTIMPGSRKMEHKGNSWHETCFTCQRCQQPIGTKSFIPKDNHNYCVPCYEKQFAMQCVHCKKPITTG--GVTYHDQPWHKDCFLCTGCKQQLSGQRFTSRDDFAYCLNCFCNLYAKKCASCTSPISGLGGSKYISFEERQWHNDCFNCKKCSVSLVGRGFLTDRDDILCPEC 275          

HSP 3 Score: 110.153 bits (274), Expect = 2.661e-26
Identity = 64/219 (29.22%), Postives = 100/219 (45.66%), Query Frame = 2
Query:  647 WHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAH---FACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFK--AGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPC 1288
            WH  CF C +C   LVD  +     +  C   Y+     +C  C + I     +R ME + +  H   F C+ C   +    +I KD+   C+ CYE Q+A  C  C   I   +  +++ D+ WH+ CF C  C   L  Q F ++D+  YC +C+ N +A +C  C        G +   +  +QWH +CF C  C   +  + F+    DI+C  C
Sbjct:   61 WHEDCFHCFQCKRSLVDKPFSTKDEQLLCTECYSNEYSSKCHECKKTIMPG--SRKMEHKGNSWHETCFTCQRCQQPIGTKSFIPKDNHNYCVPCYEKQFAMQCVHCKKPI--TTGGVTYHDQPWHKDCFLCTGCKQQLSGQRFTSRDDFAYCLNCFCNLYAKKCASCTSPISGLGGSKYISFEERQWHNDCFNCKKCSVSLVGRGFLTDRDDILCPEC 275          

HSP 4 Score: 95.1301 bits (235), Expect = 3.463e-21
Identity = 60/181 (33.15%), Postives = 89/181 (49.17%), Query Frame = 2
Query:  569 CTQCQSSIQAGQLAVRVEHAANTQMSWHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIG--CDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDC 1105
            C +C+ +I  G  + ++EH  N   SWH  CF C  C + +    +    N  YCV  Y +    +C  C + I T   T   +Q  H   F C  C   L+G R+  +DD   C+ C+ + YA  C  C+  I     SK +SF++R WH  CF C +CS SLV + F T  +++ C +C
Sbjct:  101 CHECKKTIMPG--SRKMEHKGN---SWHETCFTCQRCQQPIGTKSFIPKDNHNYCVPCYEKQFAMQCVHCKKPITTGGVT-YHDQPWHKDCFLCTGCKQQLSGQRFTSRDDFAYCLNCFCNLYAKKCASCTSPISGLGGSKYISFEERQWHNDCFNCKKCSVSLVGRGFLTDRDDILCPEC 275          

HSP 5 Score: 49.6766 bits (117), Expect = 5.327e-6
Identity = 34/124 (27.42%), Postives = 49/124 (39.52%), Query Frame = 2
Query:  560 ALPCTQCQSSIQAGQLAVRVEHAANTQMSWHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIF---TEEYTRAMEQEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGC 922
            A+ C  C+  I  G +             WH  CF CT C + L    +    +  YC+  +  L   +CA+C   I      +Y    E++ H   F CK C  SL G  ++   D  LC  C
Sbjct:  159 AMQCVHCKKPITTGGVTYH-------DQPWHKDCFLCTGCKQQLSGQRFTSRDDFAYCLNCFCNLYAKKCASCTSPISGLGGSKYISFEERQWHNDCFNCKKCSVSLVGRGFLTDRDDILCPEC 275          
BLAST of Four and A half lim domains vs. Ensembl Zebrafish
Match: fhl2a (four and a half LIM domains 2a [Source:ZFIN;Acc:ZDB-GENE-040808-49])

HSP 1 Score: 336.65 bits (862), Expect = 4.911e-111
Identity = 148/273 (54.21%), Postives = 201/273 (73.63%), Query Frame = 2
Query:  842 FACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGGVTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGELFAKKCSKCTKPITGFGGCKFISFEDRHWHSECFTCYKCNISLVGKGFLTNDDKIICPDCGR 1660
            + C  C  SL G +Y+L++D P C+ CYES Y+N C++C   IGC+S+DLS+KDRHWHE CF CF+C  SLVD+PF+TKD  L C++CY N+++++C  C K    G RK E++G  WHE CF C  C+QPIGTKSFIP++    CVPCYE+++A +C  C   I  GGVTY   PWHK+CF CT C +QL+G +FTS+++  YC  C+  L+AKKC+ CT PI+G GG K+ISFE+R WH++CF C KC++SLVG+GFLT+ D I+CP+CG+
Sbjct:    5 YDCHYCKESLFGKKYVLREDNPYCVKCYESLYSNTCEECKKPIGCNSRDLSYKDRHWHEDCFHCFQCKRSLVDKPFSTKDEQLLCTECYSNEYSSKCHECKKTIMPGSRKMEHKGNSWHETCFTCQRCQQPIGTKSFIPKDNHNYCVPCYEKQFAMQCVHCKKPITTGGVTYHDQPWHKDCFLCTGCKQQLSGQRFTSRDDFAYCLNCFCNLYAKKCASCTSPISGLGGSKYISFEERQWHNDCFNCKKCSVSLVGRGFLTDRDDILCPECGK 277          

HSP 2 Score: 151.369 bits (381), Expect = 7.008e-41
Identity = 88/273 (32.23%), Postives = 126/273 (46.15%), Query Frame = 2
Query:  662 FKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEH-HPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGG----VTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAEC 1465
            + C  C E L    Y    + PYCV+ Y  L    C  C + I       + +  H H   F C  C  SL    +  KD+Q LC  CY ++Y++ C +C   I   S+ +  K   WHE CF C  C   +  + F  KDN+ YC  CY+ +FA +C  C K    G     Y  + WH++CFLC  C+Q +  + F  R+    C+ C+   YA+KC  C   I   G    ++++   WH +CF C  CS  L G  F +  +   C EC
Sbjct:    5 YDCHYCKESLFGKKYVLREDNPYCVKCYESLYSNTCEECKKPIGCNSRDLSYKDRHWHEDCFHCFQCKRSLVDKPFSTKDEQLLCTECYSNEYSSKCHECKKTIMPGSRKMEHKGNSWHETCFTCQRCQQPIGTKSFIPKDNHNYCVPCYEKQFAMQCVHCKKPITTG--GVTYHDQPWHKDCFLCTGCKQQLSGQRFTSRDDFAYCLNCFCNLYAKKCASCTSPISGLGGSKYISFEERQWHNDCFNCKKCSVSLVGRGFLTDRDDILCPEC 275          

HSP 3 Score: 110.153 bits (274), Expect = 2.661e-26
Identity = 64/219 (29.22%), Postives = 100/219 (45.66%), Query Frame = 2
Query:  647 WHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAH---FACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFK--AGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPC 1288
            WH  CF C +C   LVD  +     +  C   Y+     +C  C + I     +R ME + +  H   F C+ C   +    +I KD+   C+ CYE Q+A  C  C   I   +  +++ D+ WH+ CF C  C   L  Q F ++D+  YC +C+ N +A +C  C        G +   +  +QWH +CF C  C   +  + F+    DI+C  C
Sbjct:   61 WHEDCFHCFQCKRSLVDKPFSTKDEQLLCTECYSNEYSSKCHECKKTIMPG--SRKMEHKGNSWHETCFTCQRCQQPIGTKSFIPKDNHNYCVPCYEKQFAMQCVHCKKPI--TTGGVTYHDQPWHKDCFLCTGCKQQLSGQRFTSRDDFAYCLNCFCNLYAKKCASCTSPISGLGGSKYISFEERQWHNDCFNCKKCSVSLVGRGFLTDRDDILCPEC 275          

HSP 4 Score: 95.1301 bits (235), Expect = 3.463e-21
Identity = 60/181 (33.15%), Postives = 89/181 (49.17%), Query Frame = 2
Query:  569 CTQCQSSIQAGQLAVRVEHAANTQMSWHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIG--CDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDC 1105
            C +C+ +I  G  + ++EH  N   SWH  CF C  C + +    +    N  YCV  Y +    +C  C + I T   T   +Q  H   F C  C   L+G R+  +DD   C+ C+ + YA  C  C+  I     SK +SF++R WH  CF C +CS SLV + F T  +++ C +C
Sbjct:  101 CHECKKTIMPG--SRKMEHKGN---SWHETCFTCQRCQQPIGTKSFIPKDNHNYCVPCYEKQFAMQCVHCKKPITTGGVT-YHDQPWHKDCFLCTGCKQQLSGQRFTSRDDFAYCLNCFCNLYAKKCASCTSPISGLGGSKYISFEERQWHNDCFNCKKCSVSLVGRGFLTDRDDILCPEC 275          

HSP 5 Score: 49.6766 bits (117), Expect = 5.327e-6
Identity = 34/124 (27.42%), Postives = 49/124 (39.52%), Query Frame = 2
Query:  560 ALPCTQCQSSIQAGQLAVRVEHAANTQMSWHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIF---TEEYTRAMEQEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGC 922
            A+ C  C+  I  G +             WH  CF CT C + L    +    +  YC+  +  L   +CA+C   I      +Y    E++ H   F CK C  SL G  ++   D  LC  C
Sbjct:  159 AMQCVHCKKPITTGGVTYH-------DQPWHKDCFLCTGCKQQLSGQRFTSRDDFAYCLNCFCNLYAKKCASCTSPISGLGGSKYISFEERQWHNDCFNCKKCSVSLVGRGFLTDRDDILCPEC 275          
BLAST of Four and A half lim domains vs. Ensembl Zebrafish
Match: fhl2a (four and a half LIM domains 2a [Source:ZFIN;Acc:ZDB-GENE-040808-49])

HSP 1 Score: 336.65 bits (862), Expect = 4.911e-111
Identity = 148/273 (54.21%), Postives = 201/273 (73.63%), Query Frame = 2
Query:  842 FACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGGVTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGELFAKKCSKCTKPITGFGGCKFISFEDRHWHSECFTCYKCNISLVGKGFLTNDDKIICPDCGR 1660
            + C  C  SL G +Y+L++D P C+ CYES Y+N C++C   IGC+S+DLS+KDRHWHE CF CF+C  SLVD+PF+TKD  L C++CY N+++++C  C K    G RK E++G  WHE CF C  C+QPIGTKSFIP++    CVPCYE+++A +C  C   I  GGVTY   PWHK+CF CT C +QL+G +FTS+++  YC  C+  L+AKKC+ CT PI+G GG K+ISFE+R WH++CF C KC++SLVG+GFLT+ D I+CP+CG+
Sbjct:    5 YDCHYCKESLFGKKYVLREDNPYCVKCYESLYSNTCEECKKPIGCNSRDLSYKDRHWHEDCFHCFQCKRSLVDKPFSTKDEQLLCTECYSNEYSSKCHECKKTIMPGSRKMEHKGNSWHETCFTCQRCQQPIGTKSFIPKDNHNYCVPCYEKQFAMQCVHCKKPITTGGVTYHDQPWHKDCFLCTGCKQQLSGQRFTSRDDFAYCLNCFCNLYAKKCASCTSPISGLGGSKYISFEERQWHNDCFNCKKCSVSLVGRGFLTDRDDILCPECGK 277          

HSP 2 Score: 151.369 bits (381), Expect = 7.008e-41
Identity = 88/273 (32.23%), Postives = 126/273 (46.15%), Query Frame = 2
Query:  662 FKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEH-HPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGG----VTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAEC 1465
            + C  C E L    Y    + PYCV+ Y  L    C  C + I       + +  H H   F C  C  SL    +  KD+Q LC  CY ++Y++ C +C   I   S+ +  K   WHE CF C  C   +  + F  KDN+ YC  CY+ +FA +C  C K    G     Y  + WH++CFLC  C+Q +  + F  R+    C+ C+   YA+KC  C   I   G    ++++   WH +CF C  CS  L G  F +  +   C EC
Sbjct:    5 YDCHYCKESLFGKKYVLREDNPYCVKCYESLYSNTCEECKKPIGCNSRDLSYKDRHWHEDCFHCFQCKRSLVDKPFSTKDEQLLCTECYSNEYSSKCHECKKTIMPGSRKMEHKGNSWHETCFTCQRCQQPIGTKSFIPKDNHNYCVPCYEKQFAMQCVHCKKPITTG--GVTYHDQPWHKDCFLCTGCKQQLSGQRFTSRDDFAYCLNCFCNLYAKKCASCTSPISGLGGSKYISFEERQWHNDCFNCKKCSVSLVGRGFLTDRDDILCPEC 275          

HSP 3 Score: 110.153 bits (274), Expect = 2.661e-26
Identity = 64/219 (29.22%), Postives = 100/219 (45.66%), Query Frame = 2
Query:  647 WHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAH---FACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFK--AGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPC 1288
            WH  CF C +C   LVD  +     +  C   Y+     +C  C + I     +R ME + +  H   F C+ C   +    +I KD+   C+ CYE Q+A  C  C   I   +  +++ D+ WH+ CF C  C   L  Q F ++D+  YC +C+ N +A +C  C        G +   +  +QWH +CF C  C   +  + F+    DI+C  C
Sbjct:   61 WHEDCFHCFQCKRSLVDKPFSTKDEQLLCTECYSNEYSSKCHECKKTIMPG--SRKMEHKGNSWHETCFTCQRCQQPIGTKSFIPKDNHNYCVPCYEKQFAMQCVHCKKPI--TTGGVTYHDQPWHKDCFLCTGCKQQLSGQRFTSRDDFAYCLNCFCNLYAKKCASCTSPISGLGGSKYISFEERQWHNDCFNCKKCSVSLVGRGFLTDRDDILCPEC 275          

HSP 4 Score: 95.1301 bits (235), Expect = 3.463e-21
Identity = 60/181 (33.15%), Postives = 89/181 (49.17%), Query Frame = 2
Query:  569 CTQCQSSIQAGQLAVRVEHAANTQMSWHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIG--CDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDC 1105
            C +C+ +I  G  + ++EH  N   SWH  CF C  C + +    +    N  YCV  Y +    +C  C + I T   T   +Q  H   F C  C   L+G R+  +DD   C+ C+ + YA  C  C+  I     SK +SF++R WH  CF C +CS SLV + F T  +++ C +C
Sbjct:  101 CHECKKTIMPG--SRKMEHKGN---SWHETCFTCQRCQQPIGTKSFIPKDNHNYCVPCYEKQFAMQCVHCKKPITTGGVT-YHDQPWHKDCFLCTGCKQQLSGQRFTSRDDFAYCLNCFCNLYAKKCASCTSPISGLGGSKYISFEERQWHNDCFNCKKCSVSLVGRGFLTDRDDILCPEC 275          

HSP 5 Score: 49.6766 bits (117), Expect = 5.327e-6
Identity = 34/124 (27.42%), Postives = 49/124 (39.52%), Query Frame = 2
Query:  560 ALPCTQCQSSIQAGQLAVRVEHAANTQMSWHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIF---TEEYTRAMEQEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGC 922
            A+ C  C+  I  G +             WH  CF CT C + L    +    +  YC+  +  L   +CA+C   I      +Y    E++ H   F CK C  SL G  ++   D  LC  C
Sbjct:  159 AMQCVHCKKPITTGGVTYH-------DQPWHKDCFLCTGCKQQLSGQRFTSRDDFAYCLNCFCNLYAKKCASCTSPISGLGGSKYISFEERQWHNDCFNCKKCSVSLVGRGFLTDRDDILCPEC 275          
BLAST of Four and A half lim domains vs. Ensembl Zebrafish
Match: fhl2b (four and a half LIM domains 2b [Source:ZFIN;Acc:ZDB-GENE-041010-121])

HSP 1 Score: 336.265 bits (861), Expect = 5.710e-111
Identity = 148/273 (54.21%), Postives = 202/273 (73.99%), Query Frame = 2
Query:  842 FACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGGVTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGELFAKKCSKCTKPITGFGGCKFISFEDRHWHSECFTCYKCNISLVGKGFLTNDDKIICPDCGR 1660
            + C  C  SL G +Y+L+D+ P C+ CYES Y+N C++C   IGC+S+DLS+KDRHWH+ CF CF+C  SLVD+PF+TKD  L C++CY N+++++C  C K    G RK E++G  WHE CF C  C+QPIGTKSFIP++    CVPCYE+++A +C +C   I  GGVTY   PWHK+CF CT C +QL+G +FTS+++ PYC  C+  L+AKKC+ CT PI+G GG K+ISFE+R WH++CF C KC++SLVG+GFLT  D I+CP+CG+
Sbjct:    5 YDCHYCKESLFGKKYVLRDENPYCVKCYESLYSNTCEECKKPIGCNSRDLSYKDRHWHDDCFHCFKCHRSLVDKPFSTKDEQLLCTECYSNEYSSKCFECKKTIMPGSRKMEHKGNSWHETCFTCQRCQQPIGTKSFIPKDNSNYCVPCYEKQFALQCVQCKKPITTGGVTYHDQPWHKDCFLCTGCKQQLSGQRFTSRDDFPYCLNCFCNLYAKKCAACTTPISGLGGSKYISFEERQWHNDCFNCKKCSVSLVGRGFLTERDDILCPECGK 277          

HSP 2 Score: 149.058 bits (375), Expect = 5.737e-40
Identity = 88/273 (32.23%), Postives = 126/273 (46.15%), Query Frame = 2
Query:  662 FKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEH-HPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGG----VTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAEC 1465
            + C  C E L    Y      PYCV+ Y  L    C  C + I       + +  H H   F C  C  SL    +  KD+Q LC  CY ++Y++ C +C   I   S+ +  K   WHE CF C  C   +  + F  KDN+ YC  CY+ +FA +C  C K    G     Y  + WH++CFLC  C+Q +  + F  R+    C+ C+   YA+KC  C   I   G    ++++   WH +CF C  CS  L G  F ++ +   C EC
Sbjct:    5 YDCHYCKESLFGKKYVLRDENPYCVKCYESLYSNTCEECKKPIGCNSRDLSYKDRHWHDDCFHCFKCHRSLVDKPFSTKDEQLLCTECYSNEYSSKCFECKKTIMPGSRKMEHKGNSWHETCFTCQRCQQPIGTKSFIPKDNSNYCVPCYEKQFALQCVQCKKPITTG--GVTYHDQPWHKDCFLCTGCKQQLSGQRFTSRDDFPYCLNCFCNLYAKKCAACTTPISGLGGSKYISFEERQWHNDCFNCKKCSVSLVGRGFLTERDDILCPEC 275          

HSP 3 Score: 110.923 bits (276), Expect = 1.486e-26
Identity = 65/219 (29.68%), Postives = 101/219 (46.12%), Query Frame = 2
Query:  647 WHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAH---FACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFK--AGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPC 1288
            WH  CF C +C   LVD  +     +  C   Y+     +C  C + I     +R ME + +  H   F C+ C   +    +I KD+   C+ CYE Q+A  C QC   I   +  +++ D+ WH+ CF C  C   L  Q F ++D+  YC +C+ N +A +C  C        G +   +  +QWH +CF C  C   +  + F+    DI+C  C
Sbjct:   61 WHDDCFHCFKCHRSLVDKPFSTKDEQLLCTECYSNEYSSKCFECKKTIMPG--SRKMEHKGNSWHETCFTCQRCQQPIGTKSFIPKDNSNYCVPCYEKQFALQCVQCKKPI--TTGGVTYHDQPWHKDCFLCTGCKQQLSGQRFTSRDDFPYCLNCFCNLYAKKCAACTTPISGLGGSKYISFEERQWHNDCFNCKKCSVSLVGRGFLTERDDILCPEC 275          

HSP 4 Score: 98.5969 bits (244), Expect = 1.934e-22
Identity = 61/181 (33.70%), Postives = 91/181 (50.28%), Query Frame = 2
Query:  569 CTQCQSSIQAGQLAVRVEHAANTQMSWHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIG--CDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDC 1105
            C +C+ +I  G  + ++EH  N   SWH  CF C  C + +    +    N  YCV  Y +    +C  C + I T   T   +Q  H   F C  C   L+G R+  +DD P C+ C+ + YA  C  C+  I     SK +SF++R WH  CF C +CS SLV + F T+ +++ C +C
Sbjct:  101 CFECKKTIMPG--SRKMEHKGN---SWHETCFTCQRCQQPIGTKSFIPKDNSNYCVPCYEKQFALQCVQCKKPITTGGVT-YHDQPWHKDCFLCTGCKQQLSGQRFTSRDDFPYCLNCFCNLYAKKCAACTTPISGLGGSKYISFEERQWHNDCFNCKKCSVSLVGRGFLTERDDILCPEC 275          

HSP 5 Score: 55.0694 bits (131), Expect = 8.789e-8
Identity = 37/124 (29.84%), Postives = 51/124 (41.13%), Query Frame = 2
Query:  560 ALPCTQCQSSIQAGQLAVRVEHAANTQMSWHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIF---TEEYTRAMEQEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGC 922
            AL C QC+  I  G +             WH  CF CT C + L    +    + PYC+  +  L   +CA C   I      +Y    E++ H   F CK C  SL G  ++ + D  LC  C
Sbjct:  159 ALQCVQCKKPITTGGVTYH-------DQPWHKDCFLCTGCKQQLSGQRFTSRDDFPYCLNCFCNLYAKKCAACTTPISGLGGSKYISFEERQWHNDCFNCKKCSVSLVGRGFLTERDDILCPEC 275          
BLAST of Four and A half lim domains vs. Ensembl Xenopus
Match: fhl2 (four and a half LIM domains 2 [Source:NCBI gene;Acc:100145283])

HSP 1 Score: 340.887 bits (873), Expect = 1.272e-112
Identity = 153/273 (56.04%), Postives = 198/273 (72.53%), Query Frame = 2
Query:  842 FACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGGVTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGELFAKKCSKCTKPITGFGGCKFISFEDRHWHSECFTCYKCNISLVGKGFLTNDDKIICPDCGR 1660
            F C  C  SL G +Y+L+++ P C+ CYES Y+N C++C   IGCD KDLS+KDRHWHE CF CF+C  SLVD+PFA KD +L C++CY N+++++C  C K    G RK EY+G  WHE CF+C  C+QPIGTKSFIP++    CV CYE+++A  C +C   I  GGVTY+  PWHKECF CT C K L+G +FTS++E  YC  C+  L+AKKC+ CT PI+G GG K+ISFE+R WHS+CF C KC ISLVG+GFLT  D I+CP+CG+
Sbjct:    5 FDCHYCKESLFGKKYLLREENPYCVKCYESLYSNSCEECKKPIGCDGKDLSYKDRHWHESCFHCFQCKKSLVDKPFAAKDEHLICTECYSNEYSSKCSECKKTIMPGTRKMEYKGNSWHETCFICSRCQQPIGTKSFIPKDNQNFCVACYEKQFAMHCVQCKKAITTGGVTYRDQPWHKECFICTGCKKPLSGQRFTSRDEFAYCLNCFCNLYAKKCAGCTNPISGLGGAKYISFEERQWHSDCFNCKKCAISLVGRGFLTERDDILCPECGK 277          

HSP 2 Score: 154.451 bits (389), Expect = 9.258e-42
Identity = 85/273 (31.14%), Postives = 129/273 (47.25%), Query Frame = 2
Query:  662 FKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEH-HPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGG----VTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAEC 1465
            F C  C E L    Y      PYCV+ Y  L    C  C + I  +    + +  H H + F C  C  SL    +  KD+  +C  CY ++Y++ C +C   I   ++ + +K   WHE CF C  C   +  + F  KDN  +C  CY+ +FA  C  C K    G     YR + WH+ECF+C  C++P+  + F  R++   C+ C+   YA+KC  C   I   G    ++++   WH +CF C  C+  L G  F ++ +   C EC
Sbjct:    5 FDCHYCKESLFGKKYLLREENPYCVKCYESLYSNSCEECKKPIGCDGKDLSYKDRHWHESCFHCFQCKKSLVDKPFAAKDEHLICTECYSNEYSSKCSECKKTIMPGTRKMEYKGNSWHETCFICSRCQQPIGTKSFIPKDNQNFCVACYEKQFAMHCVQCKKAITTG--GVTYRDQPWHKECFICTGCKKPLSGQRFTSRDEFAYCLNCFCNLYAKKCAGCTNPISGLGGAKYISFEERQWHSDCFNCKKCAISLVGRGFLTERDDILCPEC 275          

HSP 3 Score: 120.939 bits (302), Expect = 6.790e-30
Identity = 68/219 (31.05%), Postives = 104/219 (47.49%), Query Frame = 2
Query:  647 WHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAH---FACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFK--AGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPC 1288
            WH  CF C +C + LVD  +        C   Y+     +C+ C + I     TR ME + +  H   F C  C   +    +I KD+Q  C+ CYE Q+A  C QC   I   +  ++++D+ WH++CF C  C   L  Q F ++D   YC +C+ N +A +C GC        G +   +  +QWH +CF C  C   +  + F+    DI+C  C
Sbjct:   61 WHESCFHCFQCKKSLVDKPFAAKDEHLICTECYSNEYSSKCSECKKTIMPG--TRKMEYKGNSWHETCFICSRCQQPIGTKSFIPKDNQNFCVACYEKQFAMHCVQCKKAI--TTGGVTYRDQPWHKECFICTGCKKPLSGQRFTSRDEFAYCLNCFCNLYAKKCAGCTNPISGLGGAKYISFEERQWHSDCFNCKKCAISLVGRGFLTERDDILCPEC 275          

HSP 4 Score: 95.1301 bits (235), Expect = 4.663e-21
Identity = 53/167 (31.74%), Postives = 83/167 (49.70%), Query Frame = 2
Query: 1208 FLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGG--VTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGELFAKKCSKCTKPITGFGGCKFISFEDRHWHSECFTCYKCNISLVGKGFLTNDDKIICPDCGR*MVIFHYIRLQQLI 1702
            F C  C++ +  K ++ RE++  CV CYE  Y+  C +C   I   G  ++YK   WH+ CF C  C K L    F +K+E   C ECY   ++ KCS+C K I    G + + ++   WH  CF C +C   +  K F+  D++  C  C       H ++ ++ I
Sbjct:    5 FDCHYCKESLFGKKYLLREENPYCVKCYESLYSNSCEECKKPIGCDGKDLSYKDRHWHESCFHCFQCKKSLVDKPFAAKDEHLICTECYSNEYSSKCSECKKTI--MPGTRKMEYKGNSWHETCFICSRCQQPIGTKSFIPKDNQNFCVACYEKQFAMHCVQCKKAI 169          

HSP 5 Score: 91.6633 bits (226), Expect = 6.935e-20
Identity = 55/181 (30.39%), Postives = 91/181 (50.28%), Query Frame = 2
Query:  569 CTQCQSSIQAGQLAVRVEHAANTQMSWHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIG--CDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDC 1105
            C++C+ +I  G    ++E+  N   SWH  CF C+ C + +    +    N+ +CV  Y +     C  C + I T   T   +Q  H   F C  C   L+G R+  +D+   C+ C+ + YA  C  C+  I     +K +SF++R WH  CF C +C+ SLV + F T+ +++ C +C
Sbjct:  101 CSECKKTIMPG--TRKMEYKGN---SWHETCFICSRCQQPIGTKSFIPKDNQNFCVACYEKQFAMHCVQCKKAITTGGVT-YRDQPWHKECFICTGCKKPLSGQRFTSRDEFAYCLNCFCNLYAKKCAGCTNPISGLGGAKYISFEERQWHSDCFNCKKCAISLVGRGFLTERDDILCPEC 275          

HSP 6 Score: 53.5286 bits (127), Expect = 4.072e-7
Identity = 39/141 (27.66%), Postives = 58/141 (41.13%), Query Frame = 2
Query:  509 RNNQDLGVGHVYRLDMAALPCTQCQSSIQAGQLAVRVEHAANTQMSWHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIF---TEEYTRAMEQEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGC 922
            ++NQ+  V    +    A+ C QC+ +I  G +  R          WH  CF CT C + L    +       YC+  +  L   +CA C   I      +Y    E++ H   F CK C  SL G  ++ + D  LC  C
Sbjct:  144 KDNQNFCVACYEK--QFAMHCVQCKKAITTGGVTYR-------DQPWHKECFICTGCKKPLSGQRFTSRDEFAYCLNCFCNLYAKKCAGCTNPISGLGGAKYISFEERQWHSDCFNCKKCAISLVGRGFLTERDDILCPEC 275          
BLAST of Four and A half lim domains vs. Ensembl Xenopus
Match: shroom3 (shroom family member 3 [Source:Xenbase;Acc:XB-GENE-490224])

HSP 1 Score: 325.865 bits (834), Expect = 8.510e-107
Identity = 147/272 (54.04%), Postives = 194/272 (71.32%), Query Frame = 2
Query:  842 FACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGGVTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGELFAKKCSKCTKPITGFGGCKFISFEDRHWHSECFTCYKCNISLVGKGFLTNDDKIICPDCG 1657
            F C SC  SL G +YI  ++ P CI CY+S +AN C +C   IG D ++L ++DRH+HE CF+CF C  SL D+PF  +D  L C+DCY N+F+++C  C K    G RK EY G+ WHE CF+C  C+QPIG++SFIP  Q+  C+PCYE K A +CT C   + +GGVTY+  PWHKECF CT C  QLAG +FTS++EKPYC +C+G L+AKKC+ CTKPITGFGG K++SFE+RHWH  CF C +C+ SLVGKGF+ +++ I+C  C 
Sbjct:    5 FDCDSCKESLYGRKYIQMEEGPYCIPCYDSLFANTCDECKELIGHDCRELYYEDRHYHEHCFRCFRCDHSLADEPFTCQDEELLCNDCYCNEFSSKCISCEKTVMPGSRKLEYNGQTWHEHCFICNSCQQPIGSRSFIPENQNHYCIPCYESKLAPRCTHCKKSLTKGGVTYRDEPWHKECFVCTGCKTQLAGQQFTSQDEKPYCIKCFGNLYAKKCAGCTKPITGFGGAKYVSFEERHWHHSCFNCSRCSTSLVGKGFIPDNEDILCRACN 276          

HSP 2 Score: 150.984 bits (380), Expect = 1.374e-40
Identity = 88/277 (31.77%), Postives = 128/277 (46.21%), Query Frame = 2
Query:  662 FKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAH-FACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGG----VTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGEL 1477
            F C  C E L    Y      PYC+  Y  L    C  C ELI  +      E  H+  H F C  CD+SL    +  +D++ LC  CY +++++ C  C   +   S+ L +  + WHE CF C  C   +  + F  ++ N YC  CY++K A RC  C K    G     YR + WH+ECF+C  C+  +  + F  +++   C+ C+   YA+KC  C   I   G    V+++   WH  CF C+ CS  L G  F    E   C  C  +L
Sbjct:    5 FDCDSCKESLYGRKYIQMEEGPYCIPCYDSLFANTCDECKELIGHDCRELYYEDRHYHEHCFRCFRCDHSLADEPFTCQDEELLCNDCYCNEFSSKCISCEKTVMPGSRKLEYNGQTWHEHCFICNSCQQPIGSRSFIPENQNHYCIPCYESKLAPRCTHCKKSLTKG--GVTYRDEPWHKECFVCTGCKTQLAGQQFTSQDEKPYCIKCFGNLYAKKCAGCTKPITGFGGAKYVSFEERHWHHSCFNCSRCSTSLVGKGFIPDNEDILCRACNSDL 279          

HSP 3 Score: 112.849 bits (281), Expect = 3.540e-27
Identity = 65/219 (29.68%), Postives = 100/219 (45.66%), Query Frame = 2
Query:  647 WHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAME---QEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFK--AGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPC 1288
            +H  CF+C  CD  L D  +     +  C   Y      +C +C++ +     +R +E   Q  H   F C SC   +    +I ++    CI CYES+ A  C  C   +      ++++D  WH++CF C  C + L  Q F ++D   YC  C+ N +A +C GC K      G +   +  + WH  CF C  C   +  K FIP  +DI+C  C
Sbjct:   61 YHEHCFRCFRCDHSLADEPFTCQDEELLCNDCYCNEFSSKCISCEKTVMPG--SRKLEYNGQTWHEHCFICNSCQQPIGSRSFIPENQNHYCIPCYESKLAPRCTHCKKSL--TKGGVTYRDEPWHKECFVCTGCKTQLAGQQFTSQDEKPYCIKCFGNLYAKKCAGCTKPITGFGGAKYVSFEERHWHHSCFNCSRCSTSLVGKGFIPDNEDILCRAC 275          

HSP 4 Score: 91.6633 bits (226), Expect = 8.375e-20
Identity = 53/181 (29.28%), Postives = 88/181 (48.62%), Query Frame = 2
Query:  569 CTQCQSSIQAGQLAVRVEHAANTQMSWHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIG--CDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDC 1105
            C  C+ ++  G  + ++E+   T   WH  CF C  C + +    +   +   YC+  Y   + PRC  C + + T+      ++  H   F C  C   L G ++  +D++P CI C+ + YA  C  C+  I     +K +SF++RHWH  CF C  CS+SLV + F   + ++ C  C
Sbjct:  101 CISCEKTVMPG--SRKLEYNGQT---WHEHCFICNSCQQPIGSRSFIPENQNHYCIPCYESKLAPRCTHCKKSL-TKGGVTYRDEPWHKECFVCTGCKTQLAGQQFTSQDEKPYCIKCFGNLYAKKCAGCTKPITGFGGAKYVSFEERHWHHSCFNCSRCSTSLVGKGFIPDNEDILCRAC 275          
BLAST of Four and A half lim domains vs. Ensembl Xenopus
Match: fhl5 (four and a half LIM domains 5 [Source:NCBI gene;Acc:100144736])

HSP 1 Score: 322.783 bits (826), Expect = 1.543e-105
Identity = 145/272 (53.31%), Postives = 191/272 (70.22%), Query Frame = 2
Query:  842 FACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGGVTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGELFAKKCSKCTKPITGFGGCKFISFEDRHWHSECFTCYKCNISLVGKGFLTNDDKIICPDCG 1657
            F C  C  SL G +Y LKDD P CI C+ S +AN+C++C   I C+SKDL++KD HWHE CFKC +C  SLV++PFA KD  L C +CY  +++++C GC      G RK EY G  WHE CF+C  CR+P+G K FIP+E  I C+PCYE+++A +C  C   I +GG++++   WH+ECF CT C K L G K TS++E PYC +C+  L+AKKC+ C KPITG GG K+ISFEDR WHS+CFTC KC+ SLVG+ F TN+D ++CP CG
Sbjct:    6 FDCFHCKESLYGKKYTLKDDIPYCIKCFNSLFANLCERCKKPIECNSKDLAYKDSHWHETCFKCDKCDHSLVEKPFAAKDELLLCIECYSTEYSSKCFGCRATIMPGSRKMEYNGSNWHETCFVCQSCREPVGNKPFIPKESKIYCMPCYEKQFANQCKSCRKAITKGGLSFQEQQWHRECFVCTSCKKNLVGEKSTSRDESPYCVDCFDNLYAKKCAACAKPITGQGGAKYISFEDRQWHSDCFTCAKCSKSLVGEKFHTNEDDVLCPSCG 277          

HSP 2 Score: 165.622 bits (418), Expect = 8.495e-46
Identity = 89/273 (32.60%), Postives = 135/273 (49.45%), Query Frame = 2
Query:  662 FKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEH-HPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGG----VTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAEC 1465
            F C  C E L    Y    + PYC++ +  L    C  C + I       A +  H H   F C  CD+SL    +  KD+  LCI CY ++Y++ C  C   I   S+ + +   +WHE CF C  C   + ++PF  K++ +YC  CY+ +FA +C  C K    G     ++ +QWH ECF+C  C++ +  +    R++   CV C++  YA+KC  C   I   G    ++++   WH +CFTC  CSK L G KF + E+   C  C
Sbjct:    6 FDCFHCKESLYGKKYTLKDDIPYCIKCFNSLFANLCERCKKPIECNSKDLAYKDSHWHETCFKCDKCDHSLVEKPFAAKDELLLCIECYSTEYSSKCFGCRATIMPGSRKMEYNGSNWHETCFVCQSCREPVGNKPFIPKESKIYCMPCYEKQFANQCKSCRKAITKG--GLSFQEQQWHRECFVCTSCKKNLVGEKSTSRDESPYCVDCFDNLYAKKCAACAKPITGQGGAKYISFEDRQWHSDCFTCAKCSKSLVGEKFHTNEDDVLCPSC 276          

HSP 3 Score: 128.257 bits (321), Expect = 1.999e-32
Identity = 77/252 (30.56%), Postives = 120/252 (47.62%), Query Frame = 2
Query:  554 MAALPCTQCQSSIQ--AGQLAVRVEHAANTQMSWHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAME---QEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVF--KAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPC 1288
            + A  C +C+  I+  +  LA +  H       WH  CFKC +CD  LV+  +        C+  Y+     +C  C   I     +R ME      H   F C+SC   +    +I K+ +  C+ CYE Q+AN C+ C   I      LSF+++ WH +CF C  C  +LV +   ++D + YC DC+DN +A +C  C K    + G +   +  +QWH +CF C  C + +  + F   E D++C  C
Sbjct:   36 LFANLCERCKKPIECNSKDLAYKDSH-------WHETCFKCDKCDHSLVEKPFAAKDELLLCIECYSTEYSSKCFGCRATIMPG--SRKMEYNGSNWHETCFVCQSCREPVGNKPFIPKESKIYCMPCYEKQFANQCKSCRKAI--TKGGLSFQEQQWHRECFVCTSCKKNLVGEKSTSRDESPYCVDCFDNLYAKKCAACAKPITGQGGAKYISFEDRQWHSDCFTCAKCSKSLVGEKFHTNEDDVLCPSC 276          
BLAST of Four and A half lim domains vs. Ensembl Xenopus
Match: fhl1 (four and a half LIM domains 1 [Source:NCBI gene;Acc:448334])

HSP 1 Score: 266.929 bits (681), Expect = 8.232e-84
Identity = 122/276 (44.20%), Postives = 173/276 (62.68%), Query Frame = 2
Query:  842 FACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGGVTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGELFAKKCSKCTKPITGFG-GCKFISFEDRHWHSECFTCYKCNISLVGKGFLTNDDKIICPDCGR*M 1666
            F C  C   L G +YI KD    C+ C++   AN C +C   IG DSK+L +K+R+WH+ CF+C +C   L ++ F  KDN + C+ C   + + RC GCHK  + G R  EY+G  WHEECF C +C+Q IG+ SF P+  D+ CV C+E+K+A+ C KC   I  GG+TY+  PWH +CF C  C K+LAG +FT+ E+  YC +CY    AKKC+ C  PITGFG G   +++E   WH  CFTC KC+++L  K F+ +++++ C DC + M
Sbjct:   21 FDCHYCRAPLQGKKYIEKDGHNTCVKCFDKICANTCAECRKPIGVDSKELHYKNRYWHDNCFRCAKCYHPLANEQFIAKDNKIMCAKCTTREDSLRCSGCHKQIQPGGRNVEYKGSAWHEECFTCSNCKQAIGSGSFFPKGTDVYCVTCHEQKFAKNCVKCNNPITSGGITYQDQPWHGDCFVCETCHKKLAGQRFTAVEDHYYCVDCYKSFVAKKCAGCNNPITGFGKGSNVVNYEGNSWHEYCFTCKKCSLNLANKRFVRHNEQVYCQDCAKKM 296          

HSP 2 Score: 107.071 bits (266), Expect = 4.869e-25
Identity = 63/220 (28.64%), Postives = 99/220 (45.00%), Query Frame = 2
Query:  647 WHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAH---FACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKV---FKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPC 1288
            WH  CF+C +C   L +  +    NK  C +   +    RC+ C + I  +   R +E +    H   F C +C  ++    +  K     C+ C+E ++A  C +C+  I   S  ++++D+ WH  CF C  C   L  Q F   +++ YC DCY +  A +C GC+     F  G     Y G  WHE CF C  C   +  K F+   + + C  C
Sbjct:   77 WHDNCFRCAKCYHPLANEQFIAKDNKIMCAKCTTREDSLRCSGCHKQI--QPGGRNVEYKGSAWHEECFTCSNCKQAIGSGSFFPKGTDVYCVTCHEQKFAKNCVKCNNPI--TSGGITYQDQPWHGDCFVCETCHKKLAGQRFTAVEDHYYCVDCYKSFVAKKCAGCNNPITGFGKGSNVVNYEGNSWHEYCFTCKKCSLNLANKRFVRHNEQVYCQDC 292          
BLAST of Four and A half lim domains vs. Ensembl Xenopus
Match: fhl1 (four and a half LIM domains 1 [Source:NCBI gene;Acc:448334])

HSP 1 Score: 266.544 bits (680), Expect = 1.049e-83
Identity = 122/276 (44.20%), Postives = 173/276 (62.68%), Query Frame = 2
Query:  842 FACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGGVTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGELFAKKCSKCTKPITGFG-GCKFISFEDRHWHSECFTCYKCNISLVGKGFLTNDDKIICPDCGR*M 1666
            F C  C   L G +YI KD    C+ C++   AN C +C   IG DSK+L +K+R+WH+ CF+C +C   L ++ F  KDN + C+ C   + + RC GCHK  + G R  EY+G  WHEECF C +C+Q IG+ SF P+  D+ CV C+E+K+A+ C KC   I  GG+TY+  PWH +CF C  C K+LAG +FT+ E+  YC +CY    AKKC+ C  PITGFG G   +++E   WH  CFTC KC+++L  K F+ +++++ C DC + M
Sbjct:   16 FDCHYCRAPLQGKKYIEKDGHNTCVKCFDKICANTCAECRKPIGVDSKELHYKNRYWHDNCFRCAKCYHPLANEQFIAKDNKIMCAKCTTREDSLRCSGCHKQIQPGGRNVEYKGSAWHEECFTCSNCKQAIGSGSFFPKGTDVYCVTCHEQKFAKNCVKCNNPITSGGITYQDQPWHGDCFVCETCHKKLAGQRFTAVEDHYYCVDCYKSFVAKKCAGCNNPITGFGKGSNVVNYEGNSWHEYCFTCKKCSLNLANKRFVRHNEQVYCQDCAKKM 291          

HSP 2 Score: 130.954 bits (328), Expect = 2.295e-33
Identity = 80/278 (28.78%), Postives = 127/278 (45.68%), Query Frame = 2
Query:  662 FKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEH-HPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGG-----VTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGEL 1477
            F C  C   L    Y        CV+ + ++    CA C + I  +      +  + H   F C  C + L   ++I KD++ +C  C   + +  C  C  +I    +++ +K   WHE+CF C  C  ++    F  K  ++YC  C++ KFA  C  C+    +G     Y+ + WH +CF+C  C + +  + F   E    CV CY+   A+KC  C   I   G     V Y+G+ WH+ CFTC  CS  LA  +F    E+ YC +C  ++
Sbjct:   16 FDCHYCRAPLQGKKYIEKDGHNTCVKCFDKICANTCAECRKPIGVDSKELHYKNRYWHDNCFRCAKCYHPLANEQFIAKDNKIMCAKCTTREDSLRCSGCHKQIQPGGRNVEYKGSAWHEECFTCSNCKQAIGSGSFFPKGTDVYCVTCHEQKFAKNCVKCNNPITSG--GITYQDQPWHGDCFVCETCHKKLAGQRFTAVEDHYYCVDCYKSFVAKKCAGCNNPITGFGKGSNVVNYEGNSWHEYCFTCKKCSLNLANKRFVRHNEQVYCQDCAKKM 291          

HSP 3 Score: 107.071 bits (266), Expect = 4.674e-25
Identity = 63/220 (28.64%), Postives = 99/220 (45.00%), Query Frame = 2
Query:  647 WHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAH---FACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKV---FKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPC 1288
            WH  CF+C +C   L +  +    NK  C +   +    RC+ C + I  +   R +E +    H   F C +C  ++    +  K     C+ C+E ++A  C +C+  I   S  ++++D+ WH  CF C  C   L  Q F   +++ YC DCY +  A +C GC+     F  G     Y G  WHE CF C  C   +  K F+   + + C  C
Sbjct:   72 WHDNCFRCAKCYHPLANEQFIAKDNKIMCAKCTTREDSLRCSGCHKQI--QPGGRNVEYKGSAWHEECFTCSNCKQAIGSGSFFPKGTDVYCVTCHEQKFAKNCVKCNNPI--TSGGITYQDQPWHGDCFVCETCHKKLAGQRFTAVEDHYYCVDCYKSFVAKKCAGCNNPITGFGKGSNVVNYEGNSWHEYCFTCKKCSLNLANKRFVRHNEQVYCQDC 287          
BLAST of Four and A half lim domains vs. Ensembl Mouse
Match: Fhl2 (four and a half LIM domains 2 [Source:MGI Symbol;Acc:MGI:1338762])

HSP 1 Score: 348.591 bits (893), Expect = 1.026e-115
Identity = 157/273 (57.51%), Postives = 201/273 (73.63%), Query Frame = 2
Query:  842 FACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGGVTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGELFAKKCSKCTKPITGFGGCKFISFEDRHWHSECFTCYKCNISLVGKGFLTNDDKIICPDCGR 1660
            F C  C+ SL G +YILK++ P C+ C+E  YAN C++C   IGCD KDLS+KDRHWHE CF C  C SSLVD+PFA K+  L C+DCY N+++++C  C K    G RK EY+G  WHE CF C  C+QPIGTKSFIP+E    CVPCYE++YA +C +C   I  GGVTY+  PWHKECF CT C KQL+G +FT+++E PYC  C+ +L+AKKC+ CT PI+G GG K+ISFE+R WH++CF C KC++SLVG+GFLT  D I+CPDCG+
Sbjct:    5 FDCHHCNESLYGKKYILKEENPHCVACFEELYANTCEECGTPIGCDCKDLSYKDRHWHEGCFHCSRCGSSLVDKPFAAKEEQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGSSWHETCFTCQRCQQPIGTKSFIPKENQNFCVPCYEKQYALQCVQCKKPITTGGVTYREQPWHKECFVCTACKKQLSGQRFTARDEFPYCLTCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDCGK 277          

HSP 2 Score: 147.517 bits (371), Expect = 2.233e-39
Identity = 82/273 (30.04%), Postives = 132/273 (48.35%), Query Frame = 2
Query:  662 FKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEH-HPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGG----VTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAEC 1465
            F C  C+E L    Y      P+CV  + +L    C  C   I  +    + +  H H   F C  C +SL    +  K++Q LC  CY ++Y++ CQ+C   I   ++ + +K   WHE CF C  C   +  + F  K+N  +C  CY+ ++A +C  C K    G     YR + WH+ECF+C  C++ +  + F  R++   C+ C+ + YA+KC  C   I   G    ++++   WH +CF C  CS  L G  F ++ +   C +C
Sbjct:    5 FDCHHCNESLYGKKYILKEENPHCVACFEELYANTCEECGTPIGCDCKDLSYKDRHWHEGCFHCSRCGSSLVDKPFAAKEEQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGSSWHETCFTCQRCQQPIGTKSFIPKENQNFCVPCYEKQYALQCVQCKKPITTG--GVTYREQPWHKECFVCTACKKQLSGQRFTARDEFPYCLTCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDC 275          

HSP 3 Score: 114.39 bits (285), Expect = 7.641e-28
Identity = 66/219 (30.14%), Postives = 101/219 (46.12%), Query Frame = 2
Query:  647 WHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAH---FACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFK--AGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPC 1288
            WH  CF C+ C   LVD  +     +  C   Y+     +C  C + I     TR ME +    H   F C+ C   +    +I K++Q  C+ CYE QYA  C QC   I   +  ++++++ WH++CF C  C   L  Q F  +D   YC  C+ + +A +C GC        G +   +  +QWH +CF C  C   +  + F+    DI+C  C
Sbjct:   61 WHEGCFHCSRCGSSLVDKPFAAKEEQLLCTDCYSNEYSSKCQECKKTIMPG--TRKMEYKGSSWHETCFTCQRCQQPIGTKSFIPKENQNFCVPCYEKQYALQCVQCKKPI--TTGGVTYREQPWHKECFVCTACKKQLSGQRFTARDEFPYCLTCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDC 275          

HSP 4 Score: 95.1301 bits (235), Expect = 3.703e-21
Identity = 57/181 (31.49%), Postives = 89/181 (49.17%), Query Frame = 2
Query:  569 CTQCQSSIQAGQLAVRVEHAANTQMSWHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIG--CDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDC 1105
            C +C+ +I  G   +  + +     SWH  CF C  C + +    +    N+ +CV  Y +    +C  C + I T   T   EQ  H   F C +C   L+G R+  +D+ P C+ C+   YA  C  C+  I     +K +SF++R WH  CF C +CS SLV + F T+ +++ C DC
Sbjct:  101 CQECKKTIMPGTRKMEYKGS-----SWHETCFTCQRCQQPIGTKSFIPKENQNFCVPCYEKQYALQCVQCKKPITTGGVT-YREQPWHKECFVCTACKKQLSGQRFTARDEFPYCLTCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDC 275          

HSP 5 Score: 57.3806 bits (137), Expect = 1.747e-8
Identity = 38/124 (30.65%), Postives = 52/124 (41.94%), Query Frame = 2
Query:  560 ALPCTQCQSSIQAGQLAVRVEHAANTQMSWHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIF---TEEYTRAMEQEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGC 922
            AL C QC+  I  G +  R       +  WH  CF CT C + L    +      PYC+  +  L   +CA C   I      +Y    E++ H   F CK C  SL G  ++ + D  LC  C
Sbjct:  159 ALQCVQCKKPITTGGVTYR-------EQPWHKECFVCTACKKQLSGQRFTARDEFPYCLTCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDC 275          
BLAST of Four and A half lim domains vs. Ensembl Mouse
Match: Fhl2 (four and a half LIM domains 2 [Source:MGI Symbol;Acc:MGI:1338762])

HSP 1 Score: 348.591 bits (893), Expect = 1.026e-115
Identity = 157/273 (57.51%), Postives = 201/273 (73.63%), Query Frame = 2
Query:  842 FACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGGVTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGELFAKKCSKCTKPITGFGGCKFISFEDRHWHSECFTCYKCNISLVGKGFLTNDDKIICPDCGR 1660
            F C  C+ SL G +YILK++ P C+ C+E  YAN C++C   IGCD KDLS+KDRHWHE CF C  C SSLVD+PFA K+  L C+DCY N+++++C  C K    G RK EY+G  WHE CF C  C+QPIGTKSFIP+E    CVPCYE++YA +C +C   I  GGVTY+  PWHKECF CT C KQL+G +FT+++E PYC  C+ +L+AKKC+ CT PI+G GG K+ISFE+R WH++CF C KC++SLVG+GFLT  D I+CPDCG+
Sbjct:    5 FDCHHCNESLYGKKYILKEENPHCVACFEELYANTCEECGTPIGCDCKDLSYKDRHWHEGCFHCSRCGSSLVDKPFAAKEEQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGSSWHETCFTCQRCQQPIGTKSFIPKENQNFCVPCYEKQYALQCVQCKKPITTGGVTYREQPWHKECFVCTACKKQLSGQRFTARDEFPYCLTCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDCGK 277          

HSP 2 Score: 147.517 bits (371), Expect = 2.233e-39
Identity = 82/273 (30.04%), Postives = 132/273 (48.35%), Query Frame = 2
Query:  662 FKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEH-HPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGG----VTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAEC 1465
            F C  C+E L    Y      P+CV  + +L    C  C   I  +    + +  H H   F C  C +SL    +  K++Q LC  CY ++Y++ CQ+C   I   ++ + +K   WHE CF C  C   +  + F  K+N  +C  CY+ ++A +C  C K    G     YR + WH+ECF+C  C++ +  + F  R++   C+ C+ + YA+KC  C   I   G    ++++   WH +CF C  CS  L G  F ++ +   C +C
Sbjct:    5 FDCHHCNESLYGKKYILKEENPHCVACFEELYANTCEECGTPIGCDCKDLSYKDRHWHEGCFHCSRCGSSLVDKPFAAKEEQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGSSWHETCFTCQRCQQPIGTKSFIPKENQNFCVPCYEKQYALQCVQCKKPITTG--GVTYREQPWHKECFVCTACKKQLSGQRFTARDEFPYCLTCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDC 275          

HSP 3 Score: 114.39 bits (285), Expect = 7.641e-28
Identity = 66/219 (30.14%), Postives = 101/219 (46.12%), Query Frame = 2
Query:  647 WHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAH---FACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFK--AGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPC 1288
            WH  CF C+ C   LVD  +     +  C   Y+     +C  C + I     TR ME +    H   F C+ C   +    +I K++Q  C+ CYE QYA  C QC   I   +  ++++++ WH++CF C  C   L  Q F  +D   YC  C+ + +A +C GC        G +   +  +QWH +CF C  C   +  + F+    DI+C  C
Sbjct:   61 WHEGCFHCSRCGSSLVDKPFAAKEEQLLCTDCYSNEYSSKCQECKKTIMPG--TRKMEYKGSSWHETCFTCQRCQQPIGTKSFIPKENQNFCVPCYEKQYALQCVQCKKPI--TTGGVTYREQPWHKECFVCTACKKQLSGQRFTARDEFPYCLTCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDC 275          

HSP 4 Score: 95.1301 bits (235), Expect = 3.703e-21
Identity = 57/181 (31.49%), Postives = 89/181 (49.17%), Query Frame = 2
Query:  569 CTQCQSSIQAGQLAVRVEHAANTQMSWHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIG--CDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDC 1105
            C +C+ +I  G   +  + +     SWH  CF C  C + +    +    N+ +CV  Y +    +C  C + I T   T   EQ  H   F C +C   L+G R+  +D+ P C+ C+   YA  C  C+  I     +K +SF++R WH  CF C +CS SLV + F T+ +++ C DC
Sbjct:  101 CQECKKTIMPGTRKMEYKGS-----SWHETCFTCQRCQQPIGTKSFIPKENQNFCVPCYEKQYALQCVQCKKPITTGGVT-YREQPWHKECFVCTACKKQLSGQRFTARDEFPYCLTCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDC 275          

HSP 5 Score: 57.3806 bits (137), Expect = 1.747e-8
Identity = 38/124 (30.65%), Postives = 52/124 (41.94%), Query Frame = 2
Query:  560 ALPCTQCQSSIQAGQLAVRVEHAANTQMSWHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIF---TEEYTRAMEQEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGC 922
            AL C QC+  I  G +  R       +  WH  CF CT C + L    +      PYC+  +  L   +CA C   I      +Y    E++ H   F CK C  SL G  ++ + D  LC  C
Sbjct:  159 ALQCVQCKKPITTGGVTYR-------EQPWHKECFVCTACKKQLSGQRFTARDEFPYCLTCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDC 275          
BLAST of Four and A half lim domains vs. Ensembl Mouse
Match: Fhl3 (four and a half LIM domains 3 [Source:MGI Symbol;Acc:MGI:1341092])

HSP 1 Score: 307.76 bits (787), Expect = 6.761e-100
Identity = 134/273 (49.08%), Postives = 187/273 (68.50%), Query Frame = 2
Query:  842 FACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGGVTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGELFAKKCSKCTKPITGFGGCKFISFEDRHWHSECFTCYKCNISLVGKGFLTNDDKIICPDCGR 1660
            F C  C+ SL G +YI  D  P C+ CY++ +AN C +C   IG DS++L ++DRH+HE CF+C  C  SL D+PF  +D+ L C++CY   F+++C  C +    G RK EY G+ WHE CFLC  C QP+G++SF+P +    CVPCYE K+A +C +C   + +GGVTY+  PWH+EC  CT C   LAG +FTS+++ PYC  C+GELFA KCS C +PITG GG K++SFEDRHWH  CF+C +C+ SLVG+GF+ + D+++C  C +
Sbjct:    5 FDCAKCNESLYGRKYIQTDSGPYCVPCYDNTFANTCAECQQLIGHDSRELFYEDRHFHEGCFRCCRCQRSLADEPFTCQDSELLCNECYCTAFSSQCSACGETVMPGSRKLEYGGQTWHEHCFLCSGCEQPLGSRSFVPDKGAHYCVPCYENKFAPRCARCSKTLTQGGVTYRDQPWHRECLVCTGCKTPLAGQQFTSRDDDPYCVACFGELFAPKCSSCKRPITGLGGGKYVSFEDRHWHHSCFSCARCSTSLVGQGFVPDGDQVLCQGCSQ 277          

HSP 2 Score: 154.836 bits (390), Expect = 5.226e-42
Identity = 90/273 (32.97%), Postives = 123/273 (45.05%), Query Frame = 2
Query:  662 FKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEH-HPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGG----VTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAEC 1465
            F C +C+E L    Y    + PYCV  Y       CA C +LI  +      E  H H   F C  C  SL    +  +D + LC  CY + +++ C  C   +   S+ L +  + WHE CF C  C   L  + F       YC  CY+NKFA RC  C K    G     YR + WH EC +C  C+ P+  + F  R+ D  CV C+ E +A KC+ C   I   G    V+++   WH  CF+C  CS  L G  F    ++  C  C
Sbjct:    5 FDCAKCNESLYGRKYIQTDSGPYCVPCYDNTFANTCAECQQLIGHDSRELFYEDRHFHEGCFRCCRCQRSLADEPFTCQDSELLCNECYCTAFSSQCSACGETVMPGSRKLEYGGQTWHEHCFLCSGCEQPLGSRSFVPDKGAHYCVPCYENKFAPRCARCSKTLTQG--GVTYRDQPWHRECLVCTGCKTPLAGQQFTSRDDDPYCVACFGELFAPKCSSCKRPITGLGGGKYVSFEDRHWHHSCFSCARCSTSLVGQGFVPDGDQVLCQGC 275          

HSP 3 Score: 97.4413 bits (241), Expect = 5.639e-22
Identity = 58/183 (31.69%), Postives = 85/183 (46.45%), Query Frame = 2
Query:  569 CTQCQSSIQAGQLAVRVEHAANTQMSWHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQC----SGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDC 1105
            C+ C  ++  G  + ++E+   T   WH  CF C+ C++ L    +       YCV  Y     PRCA C + + T+      +Q  H     C  C   L G ++  +DD P C+ C+   +A  C  C    +G  G   K +SF+DRHWH  CF C  CS+SLV Q F    + + C  C
Sbjct:  101 CSACGETVMPG--SRKLEYGGQT---WHEHCFLCSGCEQPLGSRSFVPDKGAHYCVPCYENKFAPRCARCSKTL-TQGGVTYRDQPWHRECLVCTGCKTPLAGQQFTSRDDDPYCVACFGELFAPKCSSCKRPITGLGG--GKYVSFEDRHWHHSCFSCARCSTSLVGQGFVPDGDQVLCQGC 275          

HSP 4 Score: 59.6918 bits (143), Expect = 2.816e-9
Identity = 34/124 (27.42%), Postives = 54/124 (43.55%), Query Frame = 2
Query:  569 CTQCQSSIQAGQLAVRVEHAANTQMSWHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIF---TEEYTRAMEQEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGCYES 931
            C +C  ++  G +  R          WH  C  CT C   L    +    + PYCV  + +L  P+C++C   I      +Y    ++  H + F+C  C  SL G  ++   DQ LC GC ++
Sbjct:  162 CARCSKTLTQGGVTYR-------DQPWHRECLVCTGCKTPLAGQQFTSRDDDPYCVACFGELFAPKCSSCKRPITGLGGGKYVSFEDRHWHHSCFSCARCSTSLVGQGFVPDGDQVLCQGCSQA 278          
BLAST of Four and A half lim domains vs. Ensembl Mouse
Match: Fhl5 (four and a half LIM domains 5 [Source:MGI Symbol;Acc:MGI:1913192])

HSP 1 Score: 304.294 bits (778), Expect = 1.790e-98
Identity = 141/274 (51.46%), Postives = 190/274 (69.34%), Query Frame = 2
Query:  836 AHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGGVTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGELFAKKCSKCTKPITGFGGCKFISFEDRHWHSECFTCYKCNISLVGKGFLTNDDKIICPDCG 1657
            + F C+ C +SL G +Y+LKDD   CI CY+  ++N C+QC   I  DSKDL +K+RHWHE CF+C +C  SLV++PF  KD+ L C+DCY N+ +++C  C +    G RK E++G  WHE CF+C  CRQPIGTK  I +E    CVPC+E+++A  C  C  VI  GG+T++   WHKECF C+ C K+L    F SK++ P+C +CY  L+AKKC+ CTKPITG  G KFI F+DR WHSECF C KC++SLVG+GFLT++ +I+C  CG
Sbjct:    4 SQFDCQYCTSSLIGKKYVLKDDNLYCISCYDRIFSNYCEQCKEPIESDSKDLCYKNRHWHEGCFRCNKCHHSLVEKPFVAKDDRLLCTDCYSNECSSKCFHCKRTIMPGSRKMEFKGNYWHETCFVCEHCRQPIGTKPLISKESGNYCVPCFEKEFAHYCNFCKKVITSGGITFRDQIWHKECFLCSGCRKELYEEAFMSKDDFPFCLDCYNHLYAKKCAACTKPITGLRGAKFICFQDRQWHSECFNCGKCSVSLVGEGFLTHNMEILCRKCG 277          

HSP 2 Score: 150.214 bits (378), Expect = 2.356e-40
Identity = 86/273 (31.50%), Postives = 133/273 (48.72%), Query Frame = 2
Query:  662 FKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEH-HPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIR--RGG--VTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAEC 1465
            F C  C   L+   Y    +  YC+  Y ++    C  C E I ++      +  H H   F C  C +SL    ++ KDD+ LC  CY ++ ++ C  C   I   S+ + FK  +WHE CF C  C   +  +P  +K++  YC  C++ +FA  C+ C KV  +G     +R + WH+ECFLC  CR+ +  ++F+ ++    C+ CY   YA+KC  C   I   RG   + ++   WH ECF C  CS  L G  F +   +  C +C
Sbjct:    6 FDCQYCTSSLIGKKYVLKDDNLYCISCYDRIFSNYCEQCKEPIESDSKDLCYKNRHWHEGCFRCNKCHHSLVEKPFVAKDDRLLCTDCYSNECSSKCFHCKRTIMPGSRKMEFKGNYWHETCFVCEHCRQPIGTKPLISKESGNYCVPCFEKEFAHYCNFCKKVITSG--GITFRDQIWHKECFLCSGCRKELYEEAFMSKDDFPFCLDCYNHLYAKKCAACTKPITGLRGAKFICFQDRQWHSECFNCGKCSVSLVGEGFLTHNMEILCRKC 276          

HSP 3 Score: 107.457 bits (267), Expect = 2.497e-25
Identity = 69/247 (27.94%), Postives = 116/247 (46.96%), Query Frame = 2
Query:  569 CTQCQSSIQAGQ--LAVRVEHAANTQMSWHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAH---FACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKA--GMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPC 1288
            C QC+  I++    L  +  H       WH  CF+C +C   LV+  +    ++  C   Y+     +C  C   I     +R ME + +  H   F C+ C   +     I K+    C+ C+E ++A+ C  C   I   S  ++F+D+ WH++CF C  C   L ++ F +KD+  +C DCY++ +A +C  C K      G +   ++ +QWH ECF C  C   +  + F+    +I+C  C
Sbjct:   41 CEQCKEPIESDSKDLCYKNRH-------WHEGCFRCNKCHHSLVEKPFVAKDDRLLCTDCYSNECSSKCFHCKRTIMPG--SRKMEFKGNYWHETCFVCEHCRQPIGTKPLISKESGNYCVPCFEKEFAHYCNFCKKVI--TSGGITFRDQIWHKECFLCSGCRKELYEEAFMSKDDFPFCLDCYNHLYAKKCAACTKPITGLRGAKFICFQDRQWHSECFNCGKCSVSLVGEGFLTHNMEILCRKC 276          
BLAST of Four and A half lim domains vs. Ensembl Mouse
Match: Fhl5 (four and a half LIM domains 5 [Source:MGI Symbol;Acc:MGI:1913192])

HSP 1 Score: 304.294 bits (778), Expect = 1.790e-98
Identity = 141/274 (51.46%), Postives = 190/274 (69.34%), Query Frame = 2
Query:  836 AHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGGVTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGELFAKKCSKCTKPITGFGGCKFISFEDRHWHSECFTCYKCNISLVGKGFLTNDDKIICPDCG 1657
            + F C+ C +SL G +Y+LKDD   CI CY+  ++N C+QC   I  DSKDL +K+RHWHE CF+C +C  SLV++PF  KD+ L C+DCY N+ +++C  C +    G RK E++G  WHE CF+C  CRQPIGTK  I +E    CVPC+E+++A  C  C  VI  GG+T++   WHKECF C+ C K+L    F SK++ P+C +CY  L+AKKC+ CTKPITG  G KFI F+DR WHSECF C KC++SLVG+GFLT++ +I+C  CG
Sbjct:    4 SQFDCQYCTSSLIGKKYVLKDDNLYCISCYDRIFSNYCEQCKEPIESDSKDLCYKNRHWHEGCFRCNKCHHSLVEKPFVAKDDRLLCTDCYSNECSSKCFHCKRTIMPGSRKMEFKGNYWHETCFVCEHCRQPIGTKPLISKESGNYCVPCFEKEFAHYCNFCKKVITSGGITFRDQIWHKECFLCSGCRKELYEEAFMSKDDFPFCLDCYNHLYAKKCAACTKPITGLRGAKFICFQDRQWHSECFNCGKCSVSLVGEGFLTHNMEILCRKCG 277          

HSP 2 Score: 150.214 bits (378), Expect = 2.356e-40
Identity = 86/273 (31.50%), Postives = 133/273 (48.72%), Query Frame = 2
Query:  662 FKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEH-HPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIR--RGG--VTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAEC 1465
            F C  C   L+   Y    +  YC+  Y ++    C  C E I ++      +  H H   F C  C +SL    ++ KDD+ LC  CY ++ ++ C  C   I   S+ + FK  +WHE CF C  C   +  +P  +K++  YC  C++ +FA  C+ C KV  +G     +R + WH+ECFLC  CR+ +  ++F+ ++    C+ CY   YA+KC  C   I   RG   + ++   WH ECF C  CS  L G  F +   +  C +C
Sbjct:    6 FDCQYCTSSLIGKKYVLKDDNLYCISCYDRIFSNYCEQCKEPIESDSKDLCYKNRHWHEGCFRCNKCHHSLVEKPFVAKDDRLLCTDCYSNECSSKCFHCKRTIMPGSRKMEFKGNYWHETCFVCEHCRQPIGTKPLISKESGNYCVPCFEKEFAHYCNFCKKVITSG--GITFRDQIWHKECFLCSGCRKELYEEAFMSKDDFPFCLDCYNHLYAKKCAACTKPITGLRGAKFICFQDRQWHSECFNCGKCSVSLVGEGFLTHNMEILCRKC 276          

HSP 3 Score: 107.457 bits (267), Expect = 2.497e-25
Identity = 69/247 (27.94%), Postives = 116/247 (46.96%), Query Frame = 2
Query:  569 CTQCQSSIQAGQ--LAVRVEHAANTQMSWHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAH---FACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKA--GMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPC 1288
            C QC+  I++    L  +  H       WH  CF+C +C   LV+  +    ++  C   Y+     +C  C   I     +R ME + +  H   F C+ C   +     I K+    C+ C+E ++A+ C  C   I   S  ++F+D+ WH++CF C  C   L ++ F +KD+  +C DCY++ +A +C  C K      G +   ++ +QWH ECF C  C   +  + F+    +I+C  C
Sbjct:   41 CEQCKEPIESDSKDLCYKNRH-------WHEGCFRCNKCHHSLVEKPFVAKDDRLLCTDCYSNECSSKCFHCKRTIMPG--SRKMEFKGNYWHETCFVCEHCRQPIGTKPLISKESGNYCVPCFEKEFAHYCNFCKKVI--TSGGITFRDQIWHKECFLCSGCRKELYEEAFMSKDDFPFCLDCYNHLYAKKCAACTKPITGLRGAKFICFQDRQWHSECFNCGKCSVSLVGEGFLTHNMEILCRKC 276          
BLAST of Four and A half lim domains vs. UniProt/SwissProt
Match: sp|O70433|FHL2_MOUSE (Four and a half LIM domains protein 2 OS=Mus musculus OX=10090 GN=Fhl2 PE=1 SV=1)

HSP 1 Score: 348.591 bits (893), Expect = 7.176e-115
Identity = 157/273 (57.51%), Postives = 201/273 (73.63%), Query Frame = 2
Query:  842 FACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGGVTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGELFAKKCSKCTKPITGFGGCKFISFEDRHWHSECFTCYKCNISLVGKGFLTNDDKIICPDCGR 1660
            F C  C+ SL G +YILK++ P C+ C+E  YAN C++C   IGCD KDLS+KDRHWHE CF C  C SSLVD+PFA K+  L C+DCY N+++++C  C K    G RK EY+G  WHE CF C  C+QPIGTKSFIP+E    CVPCYE++YA +C +C   I  GGVTY+  PWHKECF CT C KQL+G +FT+++E PYC  C+ +L+AKKC+ CT PI+G GG K+ISFE+R WH++CF C KC++SLVG+GFLT  D I+CPDCG+
Sbjct:    5 FDCHHCNESLYGKKYILKEENPHCVACFEELYANTCEECGTPIGCDCKDLSYKDRHWHEGCFHCSRCGSSLVDKPFAAKEEQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGSSWHETCFTCQRCQQPIGTKSFIPKENQNFCVPCYEKQYALQCVQCKKPITTGGVTYREQPWHKECFVCTACKKQLSGQRFTARDEFPYCLTCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDCGK 277          

HSP 2 Score: 147.517 bits (371), Expect = 1.562e-38
Identity = 82/273 (30.04%), Postives = 132/273 (48.35%), Query Frame = 2
Query:  662 FKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEH-HPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGG----VTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAEC 1465
            F C  C+E L    Y      P+CV  + +L    C  C   I  +    + +  H H   F C  C +SL    +  K++Q LC  CY ++Y++ CQ+C   I   ++ + +K   WHE CF C  C   +  + F  K+N  +C  CY+ ++A +C  C K    G     YR + WH+ECF+C  C++ +  + F  R++   C+ C+ + YA+KC  C   I   G    ++++   WH +CF C  CS  L G  F ++ +   C +C
Sbjct:    5 FDCHHCNESLYGKKYILKEENPHCVACFEELYANTCEECGTPIGCDCKDLSYKDRHWHEGCFHCSRCGSSLVDKPFAAKEEQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGSSWHETCFTCQRCQQPIGTKSFIPKENQNFCVPCYEKQYALQCVQCKKPITTG--GVTYREQPWHKECFVCTACKKQLSGQRFTARDEFPYCLTCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDC 275          

HSP 3 Score: 114.39 bits (285), Expect = 5.345e-27
Identity = 66/219 (30.14%), Postives = 101/219 (46.12%), Query Frame = 2
Query:  647 WHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAH---FACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFK--AGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPC 1288
            WH  CF C+ C   LVD  +     +  C   Y+     +C  C + I     TR ME +    H   F C+ C   +    +I K++Q  C+ CYE QYA  C QC   I   +  ++++++ WH++CF C  C   L  Q F  +D   YC  C+ + +A +C GC        G +   +  +QWH +CF C  C   +  + F+    DI+C  C
Sbjct:   61 WHEGCFHCSRCGSSLVDKPFAAKEEQLLCTDCYSNEYSSKCQECKKTIMPG--TRKMEYKGSSWHETCFTCQRCQQPIGTKSFIPKENQNFCVPCYEKQYALQCVQCKKPI--TTGGVTYREQPWHKECFVCTACKKQLSGQRFTARDEFPYCLTCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDC 275          

HSP 4 Score: 95.1301 bits (235), Expect = 2.590e-20
Identity = 57/181 (31.49%), Postives = 89/181 (49.17%), Query Frame = 2
Query:  569 CTQCQSSIQAGQLAVRVEHAANTQMSWHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIG--CDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDC 1105
            C +C+ +I  G   +  + +     SWH  CF C  C + +    +    N+ +CV  Y +    +C  C + I T   T   EQ  H   F C +C   L+G R+  +D+ P C+ C+   YA  C  C+  I     +K +SF++R WH  CF C +CS SLV + F T+ +++ C DC
Sbjct:  101 CQECKKTIMPGTRKMEYKGS-----SWHETCFTCQRCQQPIGTKSFIPKENQNFCVPCYEKQYALQCVQCKKPITTGGVT-YREQPWHKECFVCTACKKQLSGQRFTARDEFPYCLTCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDC 275          

HSP 5 Score: 57.3806 bits (137), Expect = 1.222e-7
Identity = 38/124 (30.65%), Postives = 52/124 (41.94%), Query Frame = 2
Query:  560 ALPCTQCQSSIQAGQLAVRVEHAANTQMSWHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIF---TEEYTRAMEQEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGC 922
            AL C QC+  I  G +  R       +  WH  CF CT C + L    +      PYC+  +  L   +CA C   I      +Y    E++ H   F CK C  SL G  ++ + D  LC  C
Sbjct:  159 ALQCVQCKKPITTGGVTYR-------EQPWHKECFVCTACKKQLSGQRFTARDEFPYCLTCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDC 275          
BLAST of Four and A half lim domains vs. UniProt/SwissProt
Match: sp|O35115|FHL2_RAT (Four and a half LIM domains protein 2 OS=Rattus norvegicus OX=10116 GN=Fhl2 PE=1 SV=1)

HSP 1 Score: 347.821 bits (891), Expect = 1.682e-114
Identity = 156/273 (57.14%), Postives = 201/273 (73.63%), Query Frame = 2
Query:  842 FACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGGVTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGELFAKKCSKCTKPITGFGGCKFISFEDRHWHSECFTCYKCNISLVGKGFLTNDDKIICPDCGR 1660
            F C  C+ SL G +YILK++ P C+ C+E  YAN C++C   IGCD KDLS+KDRHWHE CF C  C SSLVD+PFA K+  L C+DCY N+++++C  C K    G RK EY+G  WHE CF C  C+QPIGTKSFIP+E    CVPCYE++YA +C +C   I  GGVTY+  PWH+ECF CT C KQL+G +FT+++E PYC  C+ +L+AKKC+ CT PI+G GG K+ISFE+R WH++CF C KC++SLVG+GFLT  D I+CPDCG+
Sbjct:    5 FDCHHCNESLYGKKYILKEENPHCVACFEELYANTCEECGTPIGCDCKDLSYKDRHWHEGCFHCSRCGSSLVDKPFAAKEEQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGSSWHETCFTCQRCQQPIGTKSFIPKENQNFCVPCYEKQYALQCVQCKKPITTGGVTYRDQPWHRECFVCTACKKQLSGQRFTARDEFPYCLTCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDCGK 277          

HSP 2 Score: 147.132 bits (370), Expect = 1.777e-38
Identity = 82/273 (30.04%), Postives = 131/273 (47.99%), Query Frame = 2
Query:  662 FKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEH-HPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGG----VTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAEC 1465
            F C  C+E L    Y      P+CV  + +L    C  C   I  +    + +  H H   F C  C +SL    +  K++Q LC  CY ++Y++ CQ+C   I   ++ + +K   WHE CF C  C   +  + F  K+N  +C  CY+ ++A +C  C K    G     YR + WH ECF+C  C++ +  + F  R++   C+ C+ + YA+KC  C   I   G    ++++   WH +CF C  CS  L G  F ++ +   C +C
Sbjct:    5 FDCHHCNESLYGKKYILKEENPHCVACFEELYANTCEECGTPIGCDCKDLSYKDRHWHEGCFHCSRCGSSLVDKPFAAKEEQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGSSWHETCFTCQRCQQPIGTKSFIPKENQNFCVPCYEKQYALQCVQCKKPITTG--GVTYRDQPWHRECFVCTACKKQLSGQRFTARDEFPYCLTCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDC 275          

HSP 3 Score: 115.546 bits (288), Expect = 2.342e-27
Identity = 67/219 (30.59%), Postives = 100/219 (45.66%), Query Frame = 2
Query:  647 WHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAH---FACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFK--AGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPC 1288
            WH  CF C+ C   LVD  +     +  C   Y+     +C  C + I     TR ME +    H   F C+ C   +    +I K++Q  C+ CYE QYA  C QC   I   +  ++++D+ WH +CF C  C   L  Q F  +D   YC  C+ + +A +C GC        G +   +  +QWH +CF C  C   +  + F+    DI+C  C
Sbjct:   61 WHEGCFHCSRCGSSLVDKPFAAKEEQLLCTDCYSNEYSSKCQECKKTIMPG--TRKMEYKGSSWHETCFTCQRCQQPIGTKSFIPKENQNFCVPCYEKQYALQCVQCKKPI--TTGGVTYRDQPWHRECFVCTACKKQLSGQRFTARDEFPYCLTCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDC 275          

HSP 4 Score: 93.2041 bits (230), Expect = 1.119e-19
Identity = 56/181 (30.94%), Postives = 89/181 (49.17%), Query Frame = 2
Query:  569 CTQCQSSIQAGQLAVRVEHAANTQMSWHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIG--CDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDC 1105
            C +C+ +I  G   +  + +     SWH  CF C  C + +    +    N+ +CV  Y +    +C  C + I T   T   +Q  H   F C +C   L+G R+  +D+ P C+ C+   YA  C  C+  I     +K +SF++R WH  CF C +CS SLV + F T+ +++ C DC
Sbjct:  101 CQECKKTIMPGTRKMEYKGS-----SWHETCFTCQRCQQPIGTKSFIPKENQNFCVPCYEKQYALQCVQCKKPITTGGVT-YRDQPWHRECFVCTACKKQLSGQRFTARDEFPYCLTCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDC 275          

HSP 5 Score: 56.225 bits (134), Expect = 3.149e-7
Identity = 38/124 (30.65%), Postives = 51/124 (41.13%), Query Frame = 2
Query:  560 ALPCTQCQSSIQAGQLAVRVEHAANTQMSWHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIF---TEEYTRAMEQEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGC 922
            AL C QC+  I  G +  R          WH  CF CT C + L    +      PYC+  +  L   +CA C   I      +Y    E++ H   F CK C  SL G  ++ + D  LC  C
Sbjct:  159 ALQCVQCKKPITTGGVTYR-------DQPWHRECFVCTACKKQLSGQRFTARDEFPYCLTCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDC 275          
BLAST of Four and A half lim domains vs. UniProt/SwissProt
Match: sp|Q14192|FHL2_HUMAN (Four and a half LIM domains protein 2 OS=Homo sapiens OX=9606 GN=FHL2 PE=1 SV=3)

HSP 1 Score: 340.502 bits (872), Expect = 1.206e-111
Identity = 150/273 (54.95%), Postives = 204/273 (74.73%), Query Frame = 2
Query:  842 FACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGGVTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGELFAKKCSKCTKPITGFGGCKFISFEDRHWHSECFTCYKCNISLVGKGFLTNDDKIICPDCGR 1660
            F C  C+ SL G +YIL+++ P C+ C+E+ +AN C++C   IGCD KDLS+KDRHWHE CF C +C +SLVD+PFA K++ L C+DCY N+++++C  C K    G RK EY+G  WHE CF+C  C+QPIGTKSFIP++    CVPCYE+++A +C +C   I  GGVTY+  PWHKECF CT C KQL+G +FT++++  YC  C+ +L+AKKC+ CT PI+G GG K+ISFE+R WH++CF C KC++SLVG+GFLT  D I+CPDCG+
Sbjct:    5 FDCHHCNESLFGKKYILREESPYCVVCFETLFANTCEECGKPIGCDCKDLSYKDRHWHEACFHCSQCRNSLVDKPFAAKEDQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGSSWHETCFICHRCQQPIGTKSFIPKDNQNFCVPCYEKQHAMQCVQCKKPITTGGVTYREQPWHKECFVCTACRKQLSGQRFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDCGK 277          

HSP 2 Score: 155.606 bits (392), Expect = 1.766e-41
Identity = 88/277 (31.77%), Postives = 133/277 (48.01%), Query Frame = 2
Query:  662 FKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEH-HPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGG----VTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGEL 1477
            F C  C+E L    Y      PYCV  +  L    C  C + I  +    + +  H H A F C  C NSL    +  K+DQ LC  CY ++Y++ CQ+C   I   ++ + +K   WHE CF C  C   +  + F  KDN  +C  CY+ + A +C  C K    G     YR + WH+ECF+C  CR+ +  + F  R+    C+ C+ + YA+KC  C   I   G    ++++   WH +CF C  CS  L G  F ++ +   C +C  ++
Sbjct:    5 FDCHHCNESLFGKKYILREESPYCVVCFETLFANTCEECGKPIGCDCKDLSYKDRHWHEACFHCSQCRNSLVDKPFAAKEDQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGSSWHETCFICHRCQQPIGTKSFIPKDNQNFCVPCYEKQHAMQCVQCKKPITTG--GVTYREQPWHKECFVCTACRKQLSGQRFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDCGKDI 279          

HSP 3 Score: 115.931 bits (289), Expect = 1.565e-27
Identity = 66/219 (30.14%), Postives = 104/219 (47.49%), Query Frame = 2
Query:  647 WHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAH---FACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFK--AGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPC 1288
            WH  CF C++C   LVD  +    ++  C   Y+     +C  C + I     TR ME +    H   F C  C   +    +I KD+Q  C+ CYE Q+A  C QC   I   +  ++++++ WH++CF C  C   L  Q F  +D+  YC +C+ + +A +C GC        G +   +  +QWH +CF C  C   +  + F+    DI+C  C
Sbjct:   61 WHEACFHCSQCRNSLVDKPFAAKEDQLLCTDCYSNEYSSKCQECKKTIMPG--TRKMEYKGSSWHETCFICHRCQQPIGTKSFIPKDNQNFCVPCYEKQHAMQCVQCKKPI--TTGGVTYREQPWHKECFVCTACRKQLSGQRFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDC 275          

HSP 4 Score: 91.6633 bits (226), Expect = 3.852e-19
Identity = 57/181 (31.49%), Postives = 88/181 (48.62%), Query Frame = 2
Query:  569 CTQCQSSIQAGQLAVRVEHAANTQMSWHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIG--CDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDC 1105
            C +C+ +I  G   +  + +     SWH  CF C  C + +    +    N+ +CV  Y +    +C  C + I T   T   EQ  H   F C +C   L+G R+  +DD   C+ C+   YA  C  C+  I     +K +SF++R WH  CF C +CS SLV + F T+ +++ C DC
Sbjct:  101 CQECKKTIMPGTRKMEYKGS-----SWHETCFICHRCQQPIGTKSFIPKDNQNFCVPCYEKQHAMQCVQCKKPITTGGVT-YREQPWHKECFVCTACRKQLSGQRFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDC 275          

HSP 5 Score: 54.299 bits (129), Expect = 1.384e-6
Identity = 36/124 (29.03%), Postives = 52/124 (41.94%), Query Frame = 2
Query:  560 ALPCTQCQSSIQAGQLAVRVEHAANTQMSWHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIF---TEEYTRAMEQEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGC 922
            A+ C QC+  I  G +  R       +  WH  CF CT C + L    +    +  YC+  +  L   +CA C   I      +Y    E++ H   F CK C  SL G  ++ + D  LC  C
Sbjct:  159 AMQCVQCKKPITTGGVTYR-------EQPWHKECFVCTACRKQLSGQRFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDC 275          
BLAST of Four and A half lim domains vs. UniProt/SwissProt
Match: sp|Q2KI95|FHL2_BOVIN (Four and a half LIM domains protein 2 OS=Bos taurus OX=9913 GN=FHL2 PE=2 SV=1)

HSP 1 Score: 337.421 bits (864), Expect = 1.653e-110
Identity = 149/273 (54.58%), Postives = 201/273 (73.63%), Query Frame = 2
Query:  842 FACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGGVTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGELFAKKCSKCTKPITGFGGCKFISFEDRHWHSECFTCYKCNISLVGKGFLTNDDKIICPDCGR 1660
            F C  C++SL G +Y+L+++QP C+ C+E+ +A+ C++C   IGCD KDLS+KDRHWHE CF C  C  SLVD+PFA K++ L C+DCY  ++++RC  C K    G RK EY+G  WHE CF+C  C+QPIGTKSFIP++ +  CVPCYE +YA +C +C   I  GGVTY+  PWH+ECF CT C K L+G +FTS++E  YC  C+ +L+AKKC+ C  PI+G GG K+ISFE+R WH++CF C KC++SLVG+GFLT  D I+CPDCG+
Sbjct:    5 FDCHHCEDSLFGRKYVLREEQPYCVACFEALFASTCEECGKLIGCDCKDLSYKDRHWHEACFHCSRCRGSLVDKPFAAKEDQLLCTDCYSQEYSSRCQECKKSIMPGTRKMEYKGSSWHETCFICHRCQQPIGTKSFIPKDSENFCVPCYERQYALQCVQCKKPITTGGVTYREQPWHRECFVCTACKKPLSGQRFTSRDEFAYCLGCFCDLYAKKCAGCANPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDCGK 277          

HSP 2 Score: 157.147 bits (396), Expect = 4.294e-42
Identity = 86/273 (31.50%), Postives = 133/273 (48.72%), Query Frame = 2
Query:  662 FKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEH-HPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGG----VTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAEC 1465
            F C  C++ L    Y     +PYCV  +  L    C  C +LI  +    + +  H H A F C  C  SL    +  K+DQ LC  CY  +Y++ CQ+C   I   ++ + +K   WHE CF C  C   +  + F  KD+  +C  CY+ ++A +C  C K    G     YR + WH ECF+C  C++P+  + F  R++   C+ C+ + YA+KC  C   I   G    ++++   WH +CF C  CS  L G  F ++ +   C +C
Sbjct:    5 FDCHHCEDSLFGRKYVLREEQPYCVACFEALFASTCEECGKLIGCDCKDLSYKDRHWHEACFHCSRCRGSLVDKPFAAKEDQLLCTDCYSQEYSSRCQECKKSIMPGTRKMEYKGSSWHETCFICHRCQQPIGTKSFIPKDSENFCVPCYERQYALQCVQCKKPITTG--GVTYREQPWHRECFVCTACKKPLSGQRFTSRDEFAYCLGCFCDLYAKKCAGCANPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDC 275          

HSP 3 Score: 115.931 bits (289), Expect = 1.990e-27
Identity = 68/219 (31.05%), Postives = 101/219 (46.12%), Query Frame = 2
Query:  647 WHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAH---FACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFK--AGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPC 1288
            WH  CF C+ C   LVD  +    ++  C   Y+Q    RC  C + I     TR ME +    H   F C  C   +    +I KD +  C+ CYE QYA  C QC   I   +  ++++++ WH +CF C  C   L  Q F ++D   YC  C+ + +A +C GC        G +   +  +QWH +CF C  C   +  + F+    DI+C  C
Sbjct:   61 WHEACFHCSRCRGSLVDKPFAAKEDQLLCTDCYSQEYSSRCQECKKSIMPG--TRKMEYKGSSWHETCFICHRCQQPIGTKSFIPKDSENFCVPCYERQYALQCVQCKKPI--TTGGVTYREQPWHRECFVCTACKKPLSGQRFTSRDEFAYCLGCFCDLYAKKCAGCANPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDC 275          

HSP 4 Score: 91.2781 bits (225), Expect = 5.159e-19
Identity = 58/181 (32.04%), Postives = 91/181 (50.28%), Query Frame = 2
Query:  569 CTQCQSSIQAGQLAVRVEHAANTQMSWHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIG--CDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDC 1105
            C +C+ SI  G    ++E+  +   SWH  CF C  C + +    +    ++ +CV  Y +    +C  C + I T   T   EQ  H   F C +C   L+G R+  +D+   C+GC+   YA  C  C+  I     +K +SF++R WH  CF C +CS SLV + F T+ +++ C DC
Sbjct:  101 CQECKKSIMPG--TRKMEYKGS---SWHETCFICHRCQQPIGTKSFIPKDSENFCVPCYERQYALQCVQCKKPITTGGVT-YREQPWHRECFVCTACKKPLSGQRFTSRDEFAYCLGCFCDLYAKKCAGCANPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDC 275          

HSP 5 Score: 53.1434 bits (126), Expect = 2.988e-6
Identity = 37/124 (29.84%), Postives = 51/124 (41.13%), Query Frame = 2
Query:  560 ALPCTQCQSSIQAGQLAVRVEHAANTQMSWHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIF---TEEYTRAMEQEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGC 922
            AL C QC+  I  G +  R       +  WH  CF CT C + L    +       YC+  +  L   +CA C   I      +Y    E++ H   F CK C  SL G  ++ + D  LC  C
Sbjct:  159 ALQCVQCKKPITTGGVTYR-------EQPWHRECFVCTACKKPLSGQRFTSRDEFAYCLGCFCDLYAKKCAGCANPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDC 275          
BLAST of Four and A half lim domains vs. UniProt/SwissProt
Match: sp|Q3ZBI6|FHL3_BOVIN (Four and a half LIM domains protein 3 OS=Bos taurus OX=9913 GN=FHL3 PE=2 SV=1)

HSP 1 Score: 312.768 bits (800), Expect = 6.900e-101
Identity = 137/273 (50.18%), Postives = 188/273 (68.86%), Query Frame = 2
Query:  842 FACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGGVTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGELFAKKCSKCTKPITGFGGCKFISFEDRHWHSECFTCYKCNISLVGKGFLTNDDKIICPDCGR 1660
            F C  C  SL G +YI  DD P C+ CY++ +AN C +C   IG DS++L ++DRH+HE CF+C  C  SL D+PF  +D+ L C+DCY + F+++C  C +    G RK EY G+ WHE CFLC  C QP+G++SF+P +    CVPCYE K+A +C +C   + +GGVTY+  PWH+EC  CT C   LAG +FTS+E+ PYC  C+GELFA KCS C +PITG GG K++SFEDRHWH  CF+C +C+ SLVG+GF+ + D+++C  C +
Sbjct:    5 FDCAKCSESLYGRKYIQTDDGPYCVPCYDNTFANTCAECQQLIGHDSRELFYEDRHFHEGCFRCCRCQRSLADEPFTCQDSELLCNDCYCSAFSSQCSACGETVMPGSRKLEYGGQTWHEHCFLCSGCEQPLGSRSFVPDKGAHYCVPCYENKFAPRCARCSKTLTQGGVTYRDQPWHRECLVCTGCQTPLAGQQFTSREDDPYCVTCFGELFAPKCSSCKRPITGLGGGKYVSFEDRHWHHSCFSCARCSTSLVGQGFVPDGDQVLCQGCSQ 277          

HSP 2 Score: 156.377 bits (394), Expect = 1.024e-41
Identity = 92/273 (33.70%), Postives = 122/273 (44.69%), Query Frame = 2
Query:  662 FKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEH-HPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGG----VTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAEC 1465
            F C +C E L    Y    + PYCV  Y       CA C +LI  +      E  H H   F C  C  SL    +  +D + LC  CY S +++ C  C   +   S+ L +  + WHE CF C  C   L  + F       YC  CY+NKFA RC  C K    G     YR + WH EC +C  C+ P+  + F  RE D  CV C+ E +A KC+ C   I   G    V+++   WH  CF+C  CS  L G  F    ++  C  C
Sbjct:    5 FDCAKCSESLYGRKYIQTDDGPYCVPCYDNTFANTCAECQQLIGHDSRELFYEDRHFHEGCFRCCRCQRSLADEPFTCQDSELLCNDCYCSAFSSQCSACGETVMPGSRKLEYGGQTWHEHCFLCSGCEQPLGSRSFVPDKGAHYCVPCYENKFAPRCARCSKTLTQG--GVTYRDQPWHRECLVCTGCQTPLAGQQFTSREDDPYCVTCFGELFAPKCSSCKRPITGLGGGKYVSFEDRHWHHSCFSCARCSTSLVGQGFVPDGDQVLCQGC 275          

HSP 3 Score: 95.1301 bits (235), Expect = 2.378e-20
Identity = 57/183 (31.15%), Postives = 85/183 (46.45%), Query Frame = 2
Query:  569 CTQCQSSIQAGQLAVRVEHAANTQMSWHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQC----SGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDC 1105
            C+ C  ++  G  + ++E+   T   WH  CF C+ C++ L    +       YCV  Y     PRCA C + + T+      +Q  H     C  C   L G ++  ++D P C+ C+   +A  C  C    +G  G   K +SF+DRHWH  CF C  CS+SLV Q F    + + C  C
Sbjct:  101 CSACGETVMPG--SRKLEYGGQT---WHEHCFLCSGCEQPLGSRSFVPDKGAHYCVPCYENKFAPRCARCSKTL-TQGGVTYRDQPWHRECLVCTGCQTPLAGQQFTSREDDPYCVTCFGELFAPKCSSCKRPITGLGG--GKYVSFEDRHWHHSCFSCARCSTSLVGQGFVPDGDQVLCQGC 275          

HSP 4 Score: 60.077 bits (144), Expect = 1.798e-8
Identity = 34/124 (27.42%), Postives = 54/124 (43.55%), Query Frame = 2
Query:  569 CTQCQSSIQAGQLAVRVEHAANTQMSWHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIF---TEEYTRAMEQEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGCYES 931
            C +C  ++  G +  R          WH  C  CT C   L    +    + PYCV  + +L  P+C++C   I      +Y    ++  H + F+C  C  SL G  ++   DQ LC GC ++
Sbjct:  162 CARCSKTLTQGGVTYR-------DQPWHRECLVCTGCQTPLAGQQFTSREDDPYCVTCFGELFAPKCSSCKRPITGLGGGKYVSFEDRHWHHSCFSCARCSTSLVGQGFVPDGDQVLCQGCSQA 278          
BLAST of Four and A half lim domains vs. TrEMBL
Match: U6J6Y3 (Four and a half LIM domains protein 2 OS=Echinococcus granulosus OX=6210 GN=EGR_09187 PE=4 SV=1)

HSP 1 Score: 695.271 bits (1793), Expect = 0.000e+0
Identity = 332/554 (59.93%), Postives = 411/554 (74.19%), Query Frame = 2
Query:   74 MALKQDIGTPCLDCVDKCRGFKIHGWRKTCLGCDCSVDRHDITDESPLPILEEMKLADKPYYNLFMESLKMARKYGLSWLPIGLQASEVEQF-TSIVGGNIA-SRAGEKLRKQKLRRQIPVHDRCVEKFSHLETPT--------------ERQEAEKFLQFRNNQDLGVGHVYRLDM-AALPCTQCQSSIQAGQLAVRV--EHAANTQM------SWHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGGVTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGELFAKKCSKCTKPITGFGGCKFISFEDRHWHSECFTCYKCNISLVGKGFLTNDDKIICPDCGR 1660
            MAL+QDIG PCL C  +C GFK+H WR TC  C CS D+H +TD S    L E++L+D      +  +  +AR++GL WLP+G+Q+SEVE F TS+    I    A  ++R +++R Q+P  DR  +  S L T                E +EA +F   RN +D G+G V R    A + C +C   I   +  VR+  EH  +         +WHP CF+C+ C E LVD++Y W + KPYC+RHY Q+IRPRCATCD LIF+EEYTRAM+QEHH  HFAC+SCD SLTG RYIL+D++P C+ CYE+++AN C+QC  +IGCDSKDLSFK+RHWHEKCFKC  C++SL D+PFATKD+ LYCSDCYD +FA RCDGC  VFKAGMRKYEYRG+QWHEECF+CV+C+QPIG KSFIPR+  +VCVPCYE KYAQ+CTKC  VIRRGGVTYKG+PWHKECFTCT C KQLAG+KFTSK+E+PYCA+CYG+LFAKKC+KC KPITGFGGCKFISFEDRHWHSECF C KC+ +LVG+GFLTN+D+I+C DCGR
Sbjct:    1 MALQQDIGKPCLTCASECPGFKLHPWRATCTACHCSYDKHAVTDPSKDSYLHELELSDTTVLKAYDVAQTVAREHGLHWLPVGIQSSEVEAFLTSLPSSEIPRGEAYVEMRTRRIRHQVPPQDR--KPASSLSTAKLNLPPSNTPANLEGESREATRFQNSRNRRDFGIGRVERASAKATVVCAECSEQIGFREFCVRIRPEHRLSDSSDNSYVPAWHPGCFRCSNCSEHLVDFVYAWLNGKPYCLRHYGQMIRPRCATCDHLIFSEEYTRAMDQEHHTGHFACRSCDVSLTGQRYILRDEEPHCLACYEAKFANTCEQCKEKIGCDSKDLSFKERHWHEKCFKCSACNTSLADRPFATKDDQLYCSDCYDERFAARCDGCQGVFKAGMRKYEYRGQQWHEECFVCVECKQPIGAKSFIPRDNQVVCVPCYEAKYAQRCTKCSEVIRRGGVTYKGNPWHKECFTCTSCGKQLAGLKFTSKDEQPYCADCYGDLFAKKCTKCGKPITGFGGCKFISFEDRHWHSECFACSKCDCNLVGRGFLTNEDQIMCSDCGR 552          
BLAST of Four and A half lim domains vs. TrEMBL
Match: A0A0X3PEW6 (Four and a half LIM domains protein 2 OS=Schistocephalus solidus OX=70667 GN=FHL2 PE=4 SV=1)

HSP 1 Score: 695.271 bits (1793), Expect = 0.000e+0
Identity = 336/555 (60.54%), Postives = 411/555 (74.05%), Query Frame = 2
Query:   74 MALKQDIGTPCLDCVDKCRGFKIHGWRKTCLGCDCSVDRHDITDESPLPILEEMKLADKPYYNLFMESLKMARKYGLSWLPIGLQASEVEQFTSIVGGNIASR--AGEKLRKQKLRRQIPVHDR---CVEKFSHLETPT---------ERQEAEKFLQFRNNQDLGVGHVYRL-DMAALPCTQCQSSIQAGQLAVRV--EH---AANTQM---SWHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSK---DLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGGVTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGELFAKKCSKCTKPITGFGGCKFISFEDRHWHSECFTCYKCNISLVGKGFLTNDDKIICPDCGR 1660
            MA +QDIG  CL C  +C GF +H WR TC GC CS D+HD+T+ S    ++E++L+D      +  +   A + GL+WLP+GL +SE++ F + +  +   R  A   LR++++RRQIP  DR          L  P          E +EA +F   RN +D G+G V R+ D A LPC +C  +I      VRV  EH    AN      +WHP CF+C+ C E LVD+ Y W + KPYC+RHY Q+IRPRCATCD LIF+EEYTRAM+QEHH  HFAC+SCD SLTG RYIL+D++P C+ CYE++YAN C+QC  +IGCDSK   DLSFK+RHWHEKCFKC  CS+SL D+PFATK++ LYCSDCYD +FA RCDGC  VFKAGMRKYEYRG+QWHEECF+CV+C+QPIG KSFIPRE  +VCVPCYE KYAQ+CTKC  VIRRGGVTYKG+PWHKECFTCT C KQLAG+KFTSK+E+PYCA+CYGELFAKKC+KC+KPITGFGGCKFISFEDRHWHSECF C KCN +LVG+GFLTN+D+I+C DCGR
Sbjct:    1 MAFQQDIGKSCLTCGTECSGFSLHAWRATCTGCHCSYDKHDVTNFSHESFIKELELSDTTLLASYEVAETTAAENGLTWLPVGLSSSEIDAFIASLPSSEVPRGEANAALRQKRIRRQIPPQDRKPAASLSAVKLNLPPDAAAGNLDGEIREATRFQNSRNRRDFGLGRVDRVTDKAGLPCAECSETIGFRDFCVRVRPEHRPAEANDSEHAPAWHPGCFRCSNCTEHLVDFAYAWLNGKPYCLRHYGQMIRPRCATCDHLIFSEEYTRAMDQEHHTGHFACRSCDVSLTGQRYILRDEEPHCLACYEAKYANTCEQCKEKIGCDSKSPPDLSFKERHWHEKCFKCSTCSTSLADRPFATKEDQLYCSDCYDERFAARCDGCQGVFKAGMRKYEYRGQQWHEECFVCVECKQPIGAKSFIPRENQVVCVPCYEAKYAQRCTKCTEVIRRGGVTYKGNPWHKECFTCTSCGKQLAGLKFTSKDEQPYCADCYGELFAKKCTKCSKPITGFGGCKFISFEDRHWHSECFACSKCNCNLVGRGFLTNEDQIMCSDCGR 555          
BLAST of Four and A half lim domains vs. TrEMBL
Match: A0A068Y1Z9 (Four and A half lim domains OS=Echinococcus multilocularis OX=6211 PE=4 SV=1)

HSP 1 Score: 693.73 bits (1789), Expect = 0.000e+0
Identity = 332/554 (59.93%), Postives = 411/554 (74.19%), Query Frame = 2
Query:   74 MALKQDIGTPCLDCVDKCRGFKIHGWRKTCLGCDCSVDRHDITDESPLPILEEMKLADKPYYNLFMESLKMARKYGLSWLPIGLQASEVEQF-TSIVGGNIA-SRAGEKLRKQKLRRQIPVHDRCVEKFSHLETPT--------------ERQEAEKFLQFRNNQDLGVGHVYRLDM-AALPCTQCQSSIQAGQLAVRV--EHAANTQM------SWHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGGVTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGELFAKKCSKCTKPITGFGGCKFISFEDRHWHSECFTCYKCNISLVGKGFLTNDDKIICPDCGR 1660
            MAL+QDIG PCL C  +C GFK+H WR TC  C CS D+H +TD S    L E++L+D      +  +  +AR++GL WLP+G+Q+SEVE F TS+    I    A  ++R +++R Q+P  DR  +  S L T                E +EA +F   RN +D G+G V R    A + C +C   I   +  VR+  EH  +         +WHP CF+C+ C E LVD++Y W + KPYC+RHY Q+IRPRCATCD LIF+EEYTRAM+QEHH  HFAC+SCD SLTG RYIL+D++P C+ CYE+++AN C+QC  +IGCDSKDLSFK+RHWHEKCFKC  C++SL D+PFATKD+ LYCSDCYD +FA RCDGC  VFKAGMRKYEYRG+QWHEECF+CV+C+QPIG KSFIPR+  +VCVPCYE KYAQ+CTKC  VIRRGGVTYKG+PWHKECFTCT C KQLAG+KFTSK+E+PYCA+CYG+LFAKKC+KC KPITGFGGCKFISFEDRHWHSECF C KC+ +LVG+GFLTN+D+I+C DCGR
Sbjct:    1 MALQQDIGKPCLTCGSECPGFKLHPWRATCTACHCSYDKHAVTDPSKDSYLHELELSDTTVLKAYDVAQTIAREHGLHWLPVGIQSSEVEAFLTSLPSSEIPRGEAYVEMRTRRIRHQVPPQDR--KPASSLSTAKLNLPPSNTPANLEGESREATRFQNSRNRRDFGIGRVERASAKATVVCAECSEQIGFREFCVRIRPEHRLSDSSDNSYVPAWHPGCFRCSNCSEHLVDFVYAWLNGKPYCLRHYGQMIRPRCATCDHLIFSEEYTRAMDQEHHTGHFACRSCDVSLTGQRYILRDEEPHCLACYEAKFANTCEQCKEKIGCDSKDLSFKERHWHEKCFKCSACNTSLADRPFATKDDQLYCSDCYDERFAARCDGCQGVFKAGMRKYEYRGQQWHEECFVCVECKQPIGAKSFIPRDNQVVCVPCYEAKYAQRCTKCSEVIRRGGVTYKGNPWHKECFTCTSCGKQLAGLKFTSKDEQPYCADCYGDLFAKKCTKCGKPITGFGGCKFISFEDRHWHSECFACSKCDCNLVGRGFLTNEDQIMCSDCGR 552          
BLAST of Four and A half lim domains vs. TrEMBL
Match: A0A0R3X1E4 (Uncharacterized protein OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS7003 PE=4 SV=1)

HSP 1 Score: 693.345 bits (1788), Expect = 0.000e+0
Identity = 331/554 (59.75%), Postives = 414/554 (74.73%), Query Frame = 2
Query:   74 MALKQDIGTPCLDCVDKCRGFKIHGWRKTCLGCDCSVDRHDITDESPLPILEEMKLADKPYYNLFMESLKMARKYGLSWLPIGLQASEVEQFTSIVGGNIASRAG--EKLRKQKLRRQIPVHDRCVEKFSHLETPT--------------ERQEAEKFLQFRNNQDLGVGHVYRLDM-AALPCTQCQSSIQAGQLAVRV--EH----AANTQMS--WHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGGVTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGELFAKKCSKCTKPITGFGGCKFISFEDRHWHSECFTCYKCNISLVGKGFLTNDDKIICPDCGR 1660
            MAL+QD+G PCL C  +C GFK+H WR TC GC CS D+H +TD S    L E++L+D      +  +  +A+++GL WLP+G+Q++EVE F + +  +   R     ++R +++R Q+P  DR  +  S L T                E +EA +F   RN +D G+G V R+   A + C +C   I   +  VRV  EH    +++T  +  WHP CF+C+ C E LVD +Y W + KPYC+RHY Q+IRPRCATCD LIF+EEYTRAM+QEHH  HFAC+SCD SLTG RYIL+D++P C+ CYE+++AN C+QC  +IGCDSKDLSFK+RHWHEKCFKC  C++SL D+PFATKD+ LYCSDCYD +FA RCDGC  VFKAGMRKYEYRG+QWHEECF+CV+C+QPIG KSFIPR+  +VCVPCYE KYAQ+CTKC  VIRRGGVTYKG+PWHKECFTCT C KQLAG+KFTSK+E+PYCA+CYGELFAKKC+KC KPITGFGGCKFISFEDRHWHSECF C KC+ +LVG+GFLTNDD+I+C DCGR
Sbjct:    1 MALQQDVGKPCLTCGSECSGFKLHPWRATCTGCHCSYDKHAVTDPSKDSYLHELELSDVTVLKAYDVAQAIAKEHGLHWLPVGIQSAEVEAFLTSLPSSEIPRGEVYAEMRFRRIRHQVPPQDR--KPASSLSTAKLNLPPSTAPANLEGESREATRFQNSRNRRDFGIGRVERVSAKATIVCAECSEHIGFREFCVRVRPEHRLSDSSDTSYAPAWHPGCFRCSNCSEHLVDLVYGWLNGKPYCLRHYGQMIRPRCATCDHLIFSEEYTRAMDQEHHTGHFACRSCDVSLTGQRYILRDEEPHCLACYEAKFANTCEQCKEKIGCDSKDLSFKERHWHEKCFKCSACNTSLADRPFATKDDQLYCSDCYDERFAARCDGCQGVFKAGMRKYEYRGQQWHEECFVCVECKQPIGAKSFIPRDNQVVCVPCYEAKYAQRCTKCAEVIRRGGVTYKGNPWHKECFTCTSCGKQLAGLKFTSKDEQPYCADCYGELFAKKCTKCGKPITGFGGCKFISFEDRHWHSECFACSKCDCNLVGRGFLTNDDQIMCSDCGR 552          
BLAST of Four and A half lim domains vs. TrEMBL
Match: A0A0R3T6D5 (Uncharacterized protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS2622 PE=4 SV=1)

HSP 1 Score: 692.96 bits (1787), Expect = 0.000e+0
Identity = 324/550 (58.91%), Postives = 410/550 (74.55%), Query Frame = 2
Query:   74 MALKQDIGTPCLDCVDKCRGFKIHGWRKTCLGCDCSVDRHDITDESPLPILEEMKLADKPYYNLFMESLKMARKYGLSWLPIGLQASEVEQFTSIVGGNIASRAG--EKLRKQKLRRQIPVHDR------------CVEKFSHLETPTERQEAEKFLQFRNNQDLGVGHVYRLDMAA-LPCTQCQSSIQAGQLAV------RVEHAANTQMSWHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGGVTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGELFAKKCSKCTKPITGFGGCKFISFEDRHWHSECFTCYKCNISLVGKGFLTNDDKIICPDCGR 1660
            MAL QD+G PCLDC  +C GFK+H WR +C  C CS ++H IT+ S    L E++L D      F  +  +A+++ L+WLPIG+QASE+E F + +  N   R     ++R +++R Q+P  DR             V   +H+    E +EA +F   RN +D G+G + R      + C +C   I   +L V      R+ ++A+   SWHP CF+C  C E LVD++YCW + KPYC+RHY QL+RPRC+TCD LIF+EEY RAM+QEHH  HFAC+SCD SLTG RYIL+D++P C+ CYE+++AN C+QC  +IGCDSKDLSFK+RHWHEKCFKC  C++SL D+PFATKD+ L+CSDCYD +FA RCDGC  VFKAGMRKYEYRG+QWHEECF+CV+C+QPIG KSFIPRE  +VCVPCYE+KYAQ+C+KC  VIRRGGVTYKG+PWHKECFTCT C KQLAG+KFTSK+E+PYCA+C+G+LFAKKC+KC KPITGFGGCKFISFEDRHWHSECF C KCN +LVG+GFLTN+D+I+C DCGR
Sbjct:    1 MALPQDVGKPCLDCGSECPGFKLHPWRASCNNCLCSFNKHAITESSGTTYLHELELPDTALIKAFEAAQAIAKEHELNWLPIGIQASEIEAFLASLPANELPRGDTYAQMRLKRIRSQVPPQDRKPSASLNTAKLNLVSSDAHVNLDGEIREATRFQVNRNKRDFGIGRIDRSSTNPNIACFECSEPIGFHELRVHVRQEHRLANSADDVPSWHPGCFRCATCCEHLVDFVYCWLNGKPYCLRHYGQLVRPRCSTCDHLIFSEEYIRAMDQEHHTGHFACRSCDVSLTGQRYILRDEEPHCLACYEAKFANTCEQCKEKIGCDSKDLSFKERHWHEKCFKCSACNTSLADRPFATKDDQLFCSDCYDERFAARCDGCQGVFKAGMRKYEYRGQQWHEECFVCVECKQPIGAKSFIPRENQVVCVPCYEQKYAQRCSKCSEVIRRGGVTYKGNPWHKECFTCTSCGKQLAGLKFTSKDEQPYCADCFGDLFAKKCTKCGKPITGFGGCKFISFEDRHWHSECFACSKCNANLVGRGFLTNEDQIMCSDCGR 550          
BLAST of Four and A half lim domains vs. Ensembl Cavefish
Match: fhl2a (four and a half LIM domains protein 2 [Source:NCBI gene;Acc:103031012])

HSP 1 Score: 336.265 bits (861), Expect = 6.067e-111
Identity = 147/273 (53.85%), Postives = 202/273 (73.99%), Query Frame = 2
Query:  842 FACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGGVTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGELFAKKCSKCTKPITGFGGCKFISFEDRHWHSECFTCYKCNISLVGKGFLTNDDKIICPDCGR 1660
            + C  C  SL G +Y+L+++ P C+ CYES Y+N C++C   IGC+S+DLS+KDRHWHE+CF CF+C  SLVD+PF+TKD  L C++CY N+++++C  C K    G RK E++G  WHE CF C  C+QPIGTKSFIP++ +  CVPCYE+++A +C  C   I  GGVTY   PWHK+CF CT C +QL+G +FTS+++  YC  C+  L+AKKC+ CT PI+G GG K+ISFE+R WH++CF C KC++SLVG+GFLT  D I+CP+CG+
Sbjct:    5 YDCHYCKESLFGKKYVLREENPYCVKCYESLYSNTCEECKKPIGCNSRDLSYKDRHWHEECFHCFQCKRSLVDKPFSTKDEQLLCTECYSNEYSSKCHECKKTIMPGSRKMEHKGNSWHETCFTCKRCQQPIGTKSFIPKDNNNYCVPCYEKQFAMQCVHCKKPITTGGVTYHDQPWHKDCFLCTGCKQQLSGQRFTSRDDFAYCLNCFCNLYAKKCASCTSPISGLGGSKYISFEERQWHNDCFNCKKCSVSLVGRGFLTERDDILCPECGK 277          

HSP 2 Score: 153.68 bits (387), Expect = 8.724e-42
Identity = 89/273 (32.60%), Postives = 126/273 (46.15%), Query Frame = 2
Query:  662 FKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEH-HPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGG----VTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAEC 1465
            + C  C E L    Y      PYCV+ Y  L    C  C + I       + +  H H   F C  C  SL    +  KD+Q LC  CY ++Y++ C +C   I   S+ +  K   WHE CF C  C   +  + F  KDNN YC  CY+ +FA +C  C K    G     Y  + WH++CFLC  C+Q +  + F  R+    C+ C+   YA+KC  C   I   G    ++++   WH +CF C  CS  L G  F ++ +   C EC
Sbjct:    5 YDCHYCKESLFGKKYVLREENPYCVKCYESLYSNTCEECKKPIGCNSRDLSYKDRHWHEECFHCFQCKRSLVDKPFSTKDEQLLCTECYSNEYSSKCHECKKTIMPGSRKMEHKGNSWHETCFTCKRCQQPIGTKSFIPKDNNNYCVPCYEKQFAMQCVHCKKPITTG--GVTYHDQPWHKDCFLCTGCKQQLSGQRFTSRDDFAYCLNCFCNLYAKKCASCTSPISGLGGSKYISFEERQWHNDCFNCKKCSVSLVGRGFLTERDDILCPEC 275          

HSP 3 Score: 112.849 bits (281), Expect = 2.700e-27
Identity = 65/219 (29.68%), Postives = 100/219 (45.66%), Query Frame = 2
Query:  647 WHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAH---FACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFK--AGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPC 1288
            WH  CF C +C   LVD  +     +  C   Y+     +C  C + I     +R ME + +  H   F CK C   +    +I KD+   C+ CYE Q+A  C  C   I   +  +++ D+ WH+ CF C  C   L  Q F ++D+  YC +C+ N +A +C  C        G +   +  +QWH +CF C  C   +  + F+    DI+C  C
Sbjct:   61 WHEECFHCFQCKRSLVDKPFSTKDEQLLCTECYSNEYSSKCHECKKTIMPG--SRKMEHKGNSWHETCFTCKRCQQPIGTKSFIPKDNNNYCVPCYEKQFAMQCVHCKKPI--TTGGVTYHDQPWHKDCFLCTGCKQQLSGQRFTSRDDFAYCLNCFCNLYAKKCASCTSPISGLGGSKYISFEERQWHNDCFNCKKCSVSLVGRGFLTERDDILCPEC 275          

HSP 4 Score: 96.2857 bits (238), Expect = 1.078e-21
Identity = 60/181 (33.15%), Postives = 90/181 (49.72%), Query Frame = 2
Query:  569 CTQCQSSIQAGQLAVRVEHAANTQMSWHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIG--CDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDC 1105
            C +C+ +I  G  + ++EH  N   SWH  CF C  C + +    +    N  YCV  Y +    +C  C + I T   T   +Q  H   F C  C   L+G R+  +DD   C+ C+ + YA  C  C+  I     SK +SF++R WH  CF C +CS SLV + F T+ +++ C +C
Sbjct:  101 CHECKKTIMPG--SRKMEHKGN---SWHETCFTCKRCQQPIGTKSFIPKDNNNYCVPCYEKQFAMQCVHCKKPITTGGVT-YHDQPWHKDCFLCTGCKQQLSGQRFTSRDDFAYCLNCFCNLYAKKCASCTSPISGLGGSKYISFEERQWHNDCFNCKKCSVSLVGRGFLTERDDILCPEC 275          

HSP 5 Score: 50.447 bits (119), Expect = 2.852e-6
Identity = 34/124 (27.42%), Postives = 50/124 (40.32%), Query Frame = 2
Query:  560 ALPCTQCQSSIQAGQLAVRVEHAANTQMSWHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIF---TEEYTRAMEQEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGC 922
            A+ C  C+  I  G +             WH  CF CT C + L    +    +  YC+  +  L   +CA+C   I      +Y    E++ H   F CK C  SL G  ++ + D  LC  C
Sbjct:  159 AMQCVHCKKPITTGGVTYH-------DQPWHKDCFLCTGCKQQLSGQRFTSRDDFAYCLNCFCNLYAKKCASCTSPISGLGGSKYISFEERQWHNDCFNCKKCSVSLVGRGFLTERDDILCPEC 275          
BLAST of Four and A half lim domains vs. Ensembl Cavefish
Match: fhl3a (four and a half LIM domains 3 [Source:NCBI gene;Acc:103023824])

HSP 1 Score: 328.561 bits (841), Expect = 4.548e-108
Identity = 149/272 (54.78%), Postives = 194/272 (71.32%), Query Frame = 2
Query:  842 FACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGGVTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGELFAKKCSKCTKPITGFGGCKFISFEDRHWHSECFTCYKCNISLVGKGFLTNDDKIICPDCG 1657
            F C +C  SL G +YI  +D P CI CY+S +AN C +C   IG D+++L ++DRH+HE CF+CF C  SL D+PF ++D+ L C+DCY N+F+++C  C K    G RK EY G  WHE CF+C  C QPIG+KSFIP + D  CVPCYE K+A +CT+C  V+ +GGVTY+  PWHKECF CT C  QLAG  FTS+++ PYC +C+G L+AKKC  C+KPITGFGG K+ISFE+R WH  CFTC +C++SLVG GF    D+I+C DC 
Sbjct:    5 FDCDNCKESLYGRKYIQAEDNPYCIPCYDSLFANTCDECKELIGHDARELFYEDRHYHEHCFRCFRCDRSLADEPFTSQDDALLCNDCYCNEFSSKCVACDKTVMPGTRKLEYGGSTWHEGCFICNSCEQPIGSKSFIPDKDDHYCVPCYENKFAPRCTRCKQVLAKGGVTYRDEPWHKECFLCTGCKVQLAGQHFTSRDDSPYCLKCFGNLYAKKCEACSKPITGFGGGKYISFEERQWHQTCFTCSRCSVSLVGAGFFPERDEILCRDCN 276          

HSP 2 Score: 157.147 bits (396), Expect = 5.438e-43
Identity = 90/277 (32.49%), Postives = 130/277 (46.93%), Query Frame = 2
Query:  662 FKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAH-FACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGG----VTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGEL 1477
            F C  C E L    Y    + PYC+  Y  L    C  C ELI  +      E  H+  H F C  CD SL    +  +DD  LC  CY +++++ C  C   +   ++ L +    WHE CF C  C   +  + F    ++ YC  CY+NKFA RC  C +V   G     YR + WH+ECFLC  C+  +  + F  R+    C+ C+   YA+KC  C   I   G    ++++   WH+ CFTC+ CS  L G  F  + ++  C +C   L
Sbjct:    5 FDCDNCKESLYGRKYIQAEDNPYCIPCYDSLFANTCDECKELIGHDARELFYEDRHYHEHCFRCFRCDRSLADEPFTSQDDALLCNDCYCNEFSSKCVACDKTVMPGTRKLEYGGSTWHEGCFICNSCEQPIGSKSFIPDKDDHYCVPCYENKFAPRCTRCKQVLAKG--GVTYRDEPWHKECFLCTGCKVQLAGQHFTSRDDSPYCLKCFGNLYAKKCEACSKPITGFGGGKYISFEERQWHQTCFTCSRCSVSLVGAGFFPERDEILCRDCNSNL 279          

HSP 3 Score: 112.464 bits (280), Expect = 3.739e-27
Identity = 62/219 (28.31%), Postives = 100/219 (45.66%), Query Frame = 2
Query:  647 WHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAME---QEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFK--AGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPC 1288
            +H  CF+C  CD  L D  +    +   C   Y      +C  CD+ +     TR +E      H   F C SC+  +    +I   D   C+ CYE+++A  C +C   +      ++++D  WH++CF C  C   L  Q F ++D++ YC  C+ N +A +C+ C K      G +   +  +QWH+ CF C  C   +    F P   +I+C  C
Sbjct:   61 YHEHCFRCFRCDRSLADEPFTSQDDALLCNDCYCNEFSSKCVACDKTVMPG--TRKLEYGGSTWHEGCFICNSCEQPIGSKSFIPDKDDHYCVPCYENKFAPRCTRCKQVLA--KGGVTYRDEPWHKECFLCTGCKVQLAGQHFTSRDDSPYCLKCFGNLYAKKCEACSKPITGFGGGKYISFEERQWHQTCFTCSRCSVSLVGAGFFPERDEILCRDC 275          

HSP 4 Score: 92.4337 bits (228), Expect = 2.213e-20
Identity = 57/184 (30.98%), Postives = 84/184 (45.65%), Query Frame = 2
Query:  569 CTQCQSSIQAGQLAVRVEHAANTQMSWHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIG--CDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDN 1114
            C  C  ++  G    ++E+  +T   WH  CF C  C++ +    +    +  YCV  Y     PRC  C +++     T   E  H    F C  C   L G  +  +DD P C+ C+ + YA  C+ CS  I      K +SF++R WH+ CF C  CS SLV   F  + + + C DC  N
Sbjct:  101 CVACDKTVMPG--TRKLEYGGST---WHEGCFICNSCEQPIGSKSFIPDKDDHYCVPCYENKFAPRCTRCKQVLAKGGVTYRDEPWHKEC-FLCTGCKVQLAGQHFTSRDDSPYCLKCFGNLYAKKCEACSKPITGFGGGKYISFEERQWHQTCFTCSRCSVSLVGAGFFPERDEILCRDCNSN 278          
BLAST of Four and A half lim domains vs. Ensembl Cavefish
Match: fhl2b (four and a half LIM domains 2b [Source:ZFIN;Acc:ZDB-GENE-041010-121])

HSP 1 Score: 279.641 bits (714), Expect = 2.394e-89
Identity = 131/273 (47.99%), Postives = 185/273 (67.77%), Query Frame = 2
Query:  842 FACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGGVTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGELFAKKCSKCTKPITGFGGCKFISFEDRHWHSECFTCYKCNISLVGKGFLTNDDKIICPDCGR 1660
            + C  C  SL G +Y+L+++ P C+ CYES Y+N C++C   I C+S+DLS+KDRHWH+ CF CF+C+ SLVD+PF+TK+  L C++CY N+++++C  C K    G RK E++G  WHE CF C  C+QPIGTKSFIP++    CVPC+E+++A +C +C  V      T        +CF CT C +QL+G +FTS+++ PYC  C+  L+AKKCS CT PI+G GG K+ISFE+R WH++CF C KC+I           D I+CPDCG+
Sbjct:    5 YDCHYCKESLFGKKYVLREENPYCVKCYESLYSNTCEECKKPICCNSRDLSYKDRHWHDDCFHCFKCNRSLVDKPFSTKNEELLCTECYSNEYSSKCYECKKTIMPGSRKMEHKGNSWHETCFTCQRCQQPIGTKSFIPKDNANYCVPCFEKQFALQCVQCKKVHTVYNST--------DCFLCTGCKEQLSGQRFTSRDDFPYCLNCFCNLYAKKCSSCTSPISGLGGSKYISFEERQWHNDCFNCKKCSI-----------DDILCPDCGK 258          

HSP 2 Score: 120.939 bits (302), Expect = 2.317e-30
Identity = 75/253 (29.64%), Postives = 113/253 (44.66%), Query Frame = 2
Query:  662 FKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEH-HPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGG----VTYKGSPWHKECFTCTHCS 1405
            + C  C E L    Y      PYCV+ Y  L    C  C + I       + +  H H   F C  C+ SL    +  K+++ LC  CY ++Y++ C +C   I   S+ +  K   WHE CF C  C   +  + F  KDN  YC  C++ +FA +C  C KV                 +CFLC  C++ +  + F  R+    C+ C+   YA+KC+ C   I   G    ++++   WH +CF C  CS
Sbjct:    5 YDCHYCKESLFGKKYVLREENPYCVKCYESLYSNTCEECKKPICCNSRDLSYKDRHWHDDCFHCFKCNRSLVDKPFSTKNEELLCTECYSNEYSSKCYECKKTIMPGSRKMEHKGNSWHETCFTCQRCQQPIGTKSFIPKDNANYCVPCFEKQFALQCVQCKKVHTVYNST----------DCFLCTGCKEQLSGQRFTSRDDFPYCLNCFCNLYAKKCSSCTSPISGLGGSKYISFEERQWHNDCFNCKKCS 247          

HSP 3 Score: 82.8037 bits (203), Expect = 3.254e-17
Identity = 55/198 (27.78%), Postives = 85/198 (42.93%), Query Frame = 2
Query:  647 WHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAH---FACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFK--AGMRKYEYRGKQWHEECFLCVDC 1225
            WH  CF C +C+  LVD  +   + +  C   Y+     +C  C + I     +R ME + +  H   F C+ C   +    +I KD+   C+ C+E Q+A  C QC                +    CF C  C   L  Q F ++D+  YC +C+ N +A +C  C        G +   +  +QWH +CF C  C
Sbjct:   61 WHDDCFHCFKCNRSLVDKPFSTKNEELLCTECYSNEYSSKCYECKKTIMPG--SRKMEHKGNSWHETCFTCQRCQQPIGTKSFIPKDNANYCVPCFEKQFALQCVQCK----------KVHTVYNSTDCFLCTGCKEQLSGQRFTSRDDFPYCLNCFCNLYAKKCSSCTSPISGLGGSKYISFEERQWHNDCFNCKKC 246          
BLAST of Four and A half lim domains vs. Ensembl Cavefish
Match: fhl1a (four and a half LIM domains 1 [Source:NCBI gene;Acc:103045707])

HSP 1 Score: 256.529 bits (654), Expect = 5.954e-80
Identity = 122/275 (44.36%), Postives = 172/275 (62.55%), Query Frame = 2
Query:  842 FACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNN-LYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGGVTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGELFAKKCSKCTKPITGFG-GCKFISFEDRHWHSECFTCYKCNISLVGKGFLTNDDKIICPDCGR 1660
            F C  C ++L G +Y+ KDD+ +C+ C+E   AN C +C   IG D+K+L+ K+RHWHE CF+C +C   L ++ FA +D+  + C  C   + + RC GC+KV   G +  EY+ K WHEECF C +C+QPI + SF+ +  D  C PC+E+K+A+ C +C   I   G+TY+  PWH ECF C  C K LAG +FT+ E+  YC +CY    AKKCS C  PITGFG G   +++E+  WH  CF C KC++SL  K F+ N + I C DC +
Sbjct:   21 FDCFYCRDNLQGKKYVNKDDKHVCVRCFEKLCANTCAECRRPIGVDAKELTHKNRHWHEDCFRCAKCYKPLANESFAARDDGKVMCGKCGAREDSARCQGCYKVIMPGDKNVEYKHKVWHEECFTCFECKQPIRSLSFLTKGDDFYCTPCHEKKFAKNCARCKEPITANGITYQDKPWHSECFVCQTCRKPLAGGRFTAHEDYFYCVDCYKTSVAKKCSGCQNPITGFGKGTNVVNYENNTWHEYCFNCKKCSLSLAHKRFVLNGENIYCTDCAK 295          

HSP 2 Score: 143.665 bits (361), Expect = 5.987e-38
Identity = 91/279 (32.62%), Postives = 128/279 (45.88%), Query Frame = 2
Query:  662 FKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEH-HPAHFACKSCDNSLTGHRYILKDD-QPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGG-----VTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGEL 1477
            F C  C + L    Y    +K  CVR + +L    CA C   I  +      +  H H   F C  C   L    +  +DD + +C  C   + +  CQ C   I    K++ +K + WHE+CF CFEC   +    F TK ++ YC+ C++ KFA  C  C +   A      Y+ K WH ECF+C  CR+P+    F   E    CV CY+   A+KC+ C   I   G     V Y+ + WH+ CF C  CS  LA  +F    E  YC +C  +L
Sbjct:   21 FDCFYCRDNLQGKKYVNKDDKHVCVRCFEKLCANTCAECRRPIGVDAKELTHKNRHWHEDCFRCAKCYKPLANESFAARDDGKVMCGKCGAREDSARCQGCYKVIMPGDKNVEYKHKVWHEECFTCFECKQPIRSLSFLTKGDDFYCTPCHEKKFAKNCARCKEPITAN--GITYQDKPWHSECFVCQTCRKPLAGGRFTAHEDYFYCVDCYKTSVAKKCSGCQNPITGFGKGTNVVNYENNTWHEYCFNCKKCSLSLAHKRFVLNGENIYCTDCAKKL 297          

HSP 3 Score: 102.834 bits (255), Expect = 8.947e-24
Identity = 67/252 (26.59%), Postives = 107/252 (42.46%), Query Frame = 2
Query:  554 MAALPCTQCQSSIQAGQLAVRVEHAANTQMSWHPRCFKCTECDEVLVDYIYCWYSN-KPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAH---FACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKV---FKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPC 1288
            + A  C +C+  I      V  +   +    WH  CF+C +C + L +  +    + K  C +  A+    RC  C ++I   +  + +E +H   H   F C  C   +    ++ K D   C  C+E ++A  C +C   I   +  ++++D+ WH +CF C  C   L    F   ++  YC DCY    A +C GC      F  G     Y    WHE CF C  C   +  K F+   ++I C  C
Sbjct:   51 LCANTCAECRRPI-----GVDAKELTHKNRHWHEDCFRCAKCYKPLANESFAARDDGKVMCGKCGAREDSARCQGCYKVIMPGD--KNVEYKHKVWHEECFTCFECKQPIRSLSFLTKGDDFYCTPCHEKKFAKNCARCKEPI--TANGITYQDKPWHSECFVCQTCRKPLAGGRFTAHEDYFYCVDCYKTSVAKKCSGCQNPITGFGKGTNVVNYENNTWHEYCFNCKKCSLSLAHKRFVLNGENIYCTDC 293          

HSP 4 Score: 66.6254 bits (161), Expect = 1.609e-11
Identity = 39/108 (36.11%), Postives = 57/108 (52.78%), Query Frame = 2
Query: 1337 RRGGVTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGELFAKKCSKCTKPITGFGGCKFISFEDRHWHSECFTCYKCNISLVGKGFLTNDD-KIICPDCG 1657
            R  G     S    E F C +C   L G K+ +K++K  C  C+ +L A  C++C +PI G    K ++ ++RHWH +CF C KC   L  + F   DD K++C  CG
Sbjct:    5 RHSGPRSYLSSTMTERFDCFYCRDNLQGKKYVNKDDKHVCVRCFEKLCANTCAECRRPI-GVDA-KELTHKNRHWHEDCFRCAKCYKPLANESFAARDDGKVMCGKCG 110          
BLAST of Four and A half lim domains vs. Ensembl Cavefish
Match: fhl1a (four and a half LIM domains 1 [Source:NCBI gene;Acc:103045707])

HSP 1 Score: 255.758 bits (652), Expect = 7.038e-80
Identity = 122/275 (44.36%), Postives = 172/275 (62.55%), Query Frame = 2
Query:  842 FACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNN-LYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGGVTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGELFAKKCSKCTKPITGFG-GCKFISFEDRHWHSECFTCYKCNISLVGKGFLTNDDKIICPDCGR 1660
            F C  C ++L G +Y+ KDD+ +C+ C+E   AN C +C   IG D+K+L+ K+RHWHE CF+C +C   L ++ FA +D+  + C  C   + + RC GC+KV   G +  EY+ K WHEECF C +C+QPI + SF+ +  D  C PC+E+K+A+ C +C   I   G+TY+  PWH ECF C  C K LAG +FT+ E+  YC +CY    AKKCS C  PITGFG G   +++E+  WH  CF C KC++SL  K F+ N + I C DC +
Sbjct:    5 FDCFYCRDNLQGKKYVNKDDKHVCVRCFEKLCANTCAECRRPIGVDAKELTHKNRHWHEDCFRCAKCYKPLANESFAARDDGKVMCGKCGAREDSARCQGCYKVIMPGDKNVEYKHKVWHEECFTCFECKQPIRSLSFLTKGDDFYCTPCHEKKFAKNCARCKEPITANGITYQDKPWHSECFVCQTCRKPLAGGRFTAHEDYFYCVDCYKTSVAKKCSGCQNPITGFGKGTNVVNYENNTWHEYCFNCKKCSLSLAHKRFVLNGENIYCTDCAK 279          

HSP 2 Score: 143.28 bits (360), Expect = 5.006e-38
Identity = 91/279 (32.62%), Postives = 128/279 (45.88%), Query Frame = 2
Query:  662 FKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEH-HPAHFACKSCDNSLTGHRYILKDD-QPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGG-----VTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGEL 1477
            F C  C + L    Y    +K  CVR + +L    CA C   I  +      +  H H   F C  C   L    +  +DD + +C  C   + +  CQ C   I    K++ +K + WHE+CF CFEC   +    F TK ++ YC+ C++ KFA  C  C +   A      Y+ K WH ECF+C  CR+P+    F   E    CV CY+   A+KC+ C   I   G     V Y+ + WH+ CF C  CS  LA  +F    E  YC +C  +L
Sbjct:    5 FDCFYCRDNLQGKKYVNKDDKHVCVRCFEKLCANTCAECRRPIGVDAKELTHKNRHWHEDCFRCAKCYKPLANESFAARDDGKVMCGKCGAREDSARCQGCYKVIMPGDKNVEYKHKVWHEECFTCFECKQPIRSLSFLTKGDDFYCTPCHEKKFAKNCARCKEPITAN--GITYQDKPWHSECFVCQTCRKPLAGGRFTAHEDYFYCVDCYKTSVAKKCSGCQNPITGFGKGTNVVNYENNTWHEYCFNCKKCSLSLAHKRFVLNGENIYCTDCAKKL 281          

HSP 3 Score: 102.834 bits (255), Expect = 7.967e-24
Identity = 67/252 (26.59%), Postives = 107/252 (42.46%), Query Frame = 2
Query:  554 MAALPCTQCQSSIQAGQLAVRVEHAANTQMSWHPRCFKCTECDEVLVDYIYCWYSN-KPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAH---FACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKV---FKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPC 1288
            + A  C +C+  I      V  +   +    WH  CF+C +C + L +  +    + K  C +  A+    RC  C ++I   +  + +E +H   H   F C  C   +    ++ K D   C  C+E ++A  C +C   I   +  ++++D+ WH +CF C  C   L    F   ++  YC DCY    A +C GC      F  G     Y    WHE CF C  C   +  K F+   ++I C  C
Sbjct:   35 LCANTCAECRRPI-----GVDAKELTHKNRHWHEDCFRCAKCYKPLANESFAARDDGKVMCGKCGAREDSARCQGCYKVIMPGD--KNVEYKHKVWHEECFTCFECKQPIRSLSFLTKGDDFYCTPCHEKKFAKNCARCKEPI--TANGITYQDKPWHSECFVCQTCRKPLAGGRFTAHEDYFYCVDCYKTSVAKKCSGCQNPITGFGKGTNVVNYENNTWHEYCFNCKKCSLSLAHKRFVLNGENIYCTDC 277          
BLAST of Four and A half lim domains vs. Ensembl Sea Lamprey
Match: fhl5 (four and a half LIM domains 5 [Source:ZFIN;Acc:ZDB-GENE-040822-3])

HSP 1 Score: 192.586 bits (488), Expect = 5.954e-58
Identity = 87/170 (51.18%), Postives = 116/170 (68.24%), Query Frame = 2
Query:  842 FACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFK-AGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGG 1348
            + C  C  SL G +Y+L+++ P C+ CYE+ Y + C+ C   IGCDSKDLS+KDRHWHE CFKC  C  SL D+ F+ +D  L C++C+ N ++ +C G  K+F   G RK E+RG  WHE CF C  C+QPIG+KSF+PRE+D  CVPCYE+++AQ CT C  V   GG
Sbjct:   13 YDCHYCKESLLGKKYVLREENPYCVRCYETLYTHACESCKQPIGCDSKDLSYKDRHWHEGCFKCATCERSLADKAFSARDEKLLCTECHANHYSAKCAGISKLFSPVGTRKMEFRGSSWHETCFGCARCQQPIGSKSFVPREKDQYCVPCYEKQFAQHCTLCKKVGGEGG 182          

HSP 2 Score: 105.531 bits (262), Expect = 1.767e-26
Identity = 50/171 (29.24%), Postives = 86/171 (50.29%), Query Frame = 2
Query: 1025 FKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKC---TKCVGVIRRGGVTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGELFAKKCSKCTKPITGFGG 1528
            + C  C  SL+ + +  ++ N YC  CY+  +   C+ C +      +   Y+ + WHE CF C  C + +  K+F  R++ ++C  C+   Y+ KC   +K    +    + ++GS WH+ CF C  C + +    F  +E+  YC  CY + FA+ C+ C K + G GG
Sbjct:   13 YDCHYCKESLLGKKYVLREENPYCVRCYETLYTHACESCKQPIGCDSKDLSYKDRHWHEGCFKCATCERSLADKAFSARDEKLLCTECHANHYSAKCAGISKLFSPVGTRKMEFRGSSWHETCFGCARCQQPIGSKSFVPREKDQYCVPCYEKQFAQHCTLCKK-VGGEGG 182          

HSP 3 Score: 85.8853 bits (211), Expect = 1.362e-19
Identity = 49/169 (28.99%), Postives = 76/169 (44.97%), Query Frame = 2
Query:  662 FKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEH-HPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIG-CDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAG 1162
            + C  C E L+   Y      PYCVR Y  L    C +C + I  +    + +  H H   F C +C+ SL    +  +D++ LC  C+ + Y+  C   S       ++ + F+   WHE CF C  C   +  + F  ++ + YC  CY+ +FA  C  C KV   G
Sbjct:   13 YDCHYCKESLLGKKYVLREENPYCVRCYETLYTHACESCKQPIGCDSKDLSYKDRHWHEGCFKCATCERSLADKAFSARDEKLLCTECHANHYSAKCAGISKLFSPVGTRKMEFRGSSWHETCFGCARCQQPIGSKSFVPREKDQYCVPCYEKQFAQHCTLCKKVGGEG 181          

HSP 4 Score: 82.4185 bits (202), Expect = 1.873e-18
Identity = 46/151 (30.46%), Postives = 73/151 (48.34%), Query Frame = 2
Query: 1208 FLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVI--RRGGVTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGELFAKKCSKCTKPITGFGGCKFISFEDRHWHSECFTCYKCNISLVGKGFLTNDDKIICPDC 1654
            + C  C++ +  K ++ RE++  CV CYE  Y   C  C   I      ++YK   WH+ CF C  C + LA   F++++EK  C EC+   ++ KC+  +K  +  G  K + F    WH  CF C +C   +  K F+  +    C  C
Sbjct:   13 YDCHYCKESLLGKKYVLREENPYCVRCYETLYTHACESCKQPIGCDSKDLSYKDRHWHEGCFKCATCERSLADKAFSARDEKLLCTECHANHYSAKCAGISKLFSPVGTRK-MEFRGSSWHETCFGCARCQQPIGSKSFVPREKDQYCVPC 162          

HSP 5 Score: 53.9138 bits (128), Expect = 1.405e-8
Identity = 32/107 (29.91%), Postives = 45/107 (42.06%), Query Frame = 2
Query:  647 WHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAME---QEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQC 958
            WH  CFKC  C+  L D  +     K  C   +A     +CA   +L F+   TR ME      H   F C  C   +    ++ ++    C+ CYE Q+A  C  C
Sbjct:   69 WHEGCFKCATCERSLADKAFSARDEKLLCTECHANHYSAKCAGISKL-FSPVGTRKMEFRGSSWHETCFGCARCQQPIGSKSFVPREKDQYCVPCYEKQFAQHCTLC 174          
BLAST of Four and A half lim domains vs. Ensembl Sea Lamprey
Match: fhl5 (four and a half LIM domains 5 [Source:ZFIN;Acc:ZDB-GENE-040822-3])

HSP 1 Score: 187.578 bits (475), Expect = 6.013e-56
Identity = 85/171 (49.71%), Postives = 113/171 (66.08%), Query Frame = 2
Query:  842 FACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGGVT 1354
            + C  C  SL G +Y+L+++ P C+ CYE+ Y + C+ C   IGCDSKDLS+KDRHWHE CFKC  C  SL D+ F+ +D  L C++C+ N ++ +C         G RK E+RG  WHE CF C  C+QPIG+KSF+PRE+D  CVPCYE+++AQ CT C  V   GG T
Sbjct:    6 YDCHYCKESLLGKKYVLREENPYCVRCYETLYTHACESCKQPIGCDSKDLSYKDRHWHEGCFKCATCERSLADKAFSARDEKLLCTECHANHYSAKCAA--NPNPVGTRKMEFRGSSWHETCFGCARCQQPIGSKSFVPREKDQYCVPCYEKQFAQHCTLCKKVGGEGGPT 174          

HSP 2 Score: 108.612 bits (270), Expect = 1.932e-27
Identity = 49/168 (29.17%), Postives = 84/168 (50.00%), Query Frame = 2
Query: 1025 FKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGGVTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGELFAKKCSKCTKPITGFGG 1528
            + C  C  SL+ + +  ++ N YC  CY+  +   C+ C +      +   Y+ + WHE CF C  C + +  K+F  R++ ++C  C+   Y+ KC      +    + ++GS WH+ CF C  C + +    F  +E+  YC  CY + FA+ C+ C K + G GG
Sbjct:    6 YDCHYCKESLLGKKYVLREENPYCVRCYETLYTHACESCKQPIGCDSKDLSYKDRHWHEGCFKCATCERSLADKAFSARDEKLLCTECHANHYSAKCAANPNPVGTRKMEFRGSSWHETCFGCARCQQPIGSKSFVPREKDQYCVPCYEKQFAQHCTLCKK-VGGEGG 172          

HSP 3 Score: 88.1965 bits (217), Expect = 2.087e-20
Identity = 49/168 (29.17%), Postives = 77/168 (45.83%), Query Frame = 2
Query:  662 FKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEH-HPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAG 1162
            + C  C E L+   Y      PYCVR Y  L    C +C + I  +    + +  H H   F C +C+ SL    +  +D++ LC  C+ + Y+  C      +G  ++ + F+   WHE CF C  C   +  + F  ++ + YC  CY+ +FA  C  C KV   G
Sbjct:    6 YDCHYCKESLLGKKYVLREENPYCVRCYETLYTHACESCKQPIGCDSKDLSYKDRHWHEGCFKCATCERSLADKAFSARDEKLLCTECHANHYSAKCAANPNPVG--TRKMEFRGSSWHETCFGCARCQQPIGSKSFVPREKDQYCVPCYEKQFAQHCTLCKKVGGEG 171          

HSP 4 Score: 83.5741 bits (205), Expect = 9.061e-19
Identity = 45/151 (29.80%), Postives = 72/151 (47.68%), Query Frame = 2
Query: 1208 FLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVI--RRGGVTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGELFAKKCSKCTKPITGFGGCKFISFEDRHWHSECFTCYKCNISLVGKGFLTNDDKIICPDC 1654
            + C  C++ +  K ++ RE++  CV CYE  Y   C  C   I      ++YK   WH+ CF C  C + LA   F++++EK  C EC+   ++ KC+    P+    G + + F    WH  CF C +C   +  K F+  +    C  C
Sbjct:    6 YDCHYCKESLLGKKYVLREENPYCVRCYETLYTHACESCKQPIGCDSKDLSYKDRHWHEGCFKCATCERSLADKAFSARDEKLLCTECHANHYSAKCAANPNPV----GTRKMEFRGSSWHETCFGCARCQQPIGSKSFVPREKDQYCVPC 152          

HSP 5 Score: 48.1358 bits (113), Expect = 1.215e-6
Identity = 30/107 (28.04%), Postives = 42/107 (39.25%), Query Frame = 2
Query:  647 WHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAME---QEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQC 958
            WH  CFKC  C+  L D  +     K  C   +A     +CA     + T    R ME      H   F C  C   +    ++ ++    C+ CYE Q+A  C  C
Sbjct:   62 WHEGCFKCATCERSLADKAFSARDEKLLCTECHANHYSAKCAANPNPVGT----RKMEFRGSSWHETCFGCARCQQPIGSKSFVPREKDQYCVPCYEKQFAQHCTLC 164          
BLAST of Four and A half lim domains vs. Ensembl Sea Lamprey
Match: fhl3b (four and a half LIM domains 3b [Source:ZFIN;Acc:ZDB-GENE-030131-8356])

HSP 1 Score: 181.8 bits (460), Expect = 2.537e-53
Identity = 86/227 (37.89%), Postives = 125/227 (55.07%), Query Frame = 2
Query:  989 LSFKDRHWHEKCFKCFECSSSL-VDQPFATKDNNLYCSDCYDN---KFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGGVTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGELFAKKCSKCTKPITGFGGCKFISFEDRHWHSECFTCYKCNISLVGKGFLTNDDKIICPDCG 1657
            LS  + HWHE CFKC EC++ +     +  +   + C  C  +        C  C +  + G+ K  Y+G+ WHE CF C  C + IGTKSF+P   +I CV C E+K A +C  C   +   GV YK   +H+EC  C  C+  LAG+   ++ E  YC  C+ + ++KKC+ C KPIT   G KF++ +   WH+ECF C +C +++ GKGF+   D I C DC 
Sbjct:    2 LSLDNLHWHEGCFKCSECATPIGAATEYLLEGKEIVCKTCATSPAGDMGDSCVSCKRGIREGVAKVAYKGRTWHERCFACARCMETIGTKSFVPHGDEIYCVSCNEKKTATRCFTCHKPVTEKGVVYKEHTYHRECLVCIGCNTPLAGMNMCTRGELLYCEPCFEKKYSKKCTSCRKPITSAAGAKFLTHDSLEWHTECFKCKRCGLNMAGKGFVARGDDIFCGDCA 228          

HSP 2 Score: 120.168 bits (300), Expect = 4.378e-31
Identity = 65/224 (29.02%), Postives = 105/224 (46.88%), Query Frame = 2
Query:  830 HPAHFACKSCDNSL-TGHRYILKDDQPLCIGCYESQYANI---CQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGG----VTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGEL 1477
            H   F C  C   +     Y+L+  + +C  C  S   ++   C  C   I      +++K R WHE+CF C  C  ++  + F    + +YC  C + K ATRC  CHK      +   Y+   +H EC +C+ C  P+   +   R + + C PC+E+KY++KCT C   I        +T+    WH ECF C  C   +AG  F ++ +  +C +C  ++
Sbjct:   10 HEGCFKCSECATPIGAATEYLLEGKEIVCKTCATSPAGDMGDSCVSCKRGIREGVAKVAYKGRTWHERCFACARCMETIGTKSFVPHGDEIYCVSCNEKKTATRCFTCHKPVTE--KGVVYKEHTYHRECLVCIGCNTPLAGMNMCTRGELLYCEPCFEKKYSKKCTSCRKPITSAAGAKFLTHDSLEWHTECFKCKRCGLNMAGKGFVARGDDIFCGDCANQI 231          

HSP 3 Score: 90.5077 bits (223), Expect = 8.271e-21
Identity = 59/227 (25.99%), Postives = 93/227 (40.97%), Query Frame = 2
Query:  638 QMSWHPRCFKCTECDEVLVDYIYCWYSNKPY----CVRHYAQLIRPRCATCDELIFTEEYTRAME-QEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVF--KAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEE 1297
             + WH  CFKC+EC   +          K      C    A  +   C +C   I       A + +  H   FAC  C  ++    ++   D+  C+ C E + A  C  C   +    K + +K+  +H +C  C  C++ L      T+   LYC  C++ K++ +C  C K     AG +   +   +WH ECF C  C   +  K F+ R  DI C  C  +
Sbjct:    6 NLHWHEGCFKCSECATPIGAATEYLLEGKEIVCKTCATSPAGDMGDSCVSCKRGIREGVAKVAYKGRTWHERCFACARCMETIGTKSFVPHGDEIYCVSCNEKKTATRCFTCHKPV--TEKGVVYKEHTYHRECLVCIGCNTPLAGMNMCTRGELLYCEPCFEKKYSKKCTSCRKPITSAAGAKFLTHDSLEWHTECFKCKRCGLNMAGKGFVARGDDIFCGDCANQ 230          

HSP 4 Score: 82.8037 bits (203), Expect = 3.620e-18
Identity = 49/183 (26.78%), Postives = 80/183 (43.72%), Query Frame = 2
Query:  569 CTQCQSSIQAGQLAVRVEHAANTQMSWHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRI--GCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYD 1111
            C  C+  I+ G     V   A    +WH RCF C  C E +    +  + ++ YCV    +    RC TC + + TE+     E  +H     C  C+  L G     + +   C  C+E +Y+  C  C   I     +K L+     WH +CFKC  C  ++  + F  + ++++C DC +
Sbjct:   53 CVSCKRGIREG-----VAKVAYKGRTWHERCFACARCMETIGTKSFVPHGDEIYCVSCNEKKTATRCFTCHKPV-TEKGVVYKEHTYHRECLVCIGCNTPLAGMNMCTRGELLYCEPCFEKKYSKKCTSCRKPITSAAGAKFLTHDSLEWHTECFKCKRCGLNMAGKGFVARGDDIFCGDCAN 229          
BLAST of Four and A half lim domains vs. Ensembl Sea Lamprey
Match: tes (testis derived transcript (3 LIM domains) [Source:ZFIN;Acc:ZDB-GENE-040718-59])

HSP 1 Score: 153.68 bits (387), Expect = 2.290e-41
Identity = 118/380 (31.05%), Postives = 165/380 (43.42%), Query Frame = 2
Query:  152 RKTCLGCDCSVDRHDITDESPLPILEEMKLADKPYYNLF------MESLKMARKYGLSWLPIG----LQASEVEQFTSIVGGNIASR----------------AGEKLRKQKLRRQIPVHDRCVEKFSHLETPTERQEAEKFLQFRNNQDLGVGHVYRL------------------------DMAALP-----CTQCQSSIQAGQLAVRVEHAANTQMSWHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDE----LIFTEEYTRAMEQEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEK--CFKCFECSSSLVDQPFATKDNNLYCS-DC 1105
            RK C  C C ++ HDI  E            D  Y  +       ME+  + ++  LS   I     L  +          GN  +R                 G   R+++L RQ+P HD+   +   L +  E ++ E+F++    + LGVG V                           D AA       C +C+  +Q G  AV  E A +  + WHP CF C+ CDE+LVD +Y W   K YC RHY    RPRC  CDE    LIF++EYT+A EQ  H  HF C  CD  L G  Y+++ D+P+C  CY  +YA  CQ C G I  +++ ++  +  WH    CF C  C   LV   F      ++CS DC
Sbjct:    1 RKICRNCKCGLEEHDIQMEEEAQRKVGRLFEDSRYAGVADRIRSDMETRLLEQQPRLSNHLIARKNRLGGTLTVSTAEPADGNRTARRYIELLPRDKQPIEGSQGAMYRRRQLARQLPEHDQDPSRCHDL-SAAEVKQMEEFVKKYKAEALGVGDVMLPHQVGGSAAFAQAAGEASAGERGVGDGAAQAQRDYRCNRCKQPMQQGDPAVFAERAGSEHL-WHPGCFCCSACDEILVDLVYFWKRGKLYCGRHYCDTERPRCGGCDEVWTQLIFSKEYTQAEEQNWHLKHFCCFECDCVLAGEIYVMEQDKPVCKPCYMKKYARSCQSCQGSIEPEAQRVTLGEFSWHADPTCFLCSCCGIPLVGLRFLPHQAMIFCSADC 378          

HSP 2 Score: 81.2629 bits (199), Expect = 1.069e-16
Identity = 53/165 (32.12%), Postives = 77/165 (46.67%), Query Frame = 2
Query: 1010 WHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEY---RGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGG--VTYKGSPWHKE--CFTCTHCSKQLAGIKFTSKEEKPYC-AECYGELF 1480
            WH  CF C  C   LVD  +  K   LYC   Y +    RC GC +V+   +   EY     + WH + F C +C   +  + ++  +   VC PCY +KYA+ C  C G I      VT     WH +  CF C+ C   L G++F   +   +C A+C G++ 
Sbjct:  219 WHPGCFCCSACDEILVDLVYFWKRGKLYCGRHYCDTERPRCGGCDEVWTQLIFSKEYTQAEEQNWHLKHFCCFECDCVLAGEIYVMEQDKPVCKPCYMKKYARSCQSCQGSIEPEAQRVTLGEFSWHADPTCFLCSCCGIPLVGLRFLPHQAMIFCSADCRGKVV 383          

HSP 3 Score: 58.151 bits (139), Expect = 2.524e-9
Identity = 42/158 (26.58%), Postives = 66/158 (41.77%), Query Frame = 2
Query: 1193 WHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGV-----IRRGGVTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGELFAKKCSKCTKPITGFGGCKFISFEDRHWHSE--CFTCYKCNISLVGKGFLTNDDKIIC 1645
            WH  CF C  C + +    +  +   + C   Y +    +C  C  V       +     +   WH + F C  C   LAG  +  +++KP C  CY + +A+ C  C   I      + ++  +  WH++  CF C  C I LVG  FL +   I C
Sbjct:  219 WHPGCFCCSACDEILVDLVYFWKRGKLYCGRHYCDTERPRCGGCDEVWTQLIFSKEYTQAEEQNWHLKHFCCFECDCVLAGEIYVMEQDKPVCKPCYMKKYARSCQSCQGSIEPEA--QRVTLGEFSWHADPTCFLCSCCGIPLVGLRFLPHQAMIFC 374          
BLAST of Four and A half lim domains vs. Ensembl Sea Lamprey
Match: PXN (paxillin [Source:HGNC Symbol;Acc:HGNC:9718])

HSP 1 Score: 118.242 bits (295), Expect = 1.824e-30
Identity = 70/229 (30.57%), Postives = 102/229 (44.54%), Query Frame = 2
Query:  800 EYTRAMEQEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKY-EYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGGVTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGELFA 1483
            +   AM +  HP HF C  C   +    +  KD QP C   Y S ++  C  C+  +  + + ++  DR WH + F C +C     ++ F  +D   YC   Y   FA +C+GC    +A M+ Y       WH ECF+C +C  P    SF   E    C   Y E+    C+ C   I    ++     +H E F C  C KQL    F  + +KPYC  C+ +LF 
Sbjct:    1 QVVTAMGRTWHPEHFVCVHCQVEIGSRNFFEKDGQPYCEEDYHSLFSPRCAYCNEAVMDNQRVVTALDRTWHPEHFFCAQCGRPFGEEGFHERDGKPYCRQDYYGMFAPKCNGCS---RAIMQNYLSALNTVWHPECFICRECFTPFINGSFFEHEGQPYCEVHYHERRGSLCSGCQKPITGRCISAMAKKFHPEHFVCAFCLKQLNKGTFKEQNDKPYCQPCFIKLFG 226          

HSP 2 Score: 110.538 bits (275), Expect = 8.734e-28
Identity = 69/217 (31.80%), Postives = 91/217 (41.94%), Query Frame = 2
Query: 1004 RHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGGVTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGELFAKKCSKCTKPITGFGGCKFISFEDRHWHSECFTCYKCNISLVGKGFLTNDDKIICPDC 1654
            R WH + F C  C   +  + F  KD   YC + Y + F+ RC  C++      R      + WH E F C  C +P G + F  R+    C   Y   +A KC  C   I +  ++   + WH ECF C  C        F   E +PYC   Y E     CS C KPITG    + IS   + +H E F C  C   L    F   +DK  C  C
Sbjct:    8 RTWHPEHFVCVHCQVEIGSRNFFEKDGQPYCEEDYHSLFSPRCAYCNEAVMDNQRVVTALDRTWHPEHFFCAQCGRPFGEEGFHERDGKPYCRQDYYGMFAPKCNGCSRAIMQNYLSALNTVWHPECFICRECFTPFINGSFFEHEGQPYCEVHYHERRGSLCSGCQKPITG----RCISAMAKKFHPEHFVCAFCLKQLNKGTFKEQNDKPYCQPC 220          

HSP 3 Score: 99.3673 bits (246), Expect = 6.282e-24
Identity = 61/217 (28.11%), Postives = 91/217 (41.94%), Query Frame = 2
Query:  644 SWHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIF-TEEYTRAMEQEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCY 1291
            +WHP  F C  C   +    +     +PYC   Y  L  PRCA C+E +   +    A+++  HP HF C  C        +  +D +P C   Y   +A  C  CS  I      LS  +  WH +CF C EC +  ++  F   +   YC   Y  +  + C GC K      R      K++H E F+C  C + +   +F  +     C PC+
Sbjct:    9 TWHPEHFVCVHCQVEIGSRNFFEKDGQPYCEEDYHSLFSPRCAYCNEAVMDNQRVVTALDRTWHPEHFFCAQCGRPFGEEGFHERDGKPYCRQDYYGMFAPKCNGCSRAI--MQNYLSALNTVWHPECFICRECFTPFINGSFFEHEGQPYCEVHYHERRGSLCSGCQKPITG--RCISAMAKKFHPEHFVCAFCLKQLNKGTFKEQNDKPYCQPCF 221          

HSP 4 Score: 65.855 bits (159), Expect = 2.069e-12
Identity = 34/99 (34.34%), Postives = 48/99 (48.48%), Query Frame = 2
Query: 1349 VTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGELFAKKCSKCTKPITGFGGCKFISFEDRHWHSECFTCYKCNISLVGKGFLTNDDKIIC 1645
            VT  G  WH E F C HC  ++    F  K+ +PYC E Y  LF+ +C+ C + +      + ++  DR WH E F C +C      +GF   D K  C
Sbjct:    3 VTAMGRTWHPEHFVCVHCQVEIGSRNFFEKDGQPYCEEDYHSLFSPRCAYCNEAVM--DNQRVVTALDRTWHPEHFFCAQCGRPFGEEGFHERDGKPYC 99          
BLAST of Four and A half lim domains vs. Ensembl Yeast
Match: LRG1 (GTPase-activating protein (GAP); contains Rho1p-specific GAP activity, interacting with activated forms of Rho1p; functions along with Sac7p as a negative regulator of the Pkc1p-mediated cell wall integrity signaling pathway; negative regulator of cell wall 1,3-beta-glucan biosynthesis; required for efficient cell fusion; contains a RhoGAP domain and three Lin-11-Isl1-Mec-3 (LIM) domains [Source:SGD;Acc:S000002399])

HSP 1 Score: 50.447 bits (119), Expect = 7.236e-7
Identity = 44/145 (30.34%), Postives = 69/145 (47.59%), Query Frame = 2
Query: 1184 GKQWHEECFLCVDCRQPIGTKSFIPREQD------IVCVPCYEEKYAQKCTKCVGVIRRGGVTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGELFAKKCSKCTKPITGFGGCKFISF---EDRH-WHSECFTCYK 1588
            GK +HE CF C DC++P+  K F P + D      ++C   Y  ++   C  C   +R    T  G  + +E F+CT C+      K      + YC   + + F+K+C  C  PI+     ++I F   E+ H WH EC+  +K
Sbjct:   50 GKYYHESCFTCQDCQKPLKPKYF-PYQVDKTSESILLCQYDYFRRHNLLCHVCDTPLRGLYYTAFGYRYDEEHFSCTICATPCGVKKCFMYGNQLYCKYHFLKYFSKRCKGCEFPISD----QYIEFPKGEEIHCWHPECYGIHK 189          
BLAST of Four and A half lim domains vs. Ensembl Nematostella
Match: LIMPET (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFX6])

HSP 1 Score: 362.844 bits (930), Expect = 5.648e-118
Identity = 195/529 (36.86%), Postives = 292/529 (55.20%), Query Frame = 2
Query:   86 QDI-GTPCLDCVDKCRGFKIHGWRKTCLGCDCSVDRHDI-TDESPLPILEE-MKLADKPYYNLFMESLKMARKYGLSWLPIGLQASEVEQFTSIVGGNIASRA---GEKLRKQKLRRQIPVHDRCVEKFSHLETPTERQEAEKFLQFRNNQDLGVGHVYRLDMAALPCTQCQSSIQAGQLAVRVEHAANTQMSWHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGGVTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGELFAKKCSKCTKPITGFGGCKFISFEDRHWHSECFTCYKCNISLVGKGFLTNDDKIICPDC 1654
            +DI G  CL C + CRGF +H WRK C  C C  + H + T+ +     EE M + ++    L    L+ A   G  W+P GL + E++ + S++  +   +    G + R ++L  QIP+ D   +    L T  ++   + F + R    LGVG V         C +C   +  G +A+  E        WH +CF C E  E+LVD IYC   ++ YC RH+ + ++PRCA C+ELI+  EY++A+E+  HP H  C  CD SL+  +++  +  P C  CY+  +AN C+ C   IG  SKD+  + +HWHE CFKC +CS  L+++ F  KD  L C  C     +  C  C+  F  G +K  Y+ K +H++CF+C +C+QPIG+K FI R++  +C  C++ K+A+ C KC  VI+   V + GS +H ECFTC HC K LAG  FT +E +  C  CY E +AK+C  C   I   G  KF++++++++H ECFTC KCN  L G+ F   D + IC  C
Sbjct:   27 EDIEGNKCLQCGNICRGFSVHPWRKFCNSCKCPHELHVLSTNNNDQNTPEERMGVEEEDPPMLQGSHLQQAMMEGYEWVPRGLTSEEIQIYMSLLPEDKIPKLKSLGAQHRTKQLSLQIPLQDFSSKHCKKL-TLDQKMAMDDFCEKRIKTALGVGAVRACMAQPSTCKRCNGPVNPGDMALFAERLG-PDSCWHVKCFTCEEDGELLVDLIYCSKDDEIYCCRHWGEKLKPRCAGCEELIYVGEYSQALEKNWHPGHLCCSYCDESLSNQKFVTVEGSPSCFRCYDENFANRCEACGEPIGPGSKDVDVRSKHWHEGCFKCSQCSKQLMNEGFTLKDEKLICHGCRGINPSKVCAACNGDFAPGEKKVGYQSKTFHDKCFICDECKQPIGSKQFIRRDERRLCNNCFDSKFAKVCVKCNQVIKTSSVQHAGSTYHSECFTCHHCDKPLAGSPFTKQEGRNVCQNCYRERYAKRCGACHNLIE--GNTKFVAYDEKYFHRECFTCCKCNKPLAGEKFRIRDGEKICLPC 551          

HSP 2 Score: 116.701 bits (291), Expect = 1.951e-27
Identity = 68/246 (27.64%), Postives = 113/246 (45.93%), Query Frame = 2
Query:  569 CTQCQSSIQAGQLAVRVEHAANTQMSWHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPR--CATCD-ELIFTEEYTRAMEQEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEE 1297
            C  C   I  G   V V         WH  CFKC++C + L++  +     K  C  H  + I P   CA C+ +    E+      +  H   F C  C   +   ++I +D++ LC  C++S++A +C +C+  I   S  +      +H +CF C  C   L   PF  ++    C +CY  ++A RC  CH + +   +   Y  K +H ECF C  C +P+  + F  R+ + +C+PC ++
Sbjct:  318 CEACGEPIGPGSKDVDVR-----SKHWHEGCFKCSQCSKQLMNEGFTLKDEKLIC--HGCRGINPSKVCAACNGDFAPGEKKVGYQSKTFHDKCFICDECKQPIGSKQFIRRDERRLCNNCFDSKFAKVCVKCNQVIKTSS--VQHAGSTYHSECFTCHHCDKPLAGSPFTKQEGRNVCQNCYRERYAKRCGACHNLIEGNTKFVAYDEKYFHRECFTCCKCNKPLAGEKFRIRDGEKICLPCDDD 554          
BLAST of Four and A half lim domains vs. Ensembl Nematostella
Match: EDO41100 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5D2])

HSP 1 Score: 355.91 bits (912), Expect = 1.460e-115
Identity = 196/539 (36.36%), Postives = 291/539 (53.99%), Query Frame = 2
Query:   74 MALKQDI--GTPCLDCVDKCRGFKIHGWRKTCLGCDCSVDRHDITDES--PLPILEEMKLADKPYYNLFMESLKMARKYGLSWLPIGLQASEVEQFTSIVGGN---IASRAGEKLRKQKLRRQIPVHDRCVEKFSHLETPTERQEAEKFLQFRNNQDLGVGH-VYRLDMAALP-CTQCQSSIQAGQLAVRVEHAANTQMSWHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKD-RHWHEKCFKCFECSSSLVDQ-PFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGGVTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGELFAKKCSKCTKPITGFGGCKFISFEDRHWHSECFTCYKCNISLVGKGFLTNDDKIICPDCG 1657
            M L QDI  G PCL C D+C GF +H W+K C  C C  + HDI +E+   + I   +   D P     +       KY   W P GL  S+VE +   +      I    G K  + ++  Q+PV DR  EK S           E F+QF ++ D   G  V ++       C +C   I   + AV  E+    + S+HP CF C  C+E+LV+  Y  +++K YC RH+A+L + RC  CDELIFT EYT AM +  H  HF C++CD+S+TG ++I++ D+P+C  C++  YA+ C+ C  +IG +S+D+S  D RHWH+KCF C  C   L  +    + +    C+ CY   +   C  C ++  +G  + EY G  WHE CF C +C + IGT  F+P++    C  CY+ K++++C  C   +  GGV Y G  WHK CF+C  C + LA   F+ ++   YC ECYG+ +AK+C  C K I G    ++ + E+ ++H ECF C +C  SL  +GF+   D+++C DC 
Sbjct:    1 MILLQDIDEGKPCLKCKDRCPGFSLHVWKKACQYCKCPREDHDIQNEANETMDINTRINGIDLPPPPKVISG--GFPKY--LWTPSGLSQSQVELYMKELPPQKVPIKDSPGSKYYRAQMAYQLPVQDRDPEKLSTFSA----AHRESFMQFNSSADNARGEGVVKVPFGRRQRCARCSHPILRSEPAVVAENIG-AEASFHPGCFTCETCNELLVELTYFQHADKVYCGRHFAELQKSRCGGCDELIFTGEYTVAMNKNWHLGHFQCQTCDHSITGRQFIVRGDKPVCTDCFKDSYAHECEACHQKIGPESRDISSDDDRHWHDKCFICDICRRPLKSEGSLHSTETKSCCNKCYVANYQKECCACGQIIDSGASRLEYSGNFWHENCFRCANCGEAIGTSGFVPKDDTFFCPGCYQSKFSKRCASCGEPLLEGGVLYNGETWHKACFSCYFCHRSLASAAFSVRDGCRYCMECYGKFYAKQCEICLKAIVGG---EYYTLEESNFHKECFMCSRCGRSLASEGFVREGDELLCGDCA 527          

HSP 2 Score: 75.8702 bits (185), Expect = 2.051e-14
Identity = 52/181 (28.73%), Postives = 81/181 (44.75%), Query Frame = 2
Query:  569 CTQCQSSIQAGQLAVRVEHAANTQMSWHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYD 1111
            C  C   I +G  A R+E++ N    WH  CF+C  C E +    +    +  +C   Y      RCA+C E +  E       +  H A F+C  C  SL    + ++D    C+ CY   YA  C+ C   I    +  + ++ ++H++CF C  C  SL  + F  + + L C DC D
Sbjct:  355 CCACGQIIDSG--ASRLEYSGNF---WHENCFRCANCGEAIGTSGFVPKDDTFFCPGCYQSKFSKRCASCGEPLL-EGGVLYNGETWHKACFSCYFCHRSLASAAFSVRDGCRYCMECYGKFYAKQCEICLKAI-VGGEYYTLEESNFHKECFMCSRCGRSLASEGFVREGDELLCGDCAD 528          
BLAST of Four and A half lim domains vs. Ensembl Nematostella
Match: EDO49801 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFY0])

HSP 1 Score: 209.149 bits (531), Expect = 2.526e-61
Identity = 120/364 (32.97%), Postives = 182/364 (50.00%), Query Frame = 2
Query:   68 Y*MALKQDIGTPCLDCVDKCRGFKIHGWRKTCLGCDCSVDRHDITD------ESPLPILEEMKLAD-KPYYNLFMESLKMARK---YGLSWLPIGLQASEVEQFTSIVGGN---IASRAGEKLRKQKLRRQIPVHDRCVEKFSHLETPTERQEAEKFLQFRNNQDLGVGHVYRLDMAA--LPCTQCQSSIQAGQLAVRVEHAANTQMSWHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWH--EKCFKCFECSSSLVDQPFATKDNNLYCS-DC 1105
            Y +  +++ G  CL C DKC G  +H WRK C  C C  + HD+ +      E    + ++  +A  + Y+N    +    +       +W+P G+    + ++   +      I    G K R+ ++  Q+P+HD       +L +  ERQ+ E F   RN   LGVG +     AA    C +C   +  G++AV    A   +  WHP CF CT C+ +LVD IY +     YC RHYA+  +PRCA CDELIF+E YT+A ++  H  HF C  CD  L G  Y+ +  QP C+ CY+  YA  C  C   I  D+K +  + + WH   +CF C +C+  ++ + F    NN++CS DC
Sbjct:   19 YKLGHERNEGAKCLKCGDKCEGLDLHFWRKICKNCKCKQEDHDLYEDIANEHEVKSRLFKDSNVAHLRDYFNKLTAANDQPKTEFVKKFTWVPPGMNQGILVKYMESLPKELVPIVGSEGAKYRRAQMVYQLPIHDHDPNYCDNL-SDAERQKMEDFCAMRNQDALGVGDIREKTQAASKWNCFRCSKPVMTGEVAVFASRAGEDK-CWHPGCFVCTVCNNLLVDLIYFYKDGVIYCGRHYAEQFKPRCAACDELIFSETYTQAEDRNWHQRHFCCLECDRDLGGQLYVARGGQPHCLECYDKYYAKHCMSCKKNIAADAKRIEHQGQFWHATSECFHCAKCNKDMLGKQFLKTKNNIFCSVDC 380          

HSP 2 Score: 88.9669 bits (219), Expect = 5.114e-19
Identity = 52/160 (32.50%), Postives = 77/160 (48.12%), Query Frame = 2
Query: 1193 WHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGGVTY-KGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGELFAKKCSKCTKPITGFGGCKFISFEDRHWH--SECFTCYKCNISLVGKGFLTNDDKIICP-DCGR 1660
            WH  CF+C  C   +    +  ++  I C   Y E++  +C  C  +I     T  +   WH+  F C  C + L G  + ++  +P+C ECY + +AK C  C K I      K I  + + WH  SECF C KCN  ++GK FL   + I C  DC +
Sbjct:  225 WHPGCFVCTVCNNLLVDLIYFYKDGVIYCGRHYAEQFKPRCAACDELIFSETYTQAEDRNWHQRHFCCLECDRDLGGQLYVARGGQPHCLECYDKYYAKHCMSCKKNIA--ADAKRIEHQGQFWHATSECFHCAKCNKDMLGKQFLKTKNNIFCSVDCAK 382          
BLAST of Four and A half lim domains vs. Ensembl Nematostella
Match: EDO49798 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFX7])

HSP 1 Score: 194.512 bits (493), Expect = 3.407e-56
Identity = 115/356 (32.30%), Postives = 171/356 (48.03%), Query Frame = 2
Query:   86 QDIGTPCLDCVDKCRGFKIHGWRKTCLGCDCSVDRHDITDESPLPILEEMKLADKPYYNLFMESLKMARKYG-----------LSWLPIGLQASEVEQFTSIVGGN---IASRAGEKLRKQKLRRQIPVHDRCVEKFSHLETPTERQEAEKFLQFRNNQDLGVGHVYRL-DMA-ALPCTQCQSSIQAGQLAVRVEHAANTQMSWHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWH--EKCFKCFECSSSLVDQPFATKDNNLYCS 1099
             D    C +C D C GF  H WRK C  C C  + H+I  +             +   N++M  +  A                +W+P GL   +V  + + +           GE+ R +++  Q+P HD    +F +  +  E++E   F+  R    LG G V ++ +M+    C +C   + AG +AV    A      WH  CF CT C E+LVD IY +  +K YC RH+A+ ++PRCA CDE+IF E+ T A +   H  HF C  CD  L G RY+++D++P C  C+ES YA  C  C   I  D+  ++   +HWH   +CF C  C  +L+  PF  K   +YCS
Sbjct:    7 DDGSKACNNCGDTCPGFSAHYWRKICRNCKCPREDHNIISDDA-----------RAGRNIYMADVHRASSLASDDDSGCALDEYAWVPPGLGPEQVHSYMNALPEEKVPYVDSIGERYRNRQIILQLPPHDN-EARFCNGLSEEEKRELCFFVALRKRDSLGRGVVKQVPEMSEGYSCKECGECVTAGSMAVYASRAGQ-HTCWHASCFICTTCKELLVDLIYFYKDSKVYCGRHHAETLKPRCAACDEIIFAEQCTEAEDSCWHVQHFCCFECDCPLGGMRYVMRDNKPYCCHCFESLYAEFCDSCGEPIEPDASQMAHNGQHWHATNECFSCCTCGKALLGLPFLPKSGEIYCS 349          

HSP 2 Score: 87.4261 bits (215), Expect = 1.256e-18
Identity = 56/183 (30.60%), Postives = 87/183 (47.54%), Query Frame = 2
Query: 1130 CDGCHKVFKAG-MRKYEYRGKQ---WHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGGVT-YKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGELFAKKCSKCTKPITGFGGCKFISFEDRHWHS--ECFTCYKCNISLVGKGFLTNDDKIIC-PDC 1654
            C  C +   AG M  Y  R  Q   WH  CF+C  C++ +    +  ++  + C   + E    +C  C  +I     T  + S WH + F C  C   L G+++  ++ KPYC  C+  L+A+ C  C +PI        ++   +HWH+  ECF+C  C  +L+G  FL    +I C PDC
Sbjct:  172 CKECGECVTAGSMAVYASRAGQHTCWHASCFICTTCKELLVDLIYFYKDSKVYCGRHHAETLKPRCAACDEIIFAEQCTEAEDSCWHVQHFCCFECDCPLGGMRYVMRDNKPYCCHCFESLYAEFCDSCGEPIEPDA--SQMAHNGQHWHATNECFSCCTCGKALLGLPFLPKSGEIYCSPDC 352          

HSP 3 Score: 82.0333 bits (201), Expect = 7.750e-17
Identity = 49/154 (31.82%), Postives = 70/154 (45.45%), Query Frame = 2
Query: 1010 WHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGG--VTYKGSPWH--KECFTCTHCSKQLAGIKFTSKEEKPYCA 1459
            WH  CF C  C   LVD  +  KD+ +YC   +      RC  C ++  A  +  E     WH + F C +C  P+G   ++ R+    C  C+E  YA+ C  C   I      + + G  WH   ECF+C  C K L G+ F  K  + YC+
Sbjct:  197 WHASCFICTTCKELLVDLIYFYKDSKVYCGRHHAETLKPRCAACDEIIFA-EQCTEAEDSCWHVQHFCCFECDCPLGGMRYVMRDNKPYCCHCFESLYAEFCDSCGEPIEPDASQMAHNGQHWHATNECFSCCTCGKALLGLPFLPKSGEIYCS 349          
BLAST of Four and A half lim domains vs. Ensembl Nematostella
Match: EDO41181 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S548])

HSP 1 Score: 121.709 bits (304), Expect = 5.190e-31
Identity = 80/240 (33.33%), Postives = 110/240 (45.83%), Query Frame = 2
Query:  767 CATCDELIFTEEYTRAMEQEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKY-EYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGGVTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGELFA 1483
            CA C++ I  +  T A+ +  HP HFAC +C+  L    +  +D +P C   Y   +A  C  C+G I  DS  ++  D+ WH + F C EC +   D  F  +D   +C + Y   FA RC GC +     M  Y       WH ECF+C +CRQP    SF   +    C   Y  K    C  C   I    +T     +H E F C  C KQL    F  + +KPYC  C+ +LF 
Sbjct:   26 CAACNKPIIGQVCT-ALGKTWHPEHFACVACEAPLGTQNFFERDGKPYCERDYHDTFAPRCAYCNGPI-LDSC-VTALDQTWHPEHFVCAECGNPFGDTGFHERDGKPFCREDYYAMFAPRCGGCGQPI---MDNYISALSAHWHAECFICTECRQPFPGGSFFDHDGRPYCEMHYHAKRGTLCYSCQKPITGRCITAMHRKFHPEHFVCAFCLKQLNKGTFKEQNDKPYCHPCFVKLFG 259          

HSP 2 Score: 108.227 bits (269), Expect = 2.248e-26
Identity = 55/154 (35.71%), Postives = 73/154 (47.40%), Query Frame = 2
Query: 1184 GKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGGVTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGELFAKKCSKCTKPITGFGGCKFISFEDRHWHSECFTCYKCNISLVGKGFLTNDDKIIC 1645
            GK WH E F CV C  P+GT++F  R+    C   Y + +A +C  C G I    VT     WH E F C  C        F  ++ KP+C E Y  +FA +C  C +PI       +IS    HWH+ECF C +C     G  F  +D +  C
Sbjct:   42 GKTWHPEHFACVACEAPLGTQNFFERDGKPYCERDYHDTFAPRCAYCNGPILDSCVTALDQTWHPEHFVCAECGNPFGDTGFHERDGKPFCREDYYAMFAPRCGGCGQPIMD----NYISALSAHWHAECFICTECRQPFPGGSFFDHDGRPYC 191          

HSP 3 Score: 103.99 bits (258), Expect = 7.087e-25
Identity = 67/216 (31.02%), Postives = 92/216 (42.59%), Query Frame = 2
Query: 1010 WHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCH-KVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGGVTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGELFAKKCSKCTKPITGFGGCKFISFEDRHWHSECFTCYKCNISLVGKGFLTNDDKIICPDC 1654
            WH + F C  C + L  Q F  +D   YC   Y + FA RC  C+  +  + +   +   + WH E F+C +C  P G   F  R+    C   Y   +A +C  C   I    ++   + WH ECF CT C +   G  F   + +PYC   Y       C  C KPITG    + I+   R +H E F C  C   L    F   +DK  C  C
Sbjct:   45 WHPEHFACVACEAPLGTQNFFERDGKPYCERDYHDTFAPRCAYCNGPILDSCVTALD---QTWHPEHFVCAECGNPFGDTGFHERDGKPFCREDYYAMFAPRCGGCGQPIMDNYISALSAHWHAECFICTECRQPFPGGSFFDHDGRPYCEMHYHAKRGTLCYSCQKPITG----RCITAMHRKFHPEHFVCAFCLKQLNKGTFKEQNDKPYCHPC 253          

HSP 4 Score: 101.679 bits (252), Expect = 4.340e-24
Identity = 66/221 (29.86%), Postives = 90/221 (40.72%), Query Frame = 2
Query:  644 SWHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYA 1306
            +WHP  F C  C+  L    +     KPYC R Y     PRCA C+  I     T A++Q  HP HF C  C N      +  +D +P C   Y + +A  C  C   I      +S    HWH +CF C EC        F   D   YC   Y  K  T C  C K      R      +++H E F+C  C + +   +F  +     C PC+ + + 
Sbjct:   44 TWHPEHFACVACEAPLGTQNFFERDGKPYCERDYHDTFAPRCAYCNGPILDSCVT-ALDQTWHPEHFVCAECGNPFGDTGFHERDGKPFCREDYYAMFAPRCGGCGQPI--MDNYISALSAHWHAECFICTECRQPFPGGSFFDHDGRPYCEMHYHAKRGTLCYSCQKPITG--RCITAMHRKFHPEHFVCAFCLKQLNKGTFKEQNDKPYCHPCFVKLFG 259          

HSP 5 Score: 60.8474 bits (146), Expect = 3.298e-10
Identity = 36/111 (32.43%), Postives = 45/111 (40.54%), Query Frame = 2
Query: 1313 CTKCVGVIRRGGVTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGELFAKKCSKCTKPITGFGGCKFISFEDRHWHSECFTCYKCNISLVGKGFLTNDDKIIC 1645
            C  C   I     T  G  WH E F C  C   L    F  ++ KPYC   Y + FA +C+ C  PI        ++  D+ WH E F C +C       GF   D K  C
Sbjct:   26 CAACNKPIIGQVCTALGKTWHPEHFACVACEAPLGTQNFFERDGKPYCERDYHDTFAPRCAYCNGPILD----SCVTALDQTWHPEHFVCAECGNPFGDTGFHERDGKPFC 132          
BLAST of Four and A half lim domains vs. Ensembl Medaka
Match: fhl2a (four and a half LIM domains protein 2 [Source:NCBI gene;Acc:101169645])

HSP 1 Score: 337.421 bits (864), Expect = 1.710e-111
Identity = 148/273 (54.21%), Postives = 202/273 (73.99%), Query Frame = 2
Query:  842 FACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGGVTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGELFAKKCSKCTKPITGFGGCKFISFEDRHWHSECFTCYKCNISLVGKGFLTNDDKIICPDCGR 1660
            + C  C  SL G +Y+L+++ P C+ CYES Y+N C++C   IGC+++DLS+KDRHWHE CFKCF+C  SLVD+PF+TKD  L C++CY N+++++C  C K    G RK E++G  WHE CF C  C+QPIGTKSFIP++    CVPCYE+++A +C  C   I  GGVTY+  PWHK+CF CT C +QL+G +FTSK++  YC  C+  L+AKKC+ CT PI+G GG K+ISFE+R WH++CF C KC++SLVG+GFLT  D I+CP+CG+
Sbjct:    5 YDCHYCKESLFGKKYVLREENPYCVKCYESLYSNTCEECKKPIGCNTRDLSYKDRHWHEDCFKCFQCKRSLVDKPFSTKDEQLLCTECYSNEYSSKCHECKKTIMPGSRKMEHKGHSWHETCFTCKRCQQPIGTKSFIPKDNHNYCVPCYEKQFAMQCVHCKKPITTGGVTYRDQPWHKDCFLCTSCKQQLSGQRFTSKDDFAYCLNCFCNLYAKKCASCTTPISGLGGSKYISFEERQWHNDCFNCKKCSVSLVGRGFLTERDDILCPECGK 277          

HSP 2 Score: 152.14 bits (383), Expect = 3.548e-41
Identity = 88/273 (32.23%), Postives = 127/273 (46.52%), Query Frame = 2
Query:  662 FKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEH-HPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGG----VTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAEC 1465
            + C  C E L    Y      PYCV+ Y  L    C  C + I       + +  H H   F C  C  SL    +  KD+Q LC  CY ++Y++ C +C   I   S+ +  K   WHE CF C  C   +  + F  KDN+ YC  CY+ +FA +C  C K    G     YR + WH++CFLC  C+Q +  + F  ++    C+ C+   YA+KC  C   I   G    ++++   WH +CF C  CS  L G  F ++ +   C EC
Sbjct:    5 YDCHYCKESLFGKKYVLREENPYCVKCYESLYSNTCEECKKPIGCNTRDLSYKDRHWHEDCFKCFQCKRSLVDKPFSTKDEQLLCTECYSNEYSSKCHECKKTIMPGSRKMEHKGHSWHETCFTCKRCQQPIGTKSFIPKDNHNYCVPCYEKQFAMQCVHCKKPITTG--GVTYRDQPWHKDCFLCTSCKQQLSGQRFTSKDDFAYCLNCFCNLYAKKCASCTTPISGLGGSKYISFEERQWHNDCFNCKKCSVSLVGRGFLTERDDILCPEC 275          

HSP 3 Score: 119.398 bits (298), Expect = 1.419e-29
Identity = 74/265 (27.92%), Postives = 113/265 (42.64%), Query Frame = 2
Query:  530 VGHVYRLDMAALPCTQCQSSIQAGQ-------LAVRVEHAANTQMSWHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAH---FACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFK--AGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPC 1288
             G  Y L      C +C  S+ +         +       +     WH  CFKC +C   LVD  +     +  C   Y+     +C  C + I     +R ME + H  H   F CK C   +    +I KD+   C+ CYE Q+A  C  C   I   +  ++++D+ WH+ CF C  C   L  Q F +KD+  YC +C+ N +A +C  C        G +   +  +QWH +CF C  C   +  + F+    DI+C  C
Sbjct:   15 FGKKYVLREENPYCVKCYESLYSNTCEECKKPIGCNTRDLSYKDRHWHEDCFKCFQCKRSLVDKPFSTKDEQLLCTECYSNEYSSKCHECKKTIMPG--SRKMEHKGHSWHETCFTCKRCQQPIGTKSFIPKDNHNYCVPCYEKQFAMQCVHCKKPI--TTGGVTYRDQPWHKDCFLCTSCKQQLSGQRFTSKDDFAYCLNCFCNLYAKKCASCTTPISGLGGSKYISFEERQWHNDCFNCKKCSVSLVGRGFLTERDDILCPEC 275          
BLAST of Four and A half lim domains vs. Ensembl Medaka
Match: fhl3a (four and a half LIM domains 3 [Source:NCBI gene;Acc:101174533])

HSP 1 Score: 336.265 bits (861), Expect = 2.615e-110
Identity = 150/284 (52.82%), Postives = 200/284 (70.42%), Query Frame = 2
Query:  806 TRAMEQEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGGVTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGELFAKKCSKCTKPITGFGGCKFISFEDRHWHSECFTCYKCNISLVGKGFLTNDDKIICPDCG 1657
            ++A+++      F C +C  SL G +YI  +D P CI CY+S ++N C +C   IG D+++L ++DRH+HE CF+CF C  SL D+PF ++DN L C+DCY N+F+++C  C K+   G RK EY G  WHE CF+C  C QPIG+KSFIP + +  CVPCYE+K+A +CT+C   + +GGVTY+  PWHKECF CT C  QLAG  FTS++E PYC +C+  L+AKKC  C KPITGFGG K+ISFEDR WH  CFTC +C++SLVG GF  N D+I+C DC 
Sbjct:   40 SQALKKTTMADRFDCDNCKESLYGRKYIQSNDSPYCIPCYDSLFSNTCDECKELIGHDARELFYEDRHYHEHCFRCFRCDRSLADEPFTSQDNALLCNDCYCNEFSSKCVACDKIVMPGTRKLEYAGSTWHEGCFICHSCEQPIGSKSFIPDKDEHYCVPCYEDKFAPRCTRCKKALSKGGVTYRDEPWHKECFVCTSCETQLAGQHFTSRDESPYCLKCFSSLYAKKCEACCKPITGFGGGKYISFEDRQWHQSCFTCSQCSVSLVGAGFFPNGDRILCRDCN 323          

HSP 2 Score: 154.836 bits (390), Expect = 1.067e-41
Identity = 87/277 (31.41%), Postives = 128/277 (46.21%), Query Frame = 2
Query:  662 FKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAH-FACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGG----VTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGEL 1477
            F C  C E L    Y   ++ PYC+  Y  L    C  C ELI  +      E  H+  H F C  CD SL    +  +D+  LC  CY +++++ C  C   +   ++ L +    WHE CF C  C   +  + F    +  YC  CY++KFA RC  C K    G     YR + WH+ECF+C  C   +  + F  R++   C+ C+   YA+KC  C   I   G    ++++   WH+ CFTC+ CS  L G  F    ++  C +C   L
Sbjct:   52 FDCDNCKESLYGRKYIQSNDSPYCIPCYDSLFSNTCDECKELIGHDARELFYEDRHYHEHCFRCFRCDRSLADEPFTSQDNALLCNDCYCNEFSSKCVACDKIVMPGTRKLEYAGSTWHEGCFICHSCEQPIGSKSFIPDKDEHYCVPCYEDKFAPRCTRCKKALSKG--GVTYRDEPWHKECFVCTSCETQLAGQHFTSRDESPYCLKCFSSLYAKKCEACCKPITGFGGGKYISFEDRQWHQSCFTCSQCSVSLVGAGFFPNGDRILCRDCNSNL 326          

HSP 3 Score: 113.62 bits (283), Expect = 3.617e-27
Identity = 62/219 (28.31%), Postives = 100/219 (45.66%), Query Frame = 2
Query:  647 WHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAME---QEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFK--AGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPC 1288
            +H  CF+C  CD  L D  +    N   C   Y      +C  CD+++     TR +E      H   F C SC+  +    +I   D+  C+ CYE ++A  C +C   +      ++++D  WH++CF C  C + L  Q F ++D + YC  C+ + +A +C+ C K      G +   +  +QWH+ CF C  C   +    F P    I+C  C
Sbjct:  108 YHEHCFRCFRCDRSLADEPFTSQDNALLCNDCYCNEFSSKCVACDKIVMPG--TRKLEYAGSTWHEGCFICHSCEQPIGSKSFIPDKDEHYCVPCYEDKFAPRCTRCKKALS--KGGVTYRDEPWHKECFVCTSCETQLAGQHFTSRDESPYCLKCFSSLYAKKCEACCKPITGFGGGKYISFEDRQWHQSCFTCSQCSVSLVGAGFFPNGDRILCRDC 322          

HSP 4 Score: 94.7449 bits (234), Expect = 7.490e-21
Identity = 59/184 (32.07%), Postives = 85/184 (46.20%), Query Frame = 2
Query:  569 CTQCQSSIQAGQLAVRVEHAANTQMSWHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGC--DSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDN 1114
            C  C   +  G    ++E+A +T   WH  CF C  C++ +    +    ++ YCV  Y     PRC  C + +     T   E  H    F C SC+  L G  +  +D+ P C+ C+ S YA  C+ C   I      K +SF+DR WH+ CF C +CS SLV   F    + + C DC  N
Sbjct:  148 CVACDKIVMPG--TRKLEYAGST---WHEGCFICHSCEQPIGSKSFIPDKDEHYCVPCYEDKFAPRCTRCKKALSKGGVTYRDEPWHKEC-FVCTSCETQLAGQHFTSRDESPYCLKCFSSLYAKKCEACCKPITGFGGGKYISFEDRQWHQSCFTCSQCSVSLVGAGFFPNGDRILCRDCNSN 325          
BLAST of Four and A half lim domains vs. Ensembl Medaka
Match: fhl5 (four and a half LIM domains protein 2-like [Source:NCBI gene;Acc:101156370])

HSP 1 Score: 332.028 bits (850), Expect = 2.537e-109
Identity = 150/273 (54.95%), Postives = 197/273 (72.16%), Query Frame = 2
Query:  842 FACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGGVTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGELFAKKCSKCTKPITGFGGCKFISFEDRHWHSECFTCYKCNISLVGKGFLTNDDKIICPDCGR 1660
            F C  C +SL G +YI+K+D   C  CYE+ +AN C++CS  IGC+SKDLS+KDRHWHE+CFKC +CS SL D+ FA +++ L C++CY   ++++C  C K    G RK EY+G  WHE CFLC  C+QP+GTKSFIP+E    CVPC+E+++A +C  C   I  GGVTY+  PWH+ECF C  C +QL+G +FTS+E  PYC EC+  L+AKKC  CTKPIT   G K+ISFE+R WHSECF C +C++SLVG+GFLT  D I+C +CGR
Sbjct:    7 FDCHYCKDSLLGKKYIMKEDTQYCTKCYENLFANCCEECSTPIGCNSKDLSYKDRHWHEQCFKCAKCSRSLADKAFAAREDLLLCTECYALDYSSKCITCKKTILPGSRKMEYKGNSWHETCFLCHRCQQPLGTKSFIPKENGYFCVPCFEKQFAYQCCACKKAITTGGVTYQDKPWHRECFLCIGCKRQLSGQRFTSRENYPYCLECFSNLYAKKCVGCTKPITSLAGAKYISFEERQWHSECFNCMQCSVSLVGRGFLTQRDDILCTECGR 279          

HSP 2 Score: 146.362 bits (368), Expect = 4.663e-39
Identity = 84/273 (30.77%), Postives = 121/273 (44.32%), Query Frame = 2
Query:  662 FKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEH-HPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGG----VTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAEC 1465
            F C  C + L+   Y    +  YC + Y  L    C  C   I       + +  H H   F C  C  SL    +  ++D  LC  CY   Y++ C  C   I   S+ + +K   WHE CF C  C   L  + F  K+N  +C  C++ +FA +C  C K    G     Y+ K WH ECFLC+ C++ +  + F  RE    C+ C+   YA+KC  C   I        ++++   WH ECF C  CS  L G  F ++ +   C EC
Sbjct:    7 FDCHYCKDSLLGKKYIMKEDTQYCTKCYENLFANCCEECSTPIGCNSKDLSYKDRHWHEQCFKCAKCSRSLADKAFAAREDLLLCTECYALDYSSKCITCKKTILPGSRKMEYKGNSWHETCFLCHRCQQPLGTKSFIPKENGYFCVPCFEKQFAYQCCACKKAITTG--GVTYQDKPWHRECFLCIGCKRQLSGQRFTSRENYPYCLECFSNLYAKKCVGCTKPITSLAGAKYISFEERQWHSECFNCMQCSVSLVGRGFLTQRDDILCTEC 277          

HSP 3 Score: 127.872 bits (320), Expect = 1.638e-32
Identity = 78/273 (28.57%), Postives = 125/273 (45.79%), Query Frame = 2
Query:  518 QDLGVGHVYRLDMAALPCTQCQSSIQAG-------QLAVRVEHAANTQMSWHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAH---FACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFK--AGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEK 1300
            +D  +G  Y +      CT+C  ++ A         +    +  +     WH +CFKC +C   L D  +    +   C   YA     +C TC + I     +R ME + +  H   F C  C   L    +I K++   C+ C+E Q+A  C  C   I   +  ++++D+ WH +CF C  C   L  Q F +++N  YC +C+ N +A +C GC K     AG +   +  +QWH ECF C+ C   +  + F+ +  DI+C  C  EK
Sbjct:   13 KDSLLGKKYIMKEDTQYCTKCYENLFANCCEECSTPIGCNSKDLSYKDRHWHEQCFKCAKCSRSLADKAFAAREDLLLCTECYALDYSSKCITCKKTILPG--SRKMEYKGNSWHETCFLCHRCQQPLGTKSFIPKENGYFCVPCFEKQFAYQCCACKKAI--TTGGVTYQDKPWHRECFLCIGCKRQLSGQRFTSRENYPYCLECFSNLYAKKCVGCTKPITSLAGAKYISFEERQWHSECFNCMQCSVSLVGRGFLTQRDDILCTECGREK 281          
BLAST of Four and A half lim domains vs. Ensembl Medaka
Match: fhl3a (four and a half LIM domains 3 [Source:NCBI gene;Acc:101174533])

HSP 1 Score: 332.028 bits (850), Expect = 2.696e-109
Identity = 149/272 (54.78%), Postives = 194/272 (71.32%), Query Frame = 2
Query:  842 FACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGGVTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGELFAKKCSKCTKPITGFGGCKFISFEDRHWHSECFTCYKCNISLVGKGFLTNDDKIICPDCG 1657
            F C +C  SL G +YI  +D P CI CY+S ++N C +C   IG D+++L ++DRH+HE CF+CF C  SL D+PF ++DN L C+DCY N+F+++C  C K+   G RK EY G  WHE CF+C  C QPIG+KSFIP + +  CVPCYE+K+A +CT+C   + +GGVTY+  PWHKECF CT C  QLAG  FTS++E PYC +C+  L+AKKC  C KPITGFGG K+ISFEDR WH  CFTC +C++SLVG GF  N D+I+C DC 
Sbjct:    5 FDCDNCKESLYGRKYIQSNDSPYCIPCYDSLFSNTCDECKELIGHDARELFYEDRHYHEHCFRCFRCDRSLADEPFTSQDNALLCNDCYCNEFSSKCVACDKIVMPGTRKLEYAGSTWHEGCFICHSCEQPIGSKSFIPDKDEHYCVPCYEDKFAPRCTRCKKALSKGGVTYRDEPWHKECFVCTSCETQLAGQHFTSRDESPYCLKCFSSLYAKKCEACCKPITGFGGGKYISFEDRQWHQSCFTCSQCSVSLVGAGFFPNGDRILCRDCN 276          

HSP 2 Score: 153.68 bits (387), Expect = 8.583e-42
Identity = 87/277 (31.41%), Postives = 128/277 (46.21%), Query Frame = 2
Query:  662 FKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAH-FACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGG----VTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGEL 1477
            F C  C E L    Y   ++ PYC+  Y  L    C  C ELI  +      E  H+  H F C  CD SL    +  +D+  LC  CY +++++ C  C   +   ++ L +    WHE CF C  C   +  + F    +  YC  CY++KFA RC  C K    G     YR + WH+ECF+C  C   +  + F  R++   C+ C+   YA+KC  C   I   G    ++++   WH+ CFTC+ CS  L G  F    ++  C +C   L
Sbjct:    5 FDCDNCKESLYGRKYIQSNDSPYCIPCYDSLFSNTCDECKELIGHDARELFYEDRHYHEHCFRCFRCDRSLADEPFTSQDNALLCNDCYCNEFSSKCVACDKIVMPGTRKLEYAGSTWHEGCFICHSCEQPIGSKSFIPDKDEHYCVPCYEDKFAPRCTRCKKALSKG--GVTYRDEPWHKECFVCTSCETQLAGQHFTSRDESPYCLKCFSSLYAKKCEACCKPITGFGGGKYISFEDRQWHQSCFTCSQCSVSLVGAGFFPNGDRILCRDCNSNL 279          

HSP 3 Score: 112.464 bits (280), Expect = 3.158e-27
Identity = 62/219 (28.31%), Postives = 100/219 (45.66%), Query Frame = 2
Query:  647 WHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAME---QEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFK--AGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPC 1288
            +H  CF+C  CD  L D  +    N   C   Y      +C  CD+++     TR +E      H   F C SC+  +    +I   D+  C+ CYE ++A  C +C   +      ++++D  WH++CF C  C + L  Q F ++D + YC  C+ + +A +C+ C K      G +   +  +QWH+ CF C  C   +    F P    I+C  C
Sbjct:   61 YHEHCFRCFRCDRSLADEPFTSQDNALLCNDCYCNEFSSKCVACDKIVMPG--TRKLEYAGSTWHEGCFICHSCEQPIGSKSFIPDKDEHYCVPCYEDKFAPRCTRCKKALS--KGGVTYRDEPWHKECFVCTSCETQLAGQHFTSRDESPYCLKCFSSLYAKKCEACCKPITGFGGGKYISFEDRQWHQSCFTCSQCSVSLVGAGFFPNGDRILCRDC 275          

HSP 4 Score: 53.9138 bits (128), Expect = 1.785e-7
Identity = 35/127 (27.56%), Postives = 55/127 (43.31%), Query Frame = 2
Query:  551 DMAALPCTQCQSSIQAGQLAVRVEHAANTQMSWHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIF---TEEYTRAMEQEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGC 922
            D  A  CT+C+ ++  G +  R E        WH  CF CT C+  L    +      PYC++ ++ L   +C  C + I      +Y    +++ H + F C  C  SL G  +    D+ LC  C
Sbjct:  156 DKFAPRCTRCKKALSKGGVTYRDE-------PWHKECFVCTSCETQLAGQHFTSRDESPYCLKCFSSLYAKKCEACCKPITGFGGGKYISFEDRQWHQSCFTCSQCSVSLVGAGFFPNGDRILCRDC 275          
BLAST of Four and A half lim domains vs. Ensembl Medaka
Match: rragcb (Ras-related GTP binding Cb [Source:ZFIN;Acc:ZDB-GENE-070705-380])

HSP 1 Score: 300.056 bits (767), Expect = 1.546e-91
Identity = 131/272 (48.16%), Postives = 185/272 (68.01%), Query Frame = 2
Query:  842 FACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGGVTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGELFAKKCSKCTKPITGFGGCKFISFEDRHWHSECFTCYKCNISLVGKGFLTNDDKIICPDCG 1657
            F C++C  SL G +YI  +++P CI CY+  +AN CQ+C+  IG + K+L+FKDR++HE CF+CF C  SL +  F + ++ L C+DCY N+F+++C  C+K+   G +  E+ G  WHE+CF+C  C +PIG +SF+P E    CVPCYE ++  +C+ C   + +GGV+Y+G  WH+ECF CT CS  LAG  FTS+ E PYC +C+  L+AKKC+ C   ITGFG  K+ISFEDR WH  CF C +C++SLVG GF    D+I+C DC 
Sbjct:  449 FDCRNCKASLYGQQYIKVENEPHCINCYDQLHANTCQECTEIIGHNDKELTFKDRYYHEHCFRCFRCDRSLSNASFTSHEDVLLCNDCYCNEFSSKCVSCNKIVMPGSKILEFDGSSWHEDCFVCHSCEKPIGGESFVPNENQYYCVPCYEGRFTPRCSHCNKALTKGGVSYQGGVWHRECFLCTGCSAPLAGQPFTSQGETPYCVKCFSNLYAKKCAGCNSAITGFGDGKYISFEDREWHQPCFKCSRCSVSLVGSGFFPYRDQILCRDCN 720          

HSP 2 Score: 157.147 bits (396), Expect = 6.412e-40
Identity = 88/282 (31.21%), Postives = 128/282 (45.39%), Query Frame = 2
Query:  635 TQMSWHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAH-FACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGG----VTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAEC 1465
            T  S     F C  C   L    Y    N+P+C+  Y QL    C  C E+I   +     +  ++  H F C  CD SL+   +   +D  LC  CY +++++ C  C+  +   SK L F    WHE CF C  C   +  + F   +N  YC  CY+ +F  RC  C+K    G     Y+G  WH ECFLC  C  P+  + F  + +   CV C+   YA+KC  C   I   G    ++++   WH+ CF C+ CS  L G  F    ++  C +C
Sbjct:  440 TDASIMSERFDCRNCKASLYGQQYIKVENEPHCINCYDQLHANTCQECTEIIGHNDKELTFKDRYYHEHCFRCFRCDRSLSNASFTSHEDVLLCNDCYCNEFSSKCVSCNKIVMPGSKILEFDGSSWHEDCFVCHSCEKPIGGESFVPNENQYYCVPCYEGRFTPRCSHCNKALTKG--GVSYQGGVWHRECFLCTGCSAPLAGQPFTSQGETPYCVKCFSNLYAKKCAGCNSAITGFGDGKYISFEDREWHQPCFKCSRCSVSLVGSGFFPYRDQILCRDC 719          

HSP 3 Score: 108.997 bits (271), Expect = 3.028e-24
Identity = 59/222 (26.58%), Postives = 105/222 (47.30%), Query Frame = 2
Query:  647 WHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAH---FACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKA-GMRKY-EYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEE 1297
            +H  CF+C  CD  L +  +  + +   C   Y      +C +C++++     ++ +E +    H   F C SC+  + G  ++  ++Q  C+ CYE ++   C  C+  +      +S++   WH +CF C  CS+ L  QPF ++    YC  C+ N +A +C GC+      G  KY  +  ++WH+ CF C  C   +    F P    I+C  C ++
Sbjct:  505 YHEHCFRCFRCDRSLSNASFTSHEDVLLCNDCYCNEFSSKCVSCNKIVMPG--SKILEFDGSSWHEDCFVCHSCEKPIGGESFVPNENQYYCVPCYEGRFTPRCSHCNKALT--KGGVSYQGGVWHRECFLCTGCSAPLAGQPFTSQGETPYCVKCFSNLYAKKCAGCNSAITGFGDGKYISFEDREWHQPCFKCSRCSVSLVGSGFFPYRDQILCRDCNDD 722          

HSP 4 Score: 93.9745 bits (232), Expect = 1.607e-19
Identity = 47/153 (30.72%), Postives = 79/153 (51.63%), Query Frame = 2
Query: 1202 ECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGG--VTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGELFAKKCSKCTKPITGFGGCKFISFEDRHWHSECFTCYKCNISLVGKGFLTNDDKIICPDC 1654
            E F C +C+  +  + +I  E +  C+ CY++ +A  C +C  +I      +T+K   +H+ CF C  C + L+   FTS E+   C +CY   F+ KC  C K +    G K + F+   WH +CF C+ C   + G+ F+ N+++  C  C
Sbjct:  447 ERFDCRNCKASLYGQQYIKVENEPHCINCYDQLHANTCQECTEIIGHNDKELTFKDRYYHEHCFRCFRCDRSLSNASFTSHEDVLLCNDCYCNEFSSKCVSCNKIV--MPGSKILEFDGSSWHEDCFVCHSCEKPIGGESFVPNENQYYCVPC 597          

HSP 5 Score: 91.2781 bits (225), Expect = 9.580e-19
Identity = 56/184 (30.43%), Postives = 83/184 (45.11%), Query Frame = 2
Query:  569 CTQCQSSIQAGQLAVRVEHAANTQMSWHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGC--DSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDN 1114
            C  C   +  G   +  + +     SWH  CF C  C++ +    +    N+ YCV  Y     PRC+ C++ + T+          H   F C  C   L G  +  + + P C+ C+ + YA  C  C+  I    D K +SF+DR WH+ CFKC  CS SLV   F    + + C DC D+
Sbjct:  545 CVSCNKIVMPGSKILEFDGS-----SWHEDCFVCHSCEKPIGGESFVPNENQYYCVPCYEGRFTPRCSHCNKAL-TKGGVSYQGGVWHRECFLCTGCSAPLAGQPFTSQGETPYCVKCFSNLYAKKCAGCNSAITGFGDGKYISFEDREWHQPCFKCSRCSVSLVGSGFFPYRDQILCRDCNDD 722          
BLAST of Four and A half lim domains vs. Planmine SMEST
Match: SMESG000072127.1 (SMESG000072127.1)

HSP 1 Score: 1097.03 bits (2836), Expect = 0.000e+0
Identity = 529/529 (100.00%), Postives = 529/529 (100.00%), Query Frame = 2
Query:   74 MALKQDIGTPCLDCVDKCRGFKIHGWRKTCLGCDCSVDRHDITDESPLPILEEMKLADKPYYNLFMESLKMARKYGLSWLPIGLQASEVEQFTSIVGGNIASRAGEKLRKQKLRRQIPVHDRCVEKFSHLETPTERQEAEKFLQFRNNQDLGVGHVYRLDMAALPCTQCQSSIQAGQLAVRVEHAANTQMSWHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGGVTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGELFAKKCSKCTKPITGFGGCKFISFEDRHWHSECFTCYKCNISLVGKGFLTNDDKIICPDCGR 1660
            MALKQDIGTPCLDCVDKCRGFKIHGWRKTCLGCDCSVDRHDITDESPLPILEEMKLADKPYYNLFMESLKMARKYGLSWLPIGLQASEVEQFTSIVGGNIASRAGEKLRKQKLRRQIPVHDRCVEKFSHLETPTERQEAEKFLQFRNNQDLGVGHVYRLDMAALPCTQCQSSIQAGQLAVRVEHAANTQMSWHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGGVTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGELFAKKCSKCTKPITGFGGCKFISFEDRHWHSECFTCYKCNISLVGKGFLTNDDKIICPDCGR
Sbjct:    1 MALKQDIGTPCLDCVDKCRGFKIHGWRKTCLGCDCSVDRHDITDESPLPILEEMKLADKPYYNLFMESLKMARKYGLSWLPIGLQASEVEQFTSIVGGNIASRAGEKLRKQKLRRQIPVHDRCVEKFSHLETPTERQEAEKFLQFRNNQDLGVGHVYRLDMAALPCTQCQSSIQAGQLAVRVEHAANTQMSWHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGGVTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGELFAKKCSKCTKPITGFGGCKFISFEDRHWHSECFTCYKCNISLVGKGFLTNDDKIICPDCGR 529          
BLAST of Four and A half lim domains vs. Planmine SMEST
Match: SMESG000037769.1 (SMESG000037769.1)

HSP 1 Score: 788.875 bits (2036), Expect = 0.000e+0
Identity = 363/533 (68.11%), Postives = 444/533 (83.30%), Query Frame = 2
Query:   74 MALKQDIGTPCLDCVDKCRGFKIHGWRKTCLGCDCSVDRHDITDESPLPILEEMKLADKPYYNLFMESLKMARKYGLSWLPIGLQASEVEQFTSIVGGNIASRA---GEKLRKQKLRRQIPVHDRCVEKFSHLETPTERQEAEKFLQFRNNQDLGVGHVYRL-DMAALPCTQCQSSIQAGQLAVRVEHAANTQMSWHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGGVTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGELFAKKCSKCTKPITGFGGCKFISFEDRHWHSECFTCYKCNISLVGKGFLTNDDKIICPDCGR 1660
            MALKQDIG+PC++C D+C+GF++HGWRKTC  C+CS D HD+ D++   +L+EMKL+DK +Y  ++E+ K  +  GL+WLPIGL+  EVE F S +  +         +K R ++LR+QIPV DR ++KFSHL+T  ERQEAEKFL+ RN+ DL + HV  + +   + C +C+++I   +L+VR++H  +   SWHP CF C+EC E+LVDYIYCW+ NK YC RHY + IRPRCATCDELIF EEYTRAM+QEHHP HFACK+CDNSLTGHRYILK++ P CI CYE+++AN C+QC  +IGCDSKDLSFKDRHWHEKCF+CFEC +SLVD+PFATKD +L+CS+CYDNKFA RCDGC KVFKAGMRKYEYRGKQWHEECFLC++C+QPIG KSFIPR+Q I+CVPCYE KYAQKC+KC  VIRRGGVTYKG+PWHKECFTCT+C+KQLAGIKFTSK++KPYCA+CYGELFAKKC+KCTKPITGFGGCKFISFE RHWHSECFTC KC  +LVG+GFLTN+D I+CPDCGR
Sbjct:    1 MALKQDIGSPCIECNDRCKGFQLHGWRKTCTACNCSYDIHDVFDDNISCVLDEMKLSDKSFYQKYIEAQKQGKASGLNWLPIGLKPIEVESFLSSLPASANPHGVGDDDKSRLRRLRKQIPVQDRRLDKFSHLDTNVERQEAEKFLKNRNSHDLSIAHVEAITEFQGVQCFECKTTIGKSELSVRIDHNESGAHSWHPACFNCSECKELLVDYIYCWHLNKLYCARHYGEKIRPRCATCDELIFNEEYTRAMDQEHHPNHFACKNCDNSLTGHRYILKEENPHCIKCYETKFANTCEQCKEKIGCDSKDLSFKDRHWHEKCFECFECHTSLVDRPFATKDESLFCSECYDNKFAARCDGCTKVFKAGMRKYEYRGKQWHEECFLCLECKQPIGAKSFIPRDQQIICVPCYENKYAQKCSKCTEVIRRGGVTYKGTPWHKECFTCTNCTKQLAGIKFTSKDDKPYCADCYGELFAKKCTKCTKPITGFGGCKFISFEGRHWHSECFTCSKCTTNLVGRGFLTNEDNIMCPDCGR 533          
BLAST of Four and A half lim domains vs. Planmine SMEST
Match: SMESG000037769.1 (SMESG000037769.1)

HSP 1 Score: 498.819 bits (1283), Expect = 9.333e-175
Identity = 229/282 (81.21%), Postives = 261/282 (92.55%), Query Frame = 2
Query:  815 MEQEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGGVTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGELFAKKCSKCTKPITGFGGCKFISFEDRHWHSECFTCYKCNISLVGKGFLTNDDKIICPDCGR 1660
            M+QEHHP HFACK+CDNSLTGHRYILK++ P CI CYE+++AN C+QC  +IGCDSKDLSFKDRHWHEKCF+CFEC +SLVD+PFATKD +L+CS+CYDNKFA RCDGC KVFKAGMRKYEYRGKQWHEECFLC++C+QPIG KSFIPR+Q I+CVPCYE KYAQKC+KC  VIRRGGVTYKG+PWHKECFTCT+C+KQLAGIKFTSK++KPYCA+CYGELFAKKC+KCTKPITGFGGCKFISFE RHWHSECFTC KC  +LVG+GFLTN+D I+CPDCGR
Sbjct:    1 MDQEHHPNHFACKNCDNSLTGHRYILKEENPHCIKCYETKFANTCEQCKEKIGCDSKDLSFKDRHWHEKCFECFECHTSLVDRPFATKDESLFCSECYDNKFAARCDGCTKVFKAGMRKYEYRGKQWHEECFLCLECKQPIGAKSFIPRDQQIICVPCYENKYAQKCSKCTEVIRRGGVTYKGTPWHKECFTCTNCTKQLAGIKFTSKDDKPYCADCYGELFAKKCTKCTKPITGFGGCKFISFEGRHWHSECFTCSKCTTNLVGRGFLTNEDNIMCPDCGR 282          

HSP 2 Score: 166.007 bits (419), Expect = 2.214e-46
Identity = 87/277 (31.41%), Postives = 133/277 (48.01%), Query Frame = 2
Query:  650 HPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEH-HPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGG----VTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAEC 1465
            HP  F C  CD  L  + Y      P+C++ Y       C  C E I  +    + +  H H   F C  C  SL    +  KD+   C  CY++++A  C  C+       +   ++ + WHE+CF C EC   +  + F  +D  + C  CY+NK+A +C  C +V + G     Y+G  WH+ECF C +C + +    F  ++    C  CY E +A+KCTKC   I   G    ++++G  WH ECFTC+ C+  L G  F + E+   C +C
Sbjct:    6 HPNHFACKNCDNSLTGHRYILKEENPHCIKCYETKFANTCEQCKEKIGCDSKDLSFKDRHWHEKCFECFECHTSLVDRPFATKDESLFCSECYDNKFAARCDGCTKVFKAGMRKYEYRGKQWHEECFLCLECKQPIGAKSFIPRDQQIICVPCYENKYAQKCSKCTEVIRRG--GVTYKGTPWHKECFTCTNCTKQLAGIKFTSKDDKPYCADCYGELFAKKCTKCTKPITGFGGCKFISFEGRHWHSECFTCSKCTTNLVGRGFLTNEDNIMCPDC 280          

HSP 3 Score: 123.25 bits (308), Expect = 5.317e-31
Identity = 76/271 (28.04%), Postives = 119/271 (43.91%), Query Frame = 2
Query:  509 RNNQDLGVGHVYRLDMAALPCTQCQSSIQAG-------QLAVRVEHAANTQMSWHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELI--FTEEYTRAMEQEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFK--AGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPC 1288
            +N  +   GH Y L      C +C  +  A        ++    +  +     WH +CF+C EC   LVD  +       +C   Y      RC  C ++      +Y    +Q H    F C  C   +    +I +D Q +C+ CYE++YA  C +C+  I      +++K   WH++CF C  C+  L    F +KD+  YC+DCY   FA +C  C K      G +   + G+ WH ECF C  C   +  + F+  E +I+C  C
Sbjct:   13 KNCDNSLTGHRYILKEENPHCIKCYETKFANTCEQCKEKIGCDSKDLSFKDRHWHEKCFECFECHTSLVDRPFATKDESLFCSECYDNKFAARCDGCTKVFKAGMRKYEYRGKQWHEEC-FLCLECKQPIGAKSFIPRDQQIICVPCYENKYAQKCSKCTEVI--RRGGVTYKGTPWHKECFTCTNCTKQLAGIKFTSKDDKPYCADCYGELFAKKCTKCTKPITGFGGCKFISFEGRHWHSECFTCSKCTTNLVGRGFLTNEDNIMCPDC 280          
BLAST of Four and A half lim domains vs. Planmine SMEST
Match: SMESG000004969.1 (SMESG000004969.1)

HSP 1 Score: 504.597 bits (1298), Expect = 3.354e-173
Identity = 252/531 (47.46%), Postives = 339/531 (63.84%), Query Frame = 2
Query:   74 MALKQDIGTPCLDCVDKCRGFKIHGWRKTCLGCDCSVDRHDITDESPLPILEEMKLADKPYYNLFMESLKMARKYGLSWLPIGLQASE-VEQFTSIVGGNIASRAGEKLRKQK--LRRQIPVHDRCVEKFSHLETPTERQEAEKFLQFRNNQDLGVGHVYRLDMAALPCTQCQSSIQAGQLAVRVEHAANTQMSWHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGGVTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGELFAKKCSKCTKPITGFGGCKFISFEDRHWHSECFTCYKCNISLVGKGFLTNDDKIICPDCG 1657
            MALKQDIG  C +C + C GFKIHGWRKTC  C C+VD+HDI DES LPIL+EMK+ DKP    + E+L +A K G  WLP+GL+    +E+F       I ++A   L K+K  LR QIPV DRCVEKF+HL T  ER+EAEKFL  RNN+D+G+G V R+    + CT+C ++I+   L V  E  +  +  WH  CFKCT C E+LVDYIY  Y+ K YC+RHYA+ IRPRC+ CDELIF+ EY RA + E H  HFAC  CD SL+   Y+       CI CY  + +N C +CS +I CDSKDLS+ + HWH  CF C  C+ +L    F   +  LYC +C+ +K   +C  C +  + G +   +  K WH  CF C DC++PIG  SF+ +++  +C  C++ KYA++C KC  +++ GG++YK   +H +CF C +C  ++A  KF  K  + YC  C   LF+ +C KCTKPITG   CK+ISFED++WH  CF C KC++SLV KGF   D+  +CP+C 
Sbjct:    1 MALKQDIGLSCNNCSN-CTGFKIHGWRKTCDKCKCAVDKHDIFDESTLPILDEMKV-DKPISAEYKEALAVAGKVGKPWLPVGLKNKNMIEEF-------ILNKAYPNLLKRKKCLRLQIPVQDRCVEKFNHLGTLAEREEAEKFLLNRNNRDIGLG-VVRISDEHMNCTECHTNIKPNTLCVTNEQTSAVKQFWHLECFKCTSCQELLVDYIYASYNQKLYCIRHYAKNIRPRCSECDELIFSVEYIRAGDNEFHLNHFACYICDASLSKQSYLQHKGFATCIQCYNHELSNKCVKCSKQISCDSKDLSYNNNHWHSDCFMCSICNKNLEGNQFLYLNELLYCVNCHQDKILPKCISCDRPIENGAKMICFDEKNWHFNCFNCKDCKRPIGNDSFVQQDKRSICSKCFDAKYAKRCAKCEKLVKEGGISYKNQSYHYDCFNCANCKCRIADTKFLVKNNENYCKVCCDRLFSTRCKKCTKPITGDAICKYISFEDKNWHVGCFNCDKCHVSLVDKGFFNKDNDTLCPNCS 521          
BLAST of Four and A half lim domains vs. Planmine SMEST
Match: SMESG000009923.1 (SMESG000009923.1)

HSP 1 Score: 487.649 bits (1254), Expect = 3.329e-166
Identity = 248/537 (46.18%), Postives = 332/537 (61.82%), Query Frame = 2
Query:  125 CRGFKIHGWRKTCLGCDCSVDRHDITDESPLPI------------LEEMKLADKPYYNLFMESLKMARKYGLSWLPIGLQASEVEQFTSIVGGNIASRAGEKL------RKQKLRRQIPVHDRCVEKF-SHLETPTER----QEAEKFLQFRNNQDLGVGHVYRLDMAALPCTQCQSSIQAGQL-AVRVEHAANTQMSWHPRCFKCTECDEVLVDYIYCWYSNKP--YCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGGVTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGELFAKKCSKCTKPITGFGGCKFISFEDRHWHSECFTCYKCNISLVGKGFLTNDDKIICPDCG 1657
            C  +  H WR  C+ C C   RH ++  + L              ++ + +        +  ++ MA    L WLPIGLQ +E+  F  +        + E +      RK  +  QIP  DR   +  +H +   E     Q A  F + R+   LG G +  +D   + C+ C    +   +  +R+ H+A  + + H  CF+C  C E LVD+ YCW ++    +C+RH+ +L   RCA CDELI  +++T+AM+QE H  HFAC  CD+SLTG +YIL+DD P C+ C+E+Q+ N C +CS +I CDSKDLSFK+ HWHEKCF C  C  SLVD+ F TKDN LYC +C+D KF++ CDGC K+F+ G++KYEY GKQWHE+CF+C DC Q IGTKSFIP    I C+ CYE K+AQKC KC  +IR+ G+TYKG PWHKECF CT C K L+  KFTSKEEKPYC EC+ ELF K+C KCT+PI+GFGGCKFIS  D HWH+ECF C KC  S+VGKGF   +D+++C  CG
Sbjct:    9 CDKYTNHKWRFRCVSCRCPNYRH-VSHVNSLDSGSSTGQHCVNNWIDSLTMESHNQLQDYKAAISMAESNNLVWLPIGLQQAEISDFLRVWNDFGPGFSLENIPINQLDRKMNIFYQIPDCDRISSEVQNHFDDKDEDKLIVQLARAFKKSRDTNYLGFGEIEPVDNQEV-CSICDKQFEDEDIFCIRITHSA--EFASHISCFECKTCKEKLVDFHYCWSNDSKAIFCLRHFGELTYCRCAECDELIVNKDFTKAMDQEFHVEHFACHVCDSSLTGTKYILRDDNPFCVKCFENQFGNTCHKCSEKISCDSKDLSFKEWHWHEKCFLCDICHDSLVDRSFTTKDNYLYCPNCFDEKFSSCCDGCGKIFRTGVKKYEYAGKQWHEDCFICADCNQSIGTKSFIPINGKISCIGCYENKHAQKCFKCSEIIRKSGITYKGDPWHKECFLCTSCQKMLSESKFTSKEEKPYCTECFIELFCKRCKKCTQPISGFGGCKFISVGDDHWHTECFNCSKCQASMVGKGFFLQEDQMVCGSCG 541          
The following BLAST results are available for this feature:
BLAST of Four and A half lim domains vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FHL22.512e-11254.95four and a half LIM domains 2 [Source:HGNC Symbol;... [more]
FHL22.512e-11254.95four and a half LIM domains 2 [Source:HGNC Symbol;... [more]
FHL22.512e-11254.95four and a half LIM domains 2 [Source:HGNC Symbol;... [more]
FHL22.512e-11254.95four and a half LIM domains 2 [Source:HGNC Symbol;... [more]
FHL22.512e-11254.95four and a half LIM domains 2 [Source:HGNC Symbol;... [more]
back to top
BLAST of Four and A half lim domains vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lim-90.000e+049.42LIM domain family [Source:UniProtKB/TrEMBL;Acc:G5... [more]
lim-90.000e+049.42LIM domain family [Source:UniProtKB/TrEMBL;Acc:G5... [more]
lim-90.000e+049.42LIM domain family [Source:UniProtKB/TrEMBL;Acc:G5... [more]
lim-90.000e+049.42LIM domain family [Source:UniProtKB/TrEMBL;Acc:G5... [more]
lim-90.000e+049.42LIM domain family [Source:UniProtKB/TrEMBL;Acc:G5... [more]
back to top
BLAST of Four and A half lim domains vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lmpt6.679e-2948.67gene:FBgn0261565 transcript:FBtr0302779[more]
Lmpt6.679e-2948.67gene:FBgn0261565 transcript:FBtr0302781[more]
Lmpt6.679e-2948.67gene:FBgn0261565 transcript:FBtr0306704[more]
Lmpt1.663e-17648.92gene:FBgn0261565 transcript:FBtr0332703[more]
Lmpt4.140e-17648.92gene:FBgn0261565 transcript:FBtr0302780[more]
back to top
BLAST of Four and A half lim domains vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fhl56.930e-11256.41four and a half LIM domains 5 [Source:ZFIN;Acc:ZDB... [more]
fhl2a4.911e-11154.21four and a half LIM domains 2a [Source:ZFIN;Acc:ZD... [more]
fhl2a4.911e-11154.21four and a half LIM domains 2a [Source:ZFIN;Acc:ZD... [more]
fhl2a4.911e-11154.21four and a half LIM domains 2a [Source:ZFIN;Acc:ZD... [more]
fhl2b5.710e-11154.21four and a half LIM domains 2b [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of Four and A half lim domains vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fhl21.272e-11256.04four and a half LIM domains 2 [Source:NCBI gene;Ac... [more]
shroom38.510e-10754.04shroom family member 3 [Source:Xenbase;Acc:XB-GENE... [more]
fhl51.543e-10553.31four and a half LIM domains 5 [Source:NCBI gene;Ac... [more]
fhl18.232e-8444.20four and a half LIM domains 1 [Source:NCBI gene;Ac... [more]
fhl11.049e-8344.20four and a half LIM domains 1 [Source:NCBI gene;Ac... [more]
back to top
BLAST of Four and A half lim domains vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Fhl21.026e-11557.51four and a half LIM domains 2 [Source:MGI Symbol;A... [more]
Fhl21.026e-11557.51four and a half LIM domains 2 [Source:MGI Symbol;A... [more]
Fhl36.761e-10049.08four and a half LIM domains 3 [Source:MGI Symbol;A... [more]
Fhl51.790e-9851.46four and a half LIM domains 5 [Source:MGI Symbol;A... [more]
Fhl51.790e-9851.46four and a half LIM domains 5 [Source:MGI Symbol;A... [more]
back to top
BLAST of Four and A half lim domains vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O70433|FHL2_MOUSE7.176e-11557.51Four and a half LIM domains protein 2 OS=Mus muscu... [more]
sp|O35115|FHL2_RAT1.682e-11457.14Four and a half LIM domains protein 2 OS=Rattus no... [more]
sp|Q14192|FHL2_HUMAN1.206e-11154.95Four and a half LIM domains protein 2 OS=Homo sapi... [more]
sp|Q2KI95|FHL2_BOVIN1.653e-11054.58Four and a half LIM domains protein 2 OS=Bos tauru... [more]
sp|Q3ZBI6|FHL3_BOVIN6.900e-10150.18Four and a half LIM domains protein 3 OS=Bos tauru... [more]
back to top
BLAST of Four and A half lim domains vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
U6J6Y30.000e+059.93Four and a half LIM domains protein 2 OS=Echinococ... [more]
A0A0X3PEW60.000e+060.54Four and a half LIM domains protein 2 OS=Schistoce... [more]
A0A068Y1Z90.000e+059.93Four and A half lim domains OS=Echinococcus multil... [more]
A0A0R3X1E40.000e+059.75Uncharacterized protein OS=Hydatigena taeniaeformi... [more]
A0A0R3T6D50.000e+058.91Uncharacterized protein OS=Rodentolepis nana OX=10... [more]
back to top
BLAST of Four and A half lim domains vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fhl2a6.067e-11153.85four and a half LIM domains protein 2 [Source:NCBI... [more]
fhl3a4.548e-10854.78four and a half LIM domains 3 [Source:NCBI gene;Ac... [more]
fhl2b2.394e-8947.99four and a half LIM domains 2b [Source:ZFIN;Acc:ZD... [more]
fhl1a5.954e-8044.36four and a half LIM domains 1 [Source:NCBI gene;Ac... [more]
fhl1a7.038e-8044.36four and a half LIM domains 1 [Source:NCBI gene;Ac... [more]
back to top
BLAST of Four and A half lim domains vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fhl55.954e-5851.18four and a half LIM domains 5 [Source:ZFIN;Acc:ZDB... [more]
fhl56.013e-5649.71four and a half LIM domains 5 [Source:ZFIN;Acc:ZDB... [more]
fhl3b2.537e-5337.89four and a half LIM domains 3b [Source:ZFIN;Acc:ZD... [more]
tes2.290e-4131.05testis derived transcript (3 LIM domains) [Source:... [more]
PXN1.824e-3030.57paxillin [Source:HGNC Symbol;Acc:HGNC:9718][more]
back to top
BLAST of Four and A half lim domains vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
LRG17.236e-730.34GTPase-activating protein (GAP); contains Rho1p-sp... [more]
back to top
BLAST of Four and A half lim domains vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
LIMPET5.648e-11836.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO411001.460e-11536.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO498012.526e-6132.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO497983.407e-5632.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO411815.190e-3133.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Four and A half lim domains vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fhl2a1.710e-11154.21four and a half LIM domains protein 2 [Source:NCBI... [more]
fhl3a2.615e-11052.82four and a half LIM domains 3 [Source:NCBI gene;Ac... [more]
fhl52.537e-10954.95four and a half LIM domains protein 2-like [Source... [more]
fhl3a2.696e-10954.78four and a half LIM domains 3 [Source:NCBI gene;Ac... [more]
rragcb1.546e-9148.16Ras-related GTP binding Cb [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Four and A half lim domains vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000072127.10.000e+0100.00SMESG000072127.1[more]
SMESG000037769.10.000e+068.11SMESG000037769.1[more]
SMESG000037769.19.333e-17581.21SMESG000037769.1[more]
SMESG000004969.13.354e-17347.46SMESG000004969.1[more]
SMESG000009923.13.329e-16646.18SMESG000009923.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024345 ID=SMED30024345|Name=Four and A half lim domains|organism=Schmidtea mediterranea sexual|type=transcript|length=1980bp
AAAAGATATTGATTTTGGATCTATTCAAATCTCTCAGAATCTCATATAGA
ATATATAAAAACCTGGCTATTAGATGGCACTGAAACAAGATATCGGAACA
CCTTGCCTGGACTGCGTCGACAAATGTCGAGGCTTCAAAATCCACGGATG
GAGGAAAACCTGTTTGGGCTGCGACTGTAGCGTGGACAGACACGACATCA
CCGATGAATCGCCCTTGCCGATCCTTGAGGAAATGAAATTGGCAGACAAG
CCCTATTATAATCTGTTTATGGAATCTTTGAAAATGGCCAGAAAGTACGG
ATTGAGCTGGCTGCCAATTGGACTACAAGCATCAGAAGTTGAACAATTTA
CTTCGATAGTTGGCGGAAATATTGCTTCACGGGCCGGAGAGAAATTACGC
AAACAAAAGCTGCGCCGACAAATTCCAGTTCATGATAGATGCGTTGAGAA
GTTCTCCCATTTGGAAACTCCTACAGAACGACAAGAAGCGGAAAAGTTTT
TACAATTTCGAAACAATCAAGATCTTGGAGTTGGTCATGTGTATCGACTT
GATATGGCTGCATTACCTTGTACTCAGTGCCAGTCATCAATACAAGCAGG
GCAATTGGCTGTCAGGGTTGAACATGCAGCTAATACCCAAATGAGTTGGC
ATCCTCGCTGTTTCAAGTGCACAGAATGTGACGAGGTACTTGTAGATTAT
ATATATTGCTGGTATTCCAATAAGCCGTACTGTGTGAGACATTATGCCCA
ATTAATCAGACCGAGATGCGCTACTTGTGATGAGTTGATTTTCACAGAAG
AATACACTCGAGCCATGGAACAAGAGCACCACCCAGCTCATTTTGCCTGC
AAGAGCTGTGATAATTCCTTGACGGGTCACAGATACATCCTCAAAGATGA
CCAGCCATTGTGCATTGGATGTTATGAAAGCCAATATGCCAACATATGTC
AACAGTGCAGCGGTAGAATTGGATGCGATTCGAAGGATCTCTCATTTAAG
GATAGGCATTGGCATGAGAAATGCTTTAAATGTTTTGAATGTTCTTCGTC
TTTAGTTGACCAGCCATTTGCCACAAAAGATAACAATTTGTATTGTTCTG
ATTGTTACGATAACAAATTCGCAACTCGGTGCGATGGGTGTCATAAGGTG
TTTAAGGCTGGAATGAGGAAATATGAGTATCGAGGCAAACAGTGGCATGA
AGAATGCTTCTTATGTGTTGACTGTCGACAGCCAATAGGCACGAAAAGCT
TTATCCCTCGCGAGCAGGATATCGTTTGCGTTCCGTGCTATGAAGAAAAA
TATGCTCAAAAGTGTACAAAATGTGTGGGGGTGATCCGGCGTGGCGGAGT
GACTTACAAAGGCTCCCCGTGGCATAAAGAGTGTTTTACATGTACTCACT
GTAGCAAACAATTAGCTGGAATTAAATTCACATCAAAGGAAGAAAAGCCT
TATTGTGCTGAATGTTATGGAGAACTTTTTGCCAAGAAGTGTTCAAAATG
TACAAAACCGATAACTGGATTCGGCGGCTGCAAATTTATCTCATTCGAAG
ATCGACATTGGCATTCAGAATGTTTCACCTGCTACAAATGCAATATCAGC
TTAGTCGGTAAAGGATTCCTCACCAATGATGACAAGATCATTTGTCCAGA
TTGCGGACGATAAATGGTCATTTTTCATTATATCAGATTGCAACAATTGA
TTTGATTGGTTCAATTCTACATTTCCCGCTCACTTTCCAGATGACCTCGA
CCGTTTCTCCTAGCATCTTCTAATGGATAATAATTTATATTATTATCATT
ATAATATTATGTTATATTTTTTATTTTTTATTACTTTCGATTTGTACATA
ATGCCGACTGCTTCTAGTGGTTTTGATATGTGTCACGATTCCGTAATGAC
GTACTCGCATTATGGATAATATTCTGTTATCTACTGTAGGTTACCTGTAA
GAGAACAATGCCCATTTAGTTATAATAGAC
back to top

protein sequence of SMED30024345-orf-1

>SMED30024345-orf-1 ID=SMED30024345-orf-1|Name=SMED30024345-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=530bp
MALKQDIGTPCLDCVDKCRGFKIHGWRKTCLGCDCSVDRHDITDESPLPI
LEEMKLADKPYYNLFMESLKMARKYGLSWLPIGLQASEVEQFTSIVGGNI
ASRAGEKLRKQKLRRQIPVHDRCVEKFSHLETPTERQEAEKFLQFRNNQD
LGVGHVYRLDMAALPCTQCQSSIQAGQLAVRVEHAANTQMSWHPRCFKCT
ECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQ
EHHPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIG
CDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFA
TRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDI
VCVPCYEEKYAQKCTKCVGVIRRGGVTYKGSPWHKECFTCTHCSKQLAGI
KFTSKEEKPYCAECYGELFAKKCSKCTKPITGFGGCKFISFEDRHWHSEC
FTCYKCNISLVGKGFLTNDDKIICPDCGR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000208testis
PLANA:0002030early male germ cell
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR037987FHL2/3/5
IPR001781Znf_LIM
IPR010442PET_domain
Vocabulary: molecular function
TermDefinition
GO:0008270zinc ion binding
GO:0046872metal ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001781Zinc finger, LIM-typeSMARTSM00132lim_4coord: 472..527
e-value: 3.1E-16
score: 69.9
coord: 231..283
e-value: 4.8E-12
score: 56.0
coord: 291..344
e-value: 3.8E-13
score: 59.7
coord: 352..405
e-value: 2.7E-14
score: 63.5
coord: 165..223
e-value: 6.5E-8
score: 42.3
coord: 413..464
e-value: 2.1E-15
score: 67.2
IPR001781Zinc finger, LIM-typePFAMPF00412LIMcoord: 232..286
e-value: 4.3E-11
score: 42.9
coord: 292..348
e-value: 1.6E-10
score: 41.0
coord: 166..226
e-value: 3.0E-8
score: 33.8
coord: 414..467
e-value: 2.5E-12
score: 46.8
coord: 353..409
e-value: 1.3E-11
score: 44.5
coord: 473..527
e-value: 2.6E-9
score: 37.2
IPR001781Zinc finger, LIM-typePROSITEPS00478LIM_DOMAIN_1coord: 353..388
IPR001781Zinc finger, LIM-typePROSITEPS00478LIM_DOMAIN_1coord: 232..266
IPR001781Zinc finger, LIM-typePROSITEPS00478LIM_DOMAIN_1coord: 473..510
IPR001781Zinc finger, LIM-typePROSITEPS50023LIM_DOMAIN_2coord: 231..289
score: 7.455
IPR001781Zinc finger, LIM-typePROSITEPS50023LIM_DOMAIN_2coord: 290..351
score: 13.157
IPR001781Zinc finger, LIM-typePROSITEPS50023LIM_DOMAIN_2coord: 412..471
score: 12.91
IPR001781Zinc finger, LIM-typePROSITEPS50023LIM_DOMAIN_2coord: 164..230
score: 11.514
IPR001781Zinc finger, LIM-typePROSITEPS50023LIM_DOMAIN_2coord: 472..529
score: 10.049
IPR001781Zinc finger, LIM-typePROSITEPS50023LIM_DOMAIN_2coord: 352..411
score: 8.306
NoneNo IPR availableGENE3DG3DSA:2.10.110.10coord: 469..529
e-value: 3.6E-20
score: 73.6
NoneNo IPR availableGENE3DG3DSA:2.10.110.10coord: 346..406
e-value: 2.2E-19
score: 71.2
coord: 286..345
e-value: 8.5E-22
score: 78.9
NoneNo IPR availableGENE3DG3DSA:2.10.110.10coord: 407..468
e-value: 4.3E-23
score: 82.9
coord: 227..285
e-value: 6.9E-16
score: 59.8
NoneNo IPR availableGENE3DG3DSA:2.10.110.10coord: 157..226
e-value: 3.7E-13
score: 51.1
NoneNo IPR availablePANTHERPTHR24205:SF4LIM DOMAIN FAMILYcoord: 27..528
NoneNo IPR availableCDDcd09430LIM5_LIMPETincoord: 414..465
e-value: 7.85905E-23
score: 89.4572
NoneNo IPR availableCDDcd09341LIM2_Testin_likecoord: 230..285
e-value: 1.22379E-22
score: 88.8158
NoneNo IPR availableCDDcd09347LIM4_FHLcoord: 473..528
e-value: 4.49623E-28
score: 104.348
NoneNo IPR availableCDDcd09343LIM1_FHLcoord: 288..346
e-value: 1.3772E-25
score: 97.5075
NoneNo IPR availableCDDcd09425LIM4_LIMPETincoord: 353..406
e-value: 4.99548E-24
score: 92.8863
NoneNo IPR availableSUPERFAMILYSSF57716Glucocorticoid receptor-like (DNA-binding domain)coord: 503..529
NoneNo IPR availableSUPERFAMILYSSF57716Glucocorticoid receptor-like (DNA-binding domain)coord: 381..443
NoneNo IPR availableSUPERFAMILYSSF57716Glucocorticoid receptor-like (DNA-binding domain)coord: 319..384
NoneNo IPR availableSUPERFAMILYSSF57716Glucocorticoid receptor-like (DNA-binding domain)coord: 440..507
NoneNo IPR availableSUPERFAMILYSSF57716Glucocorticoid receptor-like (DNA-binding domain)coord: 198..263
NoneNo IPR availableSUPERFAMILYSSF57716Glucocorticoid receptor-like (DNA-binding domain)coord: 259..323
IPR010442PET domainPFAMPF06297PETcoord: 78..156
e-value: 6.1E-10
score: 39.3
IPR037987Four and a half LIM domains protein 2/3/5PANTHERPTHR24205FAMILY NOT NAMEDcoord: 27..528