Neuropeptide Y receptor, invertebrate

Overview
NameNeuropeptide Y receptor, invertebrate
Smed IDSMED30024342
Length (bp)1666
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Neuropeptide Y receptor, invertebrate (SMED30024342) t-SNE clustered cells

Violin plots show distribution of expression levels for Neuropeptide Y receptor, invertebrate (SMED30024342) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Neuropeptide Y receptor, invertebrate (SMED30024342) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Neuropeptide Y receptor, invertebrate (SMED30024342) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Neuropeptide Y receptor, invertebrate vs. Ensembl Human
Match: NPY2R (neuropeptide Y receptor Y2 [Source:HGNC Symbol;Acc:HGNC:7957])

HSP 1 Score: 143.28 bits (360), Expect = 3.346e-37
Identity = 102/308 (33.12%), Postives = 171/308 (55.52%), Query Frame = 3
Query:  414 LQYLVIAGYSIIFVLGVVGNSFVIFVVMRSRHMRTITNIFISNLALSDIIMCLIAVPFTPIALFMNNWTLPASLCKVLPMTMGVSVYVSTLTSTAIAIDRFFIIVHPFIPRMKNSLCGFXXXXXXXXXXXXSLPLAVYQTKR-----NDLQSNTSKCQEVWPIDSSR---EVFTFVSFVLQFVLPCSIISVCYFKISKILRERCKSKVGSGTKSXXXXXXXXXXXXXTNKMLIAMVTIFVICWIPLNSLWMATDMSMNFKYDLRLQFFFPIGFFICHMIAMSSAVYNPFLYAWLNDNFKREFRNLVPC 1313
            +Q ++I  Y  I +LGV+GNS VI VV++ + MRT+TN FI+NLA++D+++  + +PFT     M  W +   LC ++P   G++V VST+T T IA+DR   IV+    ++   +   II + W I+ L++ PLA+++         D +     C E WP +       V++  S ++ +VLP  IIS  Y +I      + K+ V  G  +    +   +R++KT KML+ +V +F + W+PL++  +A D+      DL+    + + F + H+IAM S   NP LY W+N N+++ F +   C
Sbjct:   49 VQVVLILAYCSIILLGVIGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEWKMGPVLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKRISFLIIGLAWGISALLASPLAIFREYSLIEIIPDFE--IVACTEKWPGEEKSIYGTVYSLSSLLILYVLPLGIISFSYTRI----WSKLKNHVSPGAAN----DHYHQRRQKTTKMLVCVVVVFAVSWLPLHAFQLAVDIDSQV-LDLK---EYKLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAFLSAFRC 342          
BLAST of Neuropeptide Y receptor, invertebrate vs. Ensembl Human
Match: NPY2R (neuropeptide Y receptor Y2 [Source:HGNC Symbol;Acc:HGNC:7957])

HSP 1 Score: 143.28 bits (360), Expect = 3.346e-37
Identity = 102/308 (33.12%), Postives = 171/308 (55.52%), Query Frame = 3
Query:  414 LQYLVIAGYSIIFVLGVVGNSFVIFVVMRSRHMRTITNIFISNLALSDIIMCLIAVPFTPIALFMNNWTLPASLCKVLPMTMGVSVYVSTLTSTAIAIDRFFIIVHPFIPRMKNSLCGFXXXXXXXXXXXXSLPLAVYQTKR-----NDLQSNTSKCQEVWPIDSSR---EVFTFVSFVLQFVLPCSIISVCYFKISKILRERCKSKVGSGTKSXXXXXXXXXXXXXTNKMLIAMVTIFVICWIPLNSLWMATDMSMNFKYDLRLQFFFPIGFFICHMIAMSSAVYNPFLYAWLNDNFKREFRNLVPC 1313
            +Q ++I  Y  I +LGV+GNS VI VV++ + MRT+TN FI+NLA++D+++  + +PFT     M  W +   LC ++P   G++V VST+T T IA+DR   IV+    ++   +   II + W I+ L++ PLA+++         D +     C E WP +       V++  S ++ +VLP  IIS  Y +I      + K+ V  G  +    +   +R++KT KML+ +V +F + W+PL++  +A D+      DL+    + + F + H+IAM S   NP LY W+N N+++ F +   C
Sbjct:   49 VQVVLILAYCSIILLGVIGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEWKMGPVLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKRISFLIIGLAWGISALLASPLAIFREYSLIEIIPDFE--IVACTEKWPGEEKSIYGTVYSLSSLLILYVLPLGIISFSYTRI----WSKLKNHVSPGAAN----DHYHQRRQKTTKMLVCVVVVFAVSWLPLHAFQLAVDIDSQV-LDLK---EYKLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAFLSAFRC 342          
BLAST of Neuropeptide Y receptor, invertebrate vs. Ensembl Human
Match: NPFFR2 (neuropeptide FF receptor 2 [Source:HGNC Symbol;Acc:HGNC:4525])

HSP 1 Score: 138.272 bits (347), Expect = 3.761e-35
Identity = 108/354 (30.51%), Postives = 182/354 (51.41%), Query Frame = 3
Query:  429 IAGYSIIFVLGVVGNSFVIFVVMRSRHMRTITNIFISNLALSDIIMCLIAVPFTPIALFMNNWTLPASLCKVLPMTMGVSVYVSTLTSTAIAIDRFFIIVHPFIPRMKNSLCGFXXXXXXXXXXXXSLPLAV--------YQTKRNDLQSNTSK---CQEVWPIDSSREVFTFVSFVLQFVLPCSIISVCYFKIS-KILRERCKSKVGSGTKSXXXXXXXXXXXXXTNKMLIAMVTIFVICWIPLNSLWMATDMSMNFKYDLRLQFFFPIGFFI---CHMIAMSSAVYNPFLYAWLNDNFKREFRNLVPCLSCILKPVLPNNPSVTCRPDSRIATTYQMTTCEQEEDSSKKTLL 1445
            I  Y +IF L ++GN+ V F+VMR++HM T+TN+FI NLA+SD+++ +  +P T +   +  W    ++CK+  +  G+SV  S  T  AIA+DRF  +V+PF P++       II +IW++AI I  P AV        Y   R + Q+ TS    C+E WP    R+++T V F   ++ P S+I + Y +I   + R        +G K+        ++K+K  KML+ +  +F++ W+PL +L M +D +     DL       I  +I    H +A  ++  NP +Y + N+NF+R F+       C  +       ++  +    I T+ Q+      ++   +TLL
Sbjct:   49 IISYFLIFFLCMMGNTVVCFIVMRNKHMHTVTNLFILNLAISDLLVGIFCMPITLLDNIIAGWPFGNTMCKISGLVQGISVAASVFTLVAIAVDRFQCVVYPFKPKLTIKTAFVIIMIIWVLAITIMSPSAVMLHVQEEKYYRVRLNSQNKTSPVYWCREDWPNQEMRKIYTTVLFANIYLAPLSLIVIMYGRIGISLFRAAVPH---TGRKNQEQWHVVSRKKQKIIKMLLIVALLFILSWLPLWTLMMLSDYA-----DLSPNELQIINIYIYPFAHWLAFGNSSVNPIIYGFFNENFRRGFQEAFQLQLCQKRAKPMEAYALKAKSHVLINTSNQLVQESTFQNPHGETLL 394          
BLAST of Neuropeptide Y receptor, invertebrate vs. Ensembl Human
Match: NPFFR2 (neuropeptide FF receptor 2 [Source:HGNC Symbol;Acc:HGNC:4525])

HSP 1 Score: 138.272 bits (347), Expect = 3.955e-35
Identity = 108/354 (30.51%), Postives = 182/354 (51.41%), Query Frame = 3
Query:  429 IAGYSIIFVLGVVGNSFVIFVVMRSRHMRTITNIFISNLALSDIIMCLIAVPFTPIALFMNNWTLPASLCKVLPMTMGVSVYVSTLTSTAIAIDRFFIIVHPFIPRMKNSLCGFXXXXXXXXXXXXSLPLAV--------YQTKRNDLQSNTSK---CQEVWPIDSSREVFTFVSFVLQFVLPCSIISVCYFKIS-KILRERCKSKVGSGTKSXXXXXXXXXXXXXTNKMLIAMVTIFVICWIPLNSLWMATDMSMNFKYDLRLQFFFPIGFFI---CHMIAMSSAVYNPFLYAWLNDNFKREFRNLVPCLSCILKPVLPNNPSVTCRPDSRIATTYQMTTCEQEEDSSKKTLL 1445
            I  Y +IF L ++GN+ V F+VMR++HM T+TN+FI NLA+SD+++ +  +P T +   +  W    ++CK+  +  G+SV  S  T  AIA+DRF  +V+PF P++       II +IW++AI I  P AV        Y   R + Q+ TS    C+E WP    R+++T V F   ++ P S+I + Y +I   + R        +G K+        ++K+K  KML+ +  +F++ W+PL +L M +D +     DL       I  +I    H +A  ++  NP +Y + N+NF+R F+       C  +       ++  +    I T+ Q+      ++   +TLL
Sbjct:   52 IISYFLIFFLCMMGNTVVCFIVMRNKHMHTVTNLFILNLAISDLLVGIFCMPITLLDNIIAGWPFGNTMCKISGLVQGISVAASVFTLVAIAVDRFQCVVYPFKPKLTIKTAFVIIMIIWVLAITIMSPSAVMLHVQEEKYYRVRLNSQNKTSPVYWCREDWPNQEMRKIYTTVLFANIYLAPLSLIVIMYGRIGISLFRAAVPH---TGRKNQEQWHVVSRKKQKIIKMLLIVALLFILSWLPLWTLMMLSDYA-----DLSPNELQIINIYIYPFAHWLAFGNSSVNPIIYGFFNENFRRGFQEAFQLQLCQKRAKPMEAYALKAKSHVLINTSNQLVQESTFQNPHGETLL 397          
BLAST of Neuropeptide Y receptor, invertebrate vs. Ensembl Human
Match: NPY1R (neuropeptide Y receptor Y1 [Source:HGNC Symbol;Acc:HGNC:7956])

HSP 1 Score: 135.576 bits (340), Expect = 1.845e-34
Identity = 92/300 (30.67%), Postives = 152/300 (50.67%), Query Frame = 3
Query:  435 GYSIIFVLGVVGNSFVIFVVMRSRHMRTITNIFISNLALSDIIMCLIAVPFTPIALFMNNWTLPASLCKVLPMTMGVSVYVSTLTSTAIAIDRFFIIVHPFIPRMKNSLCGFXXXXXXXXXXXXSLPLAVYQTKRN--------DLQSNTSKCQEVWPIDSSREVFTFVSFVLQFVLPCSIISVCYFKISKILRERCKSKVGSGTKSXXXXXXXXXXXXXTNKMLIAMVTIFVICWIPLNSLWMATDMSMNFKYDLRLQFF----FPIGFFICHMIAMSSAVYNPFLYAWLNDNFKREFR 1298
             Y  + +LGV GN  +I ++++ + MR +TNI I NL+ SD+++ ++ +PFT +   M++W    ++CK+ P    VS+ VS  +   IA++R  +I++P   R  N      I VIW++A+  SLP  +YQ   +        D   +   C + +P DS R  +T +  VLQ+  P   I +CYFKI   L+ R      +    +R  +      ++ N ML+++V  F +CW+PL           N  +D   Q        + F +CH+ AM S   NP  Y +LN NF+R+ +
Sbjct:   46 AYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRR-----NNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIF--------NTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQ 332          
BLAST of Neuropeptide Y receptor, invertebrate vs. Ensembl Celegans
Match: npr-6 (NeuroPeptide Receptor family [Source:UniProtKB/TrEMBL;Acc:Q20275])

HSP 1 Score: 158.688 bits (400), Expect = 5.925e-43
Identity = 112/310 (36.13%), Postives = 173/310 (55.81%), Query Frame = 3
Query:  408 EGLQYLVIAGYSIIFVLGVVGNSFVIFVVMRSRHMRTITNIFISNLALSDIIMCLIAVPFTPIALFMNNWTLPASLCKVLPMTMGVSVYVSTLTSTAIAIDRFFIIVH-----PFIPRMKNSLCGFXXXXXXXXXXXXSLPLAVYQTKRNDLQS--NTSKCQEVWPIDSSREVFTFVSFVLQFVLPCSIISVCYFKISKILRERCKSKVGSGTKSXXXXXXXXXXXXXTNKMLIAMVTIFVICWIPLNSLWMATDMSMNFKYDLRLQFFFPIGFFICHMIAMSSAVYNPFLYAWLNDNFKREFRNLVPCL 1316
            E  +   I+ Y  +F++   GN  V++VVM ++ M+TITNIFI+NLA+SDI++   ++  TP    + +W     LC  LP+  G S+++ST T TAIAIDR+ +IVH         RM    C   I +IW+ ++L+  P A+   K N +    +   C E W     R +F  V  +LQF+LP  +I++ Y KI   L  R         +S+  ++ +IKRK++  +MLI MV IF ICW P N L    D+    K D  ++ +F   F   H+++M++  +NP LYA++N+ F+ EF  +VPCL
Sbjct:   34 EYFRPFFISMYCAVFLVASSGNFLVVYVVMTNKRMQTITNIFITNLAVSDIMVNFTSLWLTPTYTSIGHWIFGGGLCHGLPLFQGTSIFISTWTLTAIAIDRYIVIVHNSSNININDRMSMRSCLSFIVLIWLCSLLLVTPYAI-NMKLNYIHEPCDFLICSEDWSNAEFRSIFGIVVMILQFILPFVLIAISYIKIWLFLNSR---------QSMTERKSDIKRKKRLLRMLIVMVVIFAICWFPFNLLNCLRDL----KLDNFMRGYFSFVFLSVHLMSMTATAWNPILYAFMNETFREEFAKVVPCL 329          
BLAST of Neuropeptide Y receptor, invertebrate vs. Ensembl Celegans
Match: npr-10 (NeuroPeptide Receptor family [Source:UniProtKB/TrEMBL;Acc:Q6EUU1])

HSP 1 Score: 144.821 bits (364), Expect = 2.395e-38
Identity = 101/309 (32.69%), Postives = 158/309 (51.13%), Query Frame = 3
Query:  438 YSIIFVLGVVGNSFVIFVVMRSRHMRTITNIFISNLALSDIIMCLIAVPFTPIALFMNNWTLPASLCKVLPMTMGVSVYVSTLTSTAIAIDRFFIIVHPFIPRMKNSLCGFXXXXXXXXXXXXSLPLAVYQTKRNDLQSNTSKCQEVWPIDSS-REVFTFVSFVLQFVLPCSIISVCYFKISKILRERCKSKVGSGTKSXXXXXXXXXXXXXTNKMLIAMVTIFVICWIPLNSLWMATDMSMNFKYDLRLQFFFPIGFFICHMIAMSSAVYNPFLYAWLNDNFKREFRNLVPCL--SCILKPVLPNNPS 1355
            Y+II V+GV GN  V+  VMR + ++++ N+FI +L++SDI + +++   TPI  F   W     LC +LP+  G ++  STLT TAIAIDR+ +I HP    ++      +I     I++ +S+PL + Q            C E W  D+  R V+  V F++QFV P   I+ CY  IS  LR     +          +    +R+ +TN+MLI M   F + W+P        D S          + F I F   H I+M+S + NPFLY + N++F+  F  L+  +  +C ++ V P NP+
Sbjct:   35 YTIIVVVGVTGNLLVVMSVMRFKVLQSVRNMFIVSLSVSDIFVAIVSGSVTPITAFSKVWLFGGPLCHLLPLLQGTALSFSTLTLTAIAIDRYILICHPTKEPIRKDQALKMISFNSAISVGLSVPLFMKQELMQFRNYCGEYCSENWGPDAYLRSVYGTVVFIIQFVFPLITITFCYASISIKLRRGVFVRGSQKELMSEARRQLTQRRLRTNRMLIIMTVTFALSWLPSVGFNFLRDYSALPGIIDSQDYLFGIIF---HCISMTSVIVNPFLYGYCNEHFRAAFAALLDTVKAACGMRRVSPGNPA 340          
BLAST of Neuropeptide Y receptor, invertebrate vs. Ensembl Celegans
Match: npr-2 (NeuroPeptide Receptor family [Source:UniProtKB/TrEMBL;Acc:A0A061AKJ8])

HSP 1 Score: 140.584 bits (353), Expect = 1.123e-36
Identity = 100/328 (30.49%), Postives = 163/328 (49.70%), Query Frame = 3
Query:  438 YSIIFVLGVVGNSFVIFVVMRSRHMRTITNIFISNLALSDIIMCLIAVPFTPIALFMNNWTLPASLCKVLPMTMGVSVYVSTLTSTAIAIDRFFIIVHPFIPRMKNSLCGFXXXXXXXXXXXXSLPLAVYQ--TKRNDLQSNTSKCQEVWPIDSSREVFTFVSFVLQFVLPCSIISVCYFKISKILRERCKSKVG---------------SGTKSXXXXXXXXXXXXXTNKMLIA--------------MVTIFVICWIPLNSLWMATDMSMNFKYDLRLQFFFP-------------IGFFICHMIAMSSAVYNPFLYAWLNDNFKR 1289
            Y  IF+LG++GNS V+++ M+ R ++T+ NIFI NL  S+++MCL ++P T I      W   + +CK++P+  G S++VST + +AIA+DR+ ++V P   ++ +     I  +IW+I++++ +P   Y    K N L      C E WP+   R+ +TF+  + QF+ P + ++ CY+ I   LR+R ++K+                  T  I     E  +    NK  +A              MV +F   W+P N +      ++  +YD    FFF              I     H+I+M + V NPFLYAWLN  FK 
Sbjct:   33 YLHIFLLGILGNSAVLYLTMKHRQLQTVQNIFILNLCASNVLMCLTSLPITFITNVYKQWFFSSPVCKLIPLVQGASIFVSTFSLSAIALDRYNLVVRPHKQKLSSRSAMMIALLIWVISVVVCMPYGWYMDVEKLNGLCG--EYCSEHWPLAEVRKGYTFLVLITQFLFPFATMAFCYYNIFSRLRQRVETKLKKLSERSQLLENSTTCGTTNHIVSINAEAVQNGLENKQRLAVLAQQRRTTTILSCMVLLFAFTWLPHNVV------TLMIEYD---GFFFHSDETSATSTDHTYIVSMTAHLISMLTNVTNPFLYAWLNPMFKE 349          
BLAST of Neuropeptide Y receptor, invertebrate vs. Ensembl Celegans
Match: npr-2 (NeuroPeptide Receptor family [Source:UniProtKB/TrEMBL;Acc:A0A061AKJ8])

HSP 1 Score: 140.969 bits (354), Expect = 1.472e-36
Identity = 100/328 (30.49%), Postives = 163/328 (49.70%), Query Frame = 3
Query:  438 YSIIFVLGVVGNSFVIFVVMRSRHMRTITNIFISNLALSDIIMCLIAVPFTPIALFMNNWTLPASLCKVLPMTMGVSVYVSTLTSTAIAIDRFFIIVHPFIPRMKNSLCGFXXXXXXXXXXXXSLPLAVYQ--TKRNDLQSNTSKCQEVWPIDSSREVFTFVSFVLQFVLPCSIISVCYFKISKILRERCKSKVG---------------SGTKSXXXXXXXXXXXXXTNKMLIA--------------MVTIFVICWIPLNSLWMATDMSMNFKYDLRLQFFFP-------------IGFFICHMIAMSSAVYNPFLYAWLNDNFKR 1289
            Y  IF+LG++GNS V+++ M+ R ++T+ NIFI NL  S+++MCL ++P T I      W   + +CK++P+  G S++VST + +AIA+DR+ ++V P   ++ +     I  +IW+I++++ +P   Y    K N L      C E WP+   R+ +TF+  + QF+ P + ++ CY+ I   LR+R ++K+                  T  I     E  +    NK  +A              MV +F   W+P N +      ++  +YD    FFF              I     H+I+M + V NPFLYAWLN  FK 
Sbjct:   58 YLHIFLLGILGNSAVLYLTMKHRQLQTVQNIFILNLCASNVLMCLTSLPITFITNVYKQWFFSSPVCKLIPLVQGASIFVSTFSLSAIALDRYNLVVRPHKQKLSSRSAMMIALLIWVISVVVCMPYGWYMDVEKLNGLCGE--YCSEHWPLAEVRKGYTFLVLITQFLFPFATMAFCYYNIFSRLRQRVETKLKKLSERSQLLENSTTCGTTNHIVSINAEAVQNGLENKQRLAVLAQQRRTTTILSCMVLLFAFTWLPHNVV------TLMIEYD---GFFFHSDETSATSTDHTYIVSMTAHLISMLTNVTNPFLYAWLNPMFKE 374          
BLAST of Neuropeptide Y receptor, invertebrate vs. Ensembl Celegans
Match: npr-2 (NeuroPeptide Receptor family [Source:UniProtKB/TrEMBL;Acc:A0A061AKJ8])

HSP 1 Score: 140.969 bits (354), Expect = 2.236e-36
Identity = 100/328 (30.49%), Postives = 163/328 (49.70%), Query Frame = 3
Query:  438 YSIIFVLGVVGNSFVIFVVMRSRHMRTITNIFISNLALSDIIMCLIAVPFTPIALFMNNWTLPASLCKVLPMTMGVSVYVSTLTSTAIAIDRFFIIVHPFIPRMKNSLCGFXXXXXXXXXXXXSLPLAVYQ--TKRNDLQSNTSKCQEVWPIDSSREVFTFVSFVLQFVLPCSIISVCYFKISKILRERCKSKVG---------------SGTKSXXXXXXXXXXXXXTNKMLIA--------------MVTIFVICWIPLNSLWMATDMSMNFKYDLRLQFFFP-------------IGFFICHMIAMSSAVYNPFLYAWLNDNFKR 1289
            Y  IF+LG++GNS V+++ M+ R ++T+ NIFI NL  S+++MCL ++P T I      W   + +CK++P+  G S++VST + +AIA+DR+ ++V P   ++ +     I  +IW+I++++ +P   Y    K N L      C E WP+   R+ +TF+  + QF+ P + ++ CY+ I   LR+R ++K+                  T  I     E  +    NK  +A              MV +F   W+P N +      ++  +YD    FFF              I     H+I+M + V NPFLYAWLN  FK 
Sbjct:   76 YLHIFLLGILGNSAVLYLTMKHRQLQTVQNIFILNLCASNVLMCLTSLPITFITNVYKQWFFSSPVCKLIPLVQGASIFVSTFSLSAIALDRYNLVVRPHKQKLSSRSAMMIALLIWVISVVVCMPYGWYMDVEKLNGLCG--EYCSEHWPLAEVRKGYTFLVLITQFLFPFATMAFCYYNIFSRLRQRVETKLKKLSERSQLLENSTTCGTTNHIVSINAEAVQNGLENKQRLAVLAQQRRTTTILSCMVLLFAFTWLPHNVV------TLMIEYD---GFFFHSDETSATSTDHTYIVSMTAHLISMLTNVTNPFLYAWLNPMFKE 392          
BLAST of Neuropeptide Y receptor, invertebrate vs. Ensembl Fly
Match: NPFR (gene:FBgn0037408 transcript:FBtr0308318)

HSP 1 Score: 158.303 bits (399), Expect = 3.864e-42
Identity = 108/308 (35.06%), Postives = 172/308 (55.84%), Query Frame = 3
Query:  420 YLVIAGYSIIFVLGVVGNSFVIFVVMRSRHMRTITNIFISNLALSDIIMCLIAVPFTPIALFMNNWTLPAS--LCKVLPMTMGVSVYVSTLTSTAIAIDRFFIIVHPFIPRMKNSLCGFXXXXXXXXXXXXSLPLAVYQTKRN----------DLQSNTSKCQEVWPIDSSREVFTFVSFVLQFVLPCSIISVCYFKISKILRERCKSKVGSGTKSXXXXXXXXXXXXXTNKMLIAMVTIFVICWIPLNSLWMATDMSMNFKYDLRLQFFFPIGFFICHMIAMSSAVYNPFLYAWLNDNFKREFRNLV 1307
            +++I+ Y ++ V G +GN+ V+  V+R   MRT  N+FI NLA+SD+++CL+ +P T + +    W   +   LCK + M   + ++VST++ TAIA DR+ +IV+P    ++      I+  IW +A+L++ PL VY+   N           LQ     C E WP  + R  ++  S  +Q+++P  I+SV YF I   L+ R  + V     S + K    +R ++TN +LI++  IF + W+PLN   +  DM  +      L     + + ICHMI MSSA  NP LY WLNDNF++EF+ L+
Sbjct:   87 HMLISMYGVLIVFGALGNTLVVIAVIRKPIMRTARNLFILNLAISDLLLCLVTMPLTLMEILSKYWPYGSCSILCKTIAMLQALCIFVSTISITAIAFDRYQVIVYPTRDSLQFVGAVTILAGIWALALLLASPLFVYKELINTDTPALLQQIGLQDTIPYCIEDWPSRNGRFYYSIFSLCVQYLVPILIVSVAYFGIYNKLKSRI-TVVAVQASSAQRKVERGRRMKRTNCLLISIAIIFGVSWLPLNFFNLYADMERSPVTQSML-----VRYAICHMIGMSSACSNPLLYGWLNDNFRKEFQELL 388          
BLAST of Neuropeptide Y receptor, invertebrate vs. Ensembl Fly
Match: NPFR (gene:FBgn0037408 transcript:FBtr0078590)

HSP 1 Score: 158.303 bits (399), Expect = 3.917e-42
Identity = 108/308 (35.06%), Postives = 172/308 (55.84%), Query Frame = 3
Query:  420 YLVIAGYSIIFVLGVVGNSFVIFVVMRSRHMRTITNIFISNLALSDIIMCLIAVPFTPIALFMNNWTLPAS--LCKVLPMTMGVSVYVSTLTSTAIAIDRFFIIVHPFIPRMKNSLCGFXXXXXXXXXXXXSLPLAVYQTKRN----------DLQSNTSKCQEVWPIDSSREVFTFVSFVLQFVLPCSIISVCYFKISKILRERCKSKVGSGTKSXXXXXXXXXXXXXTNKMLIAMVTIFVICWIPLNSLWMATDMSMNFKYDLRLQFFFPIGFFICHMIAMSSAVYNPFLYAWLNDNFKREFRNLV 1307
            +++I+ Y ++ V G +GN+ V+  V+R   MRT  N+FI NLA+SD+++CL+ +P T + +    W   +   LCK + M   + ++VST++ TAIA DR+ +IV+P    ++      I+  IW +A+L++ PL VY+   N           LQ     C E WP  + R  ++  S  +Q+++P  I+SV YF I   L+ R  + V     S + K    +R ++TN +LI++  IF + W+PLN   +  DM  +      L     + + ICHMI MSSA  NP LY WLNDNF++EF+ L+
Sbjct:   87 HMLISMYGVLIVFGALGNTLVVIAVIRKPIMRTARNLFILNLAISDLLLCLVTMPLTLMEILSKYWPYGSCSILCKTIAMLQALCIFVSTISITAIAFDRYQVIVYPTRDSLQFVGAVTILAGIWALALLLASPLFVYKELINTDTPALLQQIGLQDTIPYCIEDWPSRNGRFYYSIFSLCVQYLVPILIVSVAYFGIYNKLKSRI-TVVAVQASSAQRKVERGRRMKRTNCLLISIAIIFGVSWLPLNFFNLYADMERSPVTQSML-----VRYAICHMIGMSSACSNPLLYGWLNDNFRKEFQELL 388          
BLAST of Neuropeptide Y receptor, invertebrate vs. Ensembl Fly
Match: NPFR (gene:FBgn0037408 transcript:FBtr0308316)

HSP 1 Score: 151.369 bits (381), Expect = 1.046e-39
Identity = 119/353 (33.71%), Postives = 184/353 (52.12%), Query Frame = 3
Query:  420 YLVIAGYSIIFVLGVVGNSFVIFVVMRSRHMRTITNIFISNLALSDIIMCLIAVPFTPIALFMNNWTLPAS--LCKVLPMTMGVSVYVSTLTSTAIAIDRFFIIVHPFIPRMKNSLCGFXXXXXXXXXXXXSLPLAVYQTKRN----------DLQSNTSKCQEVWPIDSSREVFTFVSFVLQFVLPCSIISVCYFKISKILRERCKSKVGSGTKSXXXXXXXXXXXXXTNKMLIAMVTIFVICWIPLNSLWMATDMSMNFKYDLRLQFFFPIGFFICHMIAMSSAVYNPFLYAWLNDNFK-------REFRNLVPCLS-CILKPVLPNNP-SVTCRPDSRIATTYQMTTCEQ 1415
            +++I+ Y ++ V G +GN+ V+  V+R   MRT  N+FI NLA+SD+++CL+ +P T + +    W   +   LCK + M   + ++VST++ TAIA DR+ +IV+P    ++      I+  IW +A+L++ PL VY+   N           LQ     C E WP  + R  ++  S  +Q+++P  I+SV YF I   L+ R  + V     S + K    +R ++TN +LI++  IF + W+PLN   +  DM  +      L     + + ICHMI MSSA  NP LY WLNDNF+       R  R L   LS   LK + P    S T   +  +A T  MT   +
Sbjct:   87 HMLISMYGVLIVFGALGNTLVVIAVIRKPIMRTARNLFILNLAISDLLLCLVTMPLTLMEILSKYWPYGSCSILCKTIAMLQALCIFVSTISITAIAFDRYQVIVYPTRDSLQFVGAVTILAGIWALALLLASPLFVYKELINTDTPALLQQIGLQDTIPYCIEDWPSRNGRFYYSIFSLCVQYLVPILIVSVAYFGIYNKLKSRI-TVVAVQASSAQRKVERGRRMKRTNCLLISIAIIFGVSWLPLNFFNLYADMERSPVTQSML-----VRYAICHMIGMSSACSNPLLYGWLNDNFRCNVQAAARRRRKLGAELSKGELKLLGPGGAQSGTAGGEGGLAATDFMTGHHE 433          
BLAST of Neuropeptide Y receptor, invertebrate vs. Ensembl Fly
Match: NPFR (gene:FBgn0037408 transcript:FBtr0308317)

HSP 1 Score: 150.984 bits (380), Expect = 1.229e-39
Identity = 119/353 (33.71%), Postives = 184/353 (52.12%), Query Frame = 3
Query:  420 YLVIAGYSIIFVLGVVGNSFVIFVVMRSRHMRTITNIFISNLALSDIIMCLIAVPFTPIALFMNNWTLPAS--LCKVLPMTMGVSVYVSTLTSTAIAIDRFFIIVHPFIPRMKNSLCGFXXXXXXXXXXXXSLPLAVYQTKRN----------DLQSNTSKCQEVWPIDSSREVFTFVSFVLQFVLPCSIISVCYFKISKILRERCKSKVGSGTKSXXXXXXXXXXXXXTNKMLIAMVTIFVICWIPLNSLWMATDMSMNFKYDLRLQFFFPIGFFICHMIAMSSAVYNPFLYAWLNDNFK-------REFRNLVPCLS-CILKPVLPNNP-SVTCRPDSRIATTYQMTTCEQ 1415
            +++I+ Y ++ V G +GN+ V+  V+R   MRT  N+FI NLA+SD+++CL+ +P T + +    W   +   LCK + M   + ++VST++ TAIA DR+ +IV+P    ++      I+  IW +A+L++ PL VY+   N           LQ     C E WP  + R  ++  S  +Q+++P  I+SV YF I   L+ R  + V     S + K    +R ++TN +LI++  IF + W+PLN   +  DM  +      L     + + ICHMI MSSA  NP LY WLNDNF+       R  R L   LS   LK + P    S T   +  +A T  MT   +
Sbjct:   87 HMLISMYGVLIVFGALGNTLVVIAVIRKPIMRTARNLFILNLAISDLLLCLVTMPLTLMEILSKYWPYGSCSILCKTIAMLQALCIFVSTISITAIAFDRYQVIVYPTRDSLQFVGAVTILAGIWALALLLASPLFVYKELINTDTPALLQQIGLQDTIPYCIEDWPSRNGRFYYSIFSLCVQYLVPILIVSVAYFGIYNKLKSRI-TVVAVQASSAQRKVERGRRMKRTNCLLISIAIIFGVSWLPLNFFNLYADMERSPVTQSML-----VRYAICHMIGMSSACSNPLLYGWLNDNFRCNVQAAARRRRKLGAELSKGELKLLGPGGAQSGTAGGEGGLAATDFMTGHHE 433          
BLAST of Neuropeptide Y receptor, invertebrate vs. Ensembl Fly
Match: sNPF-R (gene:FBgn0036934 transcript:FBtr0332667)

HSP 1 Score: 142.51 bits (358), Expect = 5.675e-36
Identity = 76/146 (52.05%), Postives = 105/146 (71.92%), Query Frame = 3
Query:  438 YSIIFVLGVVGNSFVIFVVMRSRHMRTITNIFISNLALSDIIMCLIAVPFTPIALFMNNWTLPASLCKVLPMTMGVSVYVSTLTSTAIAIDRFFIIVHPFIPRMKNSLCGFXXXXXXXXXXXXSLPLAVYQTKRNDLQSNTSKCQE 875
            Y+ +FVLGV GN  V +VV+R+R M+T+TNIFI+NLALSDI++C++AVPFTP+  FM  W    SLC ++    G S+Y+STLT T+IAIDR+F+I++PF PRMK S C  II  IW+IA+L ++P  +Y    N+L + T    E
Sbjct:   70 YATVFVLGVFGNVLVCYVVLRNRAMQTVTNIFITNLALSDILLCVLAVPFTPLYTFMGRWAFGRSLCHLVSFAQGCSIYISTLTLTSIAIDRYFVIIYPFHPRMKLSTCIGIIVSIWVIALLATVPYGMYMKMTNELVNGTQTGNE 215          
BLAST of Neuropeptide Y receptor, invertebrate vs. Ensembl Zebrafish
Match: npy2rl (neuropeptide Y receptor Y2, like [Source:ZFIN;Acc:ZDB-GENE-111115-4])

HSP 1 Score: 173.326 bits (438), Expect = 1.874e-48
Identity = 114/334 (34.13%), Postives = 184/334 (55.09%), Query Frame = 3
Query:  411 GLQYLVIAGYSIIFVLGVVGNSFVIFVVMRSRHMRTITNIFISNLALSDIIMCLIAVPFTPIALFMNNWTLPASLCKVLPMTMGVSVYVSTLTSTAIAIDRFFIIVHPFIPRMKNSLCGFXXXXXXXXXXXXSLPLAVYQTKR-NDLQSNTS--KCQEVWPIDSSRE--VFTFVSFVLQFVLPCSIISVCYFKISKILRERCKSKVGSGTKSXXXXXXXXXXXXXTNKMLIAMVTIFVICWIPLNSLWMATDMSMNFKYDLRLQFFFPIGFFICHMIAMSSAVYNPFLYAWLNDNFKREFRNLVPCLSCILKPVLPNNPSVTCRPDSRIATTYQ 1397
            G+Q ++I  YS I +LGVVGNS VI+VV + + +RT+TN FI+NLA++D+++  + +PFT     +  W     LC  LP   G++V+VST+T   IA+DR   IV+    RM    C  +I + W+++ +++ PLA+++     DL  + S   C E WP DSS +  +++  + +LQ+VLP +IIS  Y +I   LR    S VG   +          R+RKT KML+ MV +F + W+P ++  +A D+  +   D++    F + + + H++AM S   NP LY W+N N++  F  +  C   +        P+ T R   + A   Q
Sbjct:   42 GVQVVLILAYSTIILLGVVGNSLVIYVVYKFKTLRTVTNFFIANLAVADLLVNTLCLPFTLAYTLLREWKFGQVLCFTLPYAQGLAVHVSTITLNVIALDRHRCIVYHLDTRMSKDTCFLVIAITWVVSAVLASPLAIFREYGIVDLSPDNSIEVCGEKWP-DSSTDSTLYSISTLLLQYVLPLAIISFAYIRIWSKLRNHV-SPVGRNDRH--------HRRRKTTKMLVTMVVVFAVSWLPFHAFQLAIDIDHSV-LDMK---DFRLLYTVFHIVAMCSTFANPLLYGWMNRNYRSAFVAVFRCKERLDSLHTEGQPAATVRSKPKKALEAQ 361          
BLAST of Neuropeptide Y receptor, invertebrate vs. Ensembl Zebrafish
Match: npy2r (neuropeptide Y receptor Y2 [Source:ZFIN;Acc:ZDB-GENE-040924-8])

HSP 1 Score: 150.214 bits (378), Expect = 7.182e-40
Identity = 99/305 (32.46%), Postives = 168/305 (55.08%), Query Frame = 3
Query:  411 GLQYLVIAGYSIIFVLGVVGNSFVIFVVMRSRHMRTITNIFISNLALSDIIMCLIAVPFTPIALFMNNWTLPASLCKVLPMTMGVSVYVSTLTSTAIAIDRFFIIVHPFIPRMKNSLCGFXXXXXXXXXXXXSLPLAVYQTKRN-DL--QSNTSKCQEVWPIDSSR-EVFTFVSFVLQFVLPCSIISVCYFKISKILRERCKSKVGSGTKSXXXXXXXXXXXXXTNKMLIAMVTIFVICWIPLNSLWMATDMSMNFKYDLRLQFFFPIGFFICHMIAMSSAVYNPFLYAWLNDNFKREFRNLVPC 1313
            G+Q ++I  YS I   G+ GNS VI+VV + R++ T+TN FI NLA++D+++  + +PFT +      W     +C +LP   G++V+VST+T   IA+DR+  IV+    +M   +C  +I + W+ + +++ PLA+++     DL  +     C E WP  S+   +++   F LQ+ LP SIIS  Y +I   LR       G   +         +R++KT KML+A+V +F + W+P ++  +A D+  +   ++R    F + +   H++AM S   NP LY W+N N++  F  +  C
Sbjct:   53 GVQVILILAYSTIIFFGMTGNSLVIYVVYKFRNLHTVTNYFIVNLAVADLLVNTLCLPFTLMYTLYGEWKFGQVMCYLLPYAQGLAVHVSTITLNVIALDRYRSIVYHMETKMSKDMCVVVIAITWVASAILASPLAIFREYVTFDLSPEQTIQGCAEKWPGSSTDGTIYSIAMFFLQYGLPLSIISFAYTRIWNKLRNHVSPGGGRSDRH--------QRRQKTTKMLVAVVVVFTVSWLPFHAFQLAVDIDSSV-LEIR---DFKLLYTAFHIVAMCSTFANPILYGWMNRNYRGSFVAVFKC 345          
BLAST of Neuropeptide Y receptor, invertebrate vs. Ensembl Zebrafish
Match: npy2r (neuropeptide Y receptor Y2 [Source:ZFIN;Acc:ZDB-GENE-040924-8])

HSP 1 Score: 149.828 bits (377), Expect = 8.779e-40
Identity = 99/305 (32.46%), Postives = 168/305 (55.08%), Query Frame = 3
Query:  411 GLQYLVIAGYSIIFVLGVVGNSFVIFVVMRSRHMRTITNIFISNLALSDIIMCLIAVPFTPIALFMNNWTLPASLCKVLPMTMGVSVYVSTLTSTAIAIDRFFIIVHPFIPRMKNSLCGFXXXXXXXXXXXXSLPLAVYQTKRN-DL--QSNTSKCQEVWPIDSSR-EVFTFVSFVLQFVLPCSIISVCYFKISKILRERCKSKVGSGTKSXXXXXXXXXXXXXTNKMLIAMVTIFVICWIPLNSLWMATDMSMNFKYDLRLQFFFPIGFFICHMIAMSSAVYNPFLYAWLNDNFKREFRNLVPC 1313
            G+Q ++I  YS I   G+ GNS VI+VV + R++ T+TN FI NLA++D+++  + +PFT +      W     +C +LP   G++V+VST+T   IA+DR+  IV+    +M   +C  +I + W+ + +++ PLA+++     DL  +     C E WP  S+   +++   F LQ+ LP SIIS  Y +I   LR       G   +         +R++KT KML+A+V +F + W+P ++  +A D+  +    L ++  F + +   H++AM S   NP LY W+N N++  F  +  C
Sbjct:   53 GVQVILILAYSTIIFFGMTGNSLVIYVVYKFRNLHTVTNYFIVNLAVADLLVNTLCLPFTLMYTLYGEWKFGQVMCYLLPYAQGLAVHVSTITLNVIALDRYRSIVYHMETKMSKDMCVVVIAITWVASAILASPLAIFREYVTFDLSPEQTIQGCAEKWPGSSTDGTIYSIAMFFLQYGLPLSIISFAYTRIWNKLRNHVSPGGGRSDRH--------QRRQKTTKMLVAVVVVFTVSWLPFHAFQLAVDIDSSV---LEMK-DFKLLYTAFHIVAMCSTFANPILYGWMNRNYRGSFVAVFKC 345          
BLAST of Neuropeptide Y receptor, invertebrate vs. Ensembl Zebrafish
Match: prlhr2a (prolactin releasing hormone receptor 2a [Source:ZFIN;Acc:ZDB-GENE-060209-1])

HSP 1 Score: 149.443 bits (376), Expect = 8.861e-40
Identity = 105/330 (31.82%), Postives = 171/330 (51.82%), Query Frame = 3
Query:  375 SNGTNDIFKNHEGLQY---LVIAGYSIIFVLGVVGNSFVIFVVMRSRHMRTITNIFISNLALSDIIMCLIAVPFTPIALFM-NNWTLPASLCKVLPMTMGVSVYVSTLTSTAIAIDRFFIIVHPFIPRMKNSLCGFXXXXXXXXXXXXSLPLAVYQTKRNDLQSNTSKCQEVW-PIDSSREVFTFVSFVLQFVLPCSIISVCYFKISKILRERCKSKVGSGTKSXXXXXXXXXXXXXTNKMLIAMVTIFVICWIPLNSLWMATDMSMNFKYDLRLQFFFPIGFFICHMIAMSSAVYNPFLYAWLNDNFKREFRNLVPCLSCILKPVLPNN 1349
            S   N  F   E LQ    L+I  Y+++ ++GV GN  +++V+ +++ M  +TN FI NLA SD++MC   VPFT    F    W     +C ++ +   V+VYVS  T TAI +DR++  VHP   R+    C +++  IWI++  +  P   +           + C+E W   +  R  + + +  + +VLP S + + Y  IS  LR    + V  G ++    E +  RKRKT +++  +V  F ICW+P++   +  D+ +    DL  + +F +   +CH+  MSS+  NPFLYAWL+D F+ E R +  C   I   +  NN
Sbjct:   41 STKRNPQFVGVELLQSFKPLIIPCYALVVLVGVFGNYLLLYVICQTKKMHNVTNFFIGNLAFSDMLMCATCVPFTLAYAFNPRGWVFGRFMCYLVFLIQPVTVYVSVFTLTAIGVDRYYATVHPLKKRISVLACTYLLSGIWILSCGLVAPAVAHTYHVEFKDEGFTICEEFWMGQEKERLAYAYSTLFITYVLPLSALCISYLCISVKLR----NCVVPGHRTQSQAEAQRARKRKTFRLVSLVVAAFGICWLPISVFNVLRDIDI----DLIDKRYFLLIQLLCHLCGMSSSCCNPFLYAWLHDRFRAELRKMFTCHRRIGIGIPANN 362          
BLAST of Neuropeptide Y receptor, invertebrate vs. Ensembl Zebrafish
Match: npffr1l3 (neuropeptide FF receptor 1 like 3 [Source:ZFIN;Acc:ZDB-GENE-070424-44])

HSP 1 Score: 150.984 bits (380), Expect = 1.060e-39
Identity = 110/361 (30.47%), Postives = 180/361 (49.86%), Query Frame = 3
Query:  435 GYSIIFVLGVVGNSFVIFVVMRSRHMRTITNIFISNLALSDIIMCLIAVPFTPIALFMNNWTLPASLCKVLPMTMGVSVYVSTLTSTAIAIDRFFIIVHPFIPRMKNSLCGFXXXXXXXXXXXXSLP----LAVYQTKR-----NDLQSNT---SKCQEVWPIDSSREVFTFVSFVLQFVLPCSIISVCYFKISKILRERCKSKVGSGTKSXXXXXXXXXXXXXTNKMLIAMVTIFVICWIPLNSLWMATDMSM--NFKYDLRLQFFFPIGFFICHMIAMSSAVYNPFLYAWLNDNFKREFRNLVPCLSCIL-------------KPVLPNNPSVTCRPDSRIATTYQMTTCEQEEDSSKK 1436
             Y  IF+L ++GN+ V  +V+R+RHMRT+TNIFI NLA+SD+++ +  +P T +   +  W    ++CK+  +  G+SV  S  T  AIA+DRF  IV+PF P++   +    I  IW++A+ I  P    L V Q +      ND  +NT     C E WP    R+++T V F+  +V+P ++I + Y +I   L     S+  +     + +           KMLI +  +F++ W+PL +L M TD     N   ++   + FP+     H +A S++  NP +Y + N+NFKR F+ +    +C               +   P N  V     +RI T   +T C + E   ++
Sbjct:   57 AYLFIFLLCLMGNALVCVIVLRNRHMRTVTNIFILNLAVSDLLVGIFCIPTTLVDNLITGWPFSNTVCKLSGLVQGMSVSASVFTLVAIAVDRFRCIVYPFKPKLTLFIAKVSIGTIWLLALTIMFPSVLMLTVEQERAHFMIYNDDYNNTYPLYSCYETWPDPEMRKIYTTVLFIHIYVIPLALIMLMYGRIGAKLYSAAVSEHANAQGKRKIRVV---------KMLIMVALLFMLSWLPLWTLMMLTDYGHPDNDSLEILTSYIFPLS----HWLAFSNSSVNPIIYGYFNENFKRGFQAVFQRQACFRRRRKMRFRVKRPRQGCSPLNTGVLGSKTNRIFTESDLTGCVRLELEHRR 404          
BLAST of Neuropeptide Y receptor, invertebrate vs. Ensembl Xenopus
Match: taf1b (TATA-box binding protein associated factor, RNA polymerase I, B [Source:Xenbase;Acc:XB-GENE-992275])

HSP 1 Score: 165.236 bits (417), Expect = 2.626e-45
Identity = 108/327 (33.03%), Postives = 176/327 (53.82%), Query Frame = 3
Query:  411 GLQYLVIAGYSIIFVLGVVGNSFVIFVVMRSRHMRTITNIFISNLALSDIIMCLIAVPFTPIALFMNNWTLPASLCKVLPMTMGVSVYVSTLTSTAIAIDRFFIIVHPFIPRMKNSLCGFXXXXXXXXXXXXSLPLAVYQTKR-NDLQSNTSK---CQEVWPIDSSREVFTFVSFVLQFVLPCSIISVCYFKISKILRERCKSKVGSGTKSXXXXXXXXXXXXXTNKMLIAMVTIFVICWIPLNSLWMATDMSMNFKYDLRLQFFFPIGFFICHMIAMSSAVYNPFLYAWLNDNFKREFRNLVPCLSCILKPVLPNN-PSVTCRPDS 1376
            G+Q ++IA YS+I +LG+VGNS VI+++++ ++MRT+TN FI+NLA++D+++    +PFT +   M+ W   + LC + P    +SV VSTLT   IA+DR++ IV     R+  +L   II + WI A ++++PLAV++  R  DL     K   C E W  +    +++    +LQ+ LP ++I   Y +I   L+        S ++          R++ T KML+ MV +F +CW+P +   +A D+               + + I H++AM S   NPFLY W+N N++  F     C     K  L N+ P  + R  S
Sbjct:   37 GVQVILIAAYSLIILLGLVGNSLVIYMIVKYKNMRTVTNFFIANLAIADLMVDSFCLPFTLVYTLMDEWKFGSVLCHLFPYAQAMSVNVSTLTLIVIALDRYWCIVFHLNSRISKNLSFLIISITWITAAILAIPLAVFREFRYEDLPPFNLKIAVCAENWT-NRDSTIYSLSMLILQYALPLAVICYAYLRIWFKLKNHISPTTRSESQQ---------RRKNTTKMLVMMVVVFAVCWLPFHIFQLAIDLEWTVAIHEN-----KLLYTIFHVVAMCSTFVNPFLYGWMNKNYRHGFLTFFGC-----KDTLQNSQPDGSLRGHS 343          
BLAST of Neuropeptide Y receptor, invertebrate vs. Ensembl Xenopus
Match: ENSXETT00000044281.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:3:115219157:115249407:-1 gene:ENSXETG00000019365.1 transcript:ENSXETT00000044281.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 157.532 bits (397), Expect = 9.121e-43
Identity = 99/299 (33.11%), Postives = 163/299 (54.52%), Query Frame = 3
Query:  423 LVIAGYSIIFVLGVVGNSFVIFVVMRSRHMRTITNIFISNLALSDIIMCLIAVPFT-PIALFMNNWTLPASLCKVLPMTMGVSVYVSTLTSTAIAIDRFFIIVHPFIPRMKNSLCGFXXXXXXXXXXXXSLPLAVYQTKRNDLQSNTSKCQEVW-PIDSSREVFTFVSFVLQFVLPCSIISVCYFKISKILRERCKSKVGSGTKSXXXXXXXXXXXXXTNKMLIAMVTIFVICWIPLNSLWMATDMSMNF---KYDLRLQFFFPIGFFICHMIAMSSAVYNPFLYAWLNDNFKREFRNL 1304
            L I  Y+++ ++G+ GN  +++V+ R+R M  +TN FI NLA SD++MC   VPFT   A     W     +C  + +   V+VYVS  T TAIA+DR++  VHP   R+  + C +++  IW+++  +  P   +       Q   + C+E W   ++ R  + + + ++ ++LP S +S+ Y  I+  L+ R    V  G  +    E +  RKRK  ++++ +VT F ICW+P++   +  D+ +N     Y L +Q F       CH  AMSS+  NPFLYAWL+D F+ E R +
Sbjct:   36 LFIPCYTLVVLIGIFGNYLLLYVICRTRKMHNVTNFFIGNLAFSDMLMCATCVPFTLAYAFNPQGWVFGKFMCYFVFLMQPVTVYVSVFTLTAIAVDRYYATVHPLKKRISVTTCIYVLMGIWLLSCALVGPAIAHTYHVEFQQEGFTICEEFWMGKETERLAYAYSTLIITYILPLSAVSLSYICITVKLKNR----VVPGHPTQSQAEFDRLRKRKIFRLIVLVVTAFGICWLPIHVFNIIRDIDINLINKHYFLHIQLF-------CHWFAMSSSCCNPFLYAWLHDRFRSELRKM 323          
BLAST of Neuropeptide Y receptor, invertebrate vs. Ensembl Xenopus
Match: NPY2R (neuropeptide Y receptor Y2 [Source:NCBI gene;Acc:100498351])

HSP 1 Score: 147.902 bits (372), Expect = 9.968e-39
Identity = 100/307 (32.57%), Postives = 174/307 (56.68%), Query Frame = 3
Query:  414 LQYLVIAGYSIIFVLGVVGNSFVIFVVMRSRHMRTITNIFISNLALSDIIMCLIAVPFTPIALFMNNWTLPASLCKVLPMTMGVSVYVSTLTSTAIAIDRFFIIVHPFIPRMKNSLCGFXXXXXXXXXXXXSLPLAVYQTK-----RNDLQSNTSKCQEVWPID--SSREVFTFVSFVLQFVLPCSIISVCYFKISKILRERCKSKVGSGTKSXXXXXXXXXXXXXTNKMLIAMVTIFVICWIPLNSLWMATDMSMNFKYDLRLQFFFPIGFFICHMIAMSSAVYNPFLYAWLNDNFKREFRNLVPC 1313
            +Q ++I  YS I +LGV+GNS VI+VV++ + MRT+TN FI NLA+SD+++  + +PFT +   +++W     LC ++  + G++V VST+T   IA+DR   IV+    ++   +C  II + W+ + L++ PLA+++        +D Q     C E WP+   +   +++    ++Q+++P +IIS  Y +I   L+       G+            +R+RKT KML+A+V +F +CW+P ++  +A+D+      DL     + + + I H+IAM S   NP LY W+N+N++  F     C
Sbjct:   72 VQVVLILAYSSIILLGVLGNSLVIYVVIKFKTMRTVTNFFIVNLAVSDLMVNTLCLPFTLVYTLLDDWKFGTVLCHLVTYSQGLAVQVSTVTLMVIALDRHRCIVYHLESKISTKICFMIIGITWVCSALLASPLAIFKEYSVIVISSDFQ--IQACSERWPVGDLNYGTIYSISMLLIQYIVPLAIISYAYIRIWTKLKNHVSPGGGND--------HYHQRRRKTTKMLVAVVVVFAVCWLPFHAFQLASDIDGKV-LDLNE---YKLIYTIFHVIAMCSTFANPLLYGWMNNNYRTAFLTAFKC 364          
BLAST of Neuropeptide Y receptor, invertebrate vs. Ensembl Xenopus
Match: gamt (guanidinoacetate N-methyltransferase [Source:Xenbase;Acc:XB-GENE-947462])

HSP 1 Score: 145.591 bits (366), Expect = 9.014e-38
Identity = 114/346 (32.95%), Postives = 177/346 (51.16%), Query Frame = 3
Query:  414 LQYLVIAGYSIIFVLGVVGNSFVIFVVMRSRHMRTITNIFISNLALSDIIMCLIAVPFTPIALFMNNWTLPASLCKVLPMTMGVSVYVSTLTSTAIAIDRFFIIVHPFIPRMKNSLCGFXXXXXXXXXXXXSLPLAVYQTKRNDLQSNTSKCQEV----WPIDSSREVFTFVSFVLQFVLPCSIISVCYFKISKILRERCKSKVGSGTKSXXXXXXXXXXXXXTNKMLIAMVTIFVICWIPLNSLWMATDMSMNFKYDLRLQFFFPIGFFICHMIAMSSAVYNPFLYAWLNDNFKREFRNLVPCLSCILKPVLPNNPSVTCRPDSRIATTYQMTTCEQEEDSSKKT 1439
            ++ L+I  YS+I V+ + GN  V  VV+++  M++ T++FI NLA++DI++ L+  PFT +    + W     +C V       SV+VS LT  AIA+DR  +I+HP  PRM        I VIW +A   SLP AVYQ        NT +   +    +P D   +     +FVL +VLP  +IS+ Y  ++K L  R       G  ++       ++K+ T KML+ +V +F +CW PLN  ++    S     +  + F F       H  AMSS  YNPF+Y WLN++F+ E + L+ C+ C  +    ++P  +  P  R A T     C  ++ SS + 
Sbjct:   68 VKALLIVAYSVIIVISLFGNILVCHVVIKNSRMQSATSLFIVNLAVADIMITLLNTPFTLVRFVSSTWVFGKLMCHVSRFVQYCSVHVSVLTLMAIALDRHQVIMHPLKPRMSTVKGIICIIVIWFMASGFSLPHAVYQKLEQFFIGNTVRMVCLPSFPYPADLFWKYLDLATFVLLYVLPLIVISITYTTVAKKLWLRN----AIGDITMEQYYAHRRKKKMTLKMLMLVVVVFAVCWFPLNC-YLVLMSSKVISSNNAIYFAF-------HWFAMSSTCYNPFIYCWLNESFRSELKALL-CV-CRRRSPAQSHPLQSVSPQFRHAWT---ENCHFKQGSSSQA 396          
BLAST of Neuropeptide Y receptor, invertebrate vs. Ensembl Xenopus
Match: GPR83 (G protein-coupled receptor 83 [Source:NCBI gene;Acc:100486806])

HSP 1 Score: 145.206 bits (365), Expect = 1.171e-37
Identity = 119/331 (35.95%), Postives = 178/331 (53.78%), Query Frame = 3
Query:  414 LQYLVIAGYSIIFVLGVVGNSFVIFVVMRSRHMRTITNIFISNLALSDIIMCLIAVPFTPIALFMNN-WTLPASLCKVLPMTMGVSVYVSTLTSTAIAIDRFFIIVHPFIPRMKNSLCGFXXXXXXXXXXXXSLPLAVYQ---TKRNDLQSNTSKCQEVWPIDSS--REVFTFVSFVLQFVLPCSIISVCYFKISKILRERCKSKVGSGTKSXXXXXXXXXXXXXTNKMLIAMVTIFVICWIPLNSLWMATDMSMNFKYDLRLQFFFPIGFFICHMIAMSSAVYNPFLYAWLNDNFKREFRNLVPCLSCILKPVLPNNPSV-TCRPDSRIA 1385
            ++ L+I  YS I V  + GN  V  VV++++ M + T++FI NLA++DI++ L+  PFT +A F+N+ W     +C V       S++VS LT TAIA+DR  +I+HP  PR+        I +IWI+A   SLP A+YQ   T     ++  S C   +P  S    +     +F+L +VLP  IISV Y  ++K L  R  + +G  T          ++K+KT KML+ +V +F +CW PLN  ++    S   + +  L F F       H  AMSS  YNPF+Y WLNDNF+ E + L   L+   KP  P+   + +  P  R+A
Sbjct:   70 VKALLIVAYSFIIVFSLFGNVLVCHVVIKNKRMHSATSLFIVNLAVADILITLLNTPFT-LARFVNSTWMFGKGMCHVSRFAQYCSLHVSALTLTAIAVDRHQVIMHPLKPRISTVKGVAYIAIIWIMATCFSLPHAIYQKLFTFEYSEENIRSLCLPDFPEPSDLFWKYLDLATFILLYVLPLLIISVAYTTVAKKLWLR--NAIGDVTTE--QYFALRRKKKKTIKMLMLVVVLFAVCWFPLNC-YVVLLSSQTIRTNNALYFAF-------HWFAMSSTCYNPFIYCWLNDNFRSELKAL---LNMCKKPTGPSEHMLPSSVPSYRVA 384          
BLAST of Neuropeptide Y receptor, invertebrate vs. Ensembl Mouse
Match: Prlhr (prolactin releasing hormone receptor [Source:MGI Symbol;Acc:MGI:2135956])

HSP 1 Score: 154.066 bits (388), Expect = 1.971e-41
Identity = 102/304 (33.55%), Postives = 166/304 (54.61%), Query Frame = 3
Query:  414 LQYLVIAGYSIIFVLGVVGNSFVIFVVMRSRHMRTITNIFISNLALSDIIMCLIAVPFTPIALFM-NNWTLPASLCKVLPMTMGVSVYVSTLTSTAIAIDRFFIIVHPFIPRMKNSLCGFXXXXXXXXXXXXSLPLAVYQTKRNDLQSNTSKCQEVW-PIDSSREVFTFVSFVLQFVLPCSIISVCYFKISKILRERCKSKVGSGTKSXXXXXXXXXXXXXTNKMLIAMVTIFVICWIPLNSLWMATDMSMNFKYDLRLQFFFPIGF----FICHMIAMSSAVYNPFLYAWLNDNFKREFRNLV 1307
            L+ L++  YSI+ V+G+VGN  ++ V+ R R +  +TN  I NLALSD++MC   VP T    F    W     LC ++     V+VYVS  T T IA+DR+ ++VHP   R+   L  + +  IW ++ +++LP AV+         + S C+E W   +  R+++ +   +  ++LP   I + Y ++S  LR R    V  G+ +    + +  R+R+T  +L+ +V +F +CW+PL+          N   DL  +   P  F     +CH +AMSSA YNPF+YAWL+D+F+ E R ++
Sbjct:   59 LKGLIVMLYSIVVVVGLVGNCLLVLVIARVRRLHNVTNFLIGNLALSDVLMCAACVPLTLAYAFEPRGWVFGGGLCHLVFFLQPVTVYVSVFTLTTIALDRYVVLVHPLRRRISLRLSAYAVLGIWALSAVLALPAAVHTYHVELKPHDVSLCEEFWGSQERQRQIYAWGLLLGTYLLPLLAILLSYVRVSVKLRNR----VVPGSVTQSQADWDRARRRRTFCLLVVVVVVFAVCWLPLHIF--------NLLRDLDPRAIDPYAFGLVQLLCHWLAMSSACYNPFIYAWLHDSFREELRKML 350          
BLAST of Neuropeptide Y receptor, invertebrate vs. Ensembl Mouse
Match: Npy2r (neuropeptide Y receptor Y2 [Source:MGI Symbol;Acc:MGI:108418])

HSP 1 Score: 142.51 bits (358), Expect = 4.753e-37
Identity = 102/308 (33.12%), Postives = 167/308 (54.22%), Query Frame = 3
Query:  414 LQYLVIAGYSIIFVLGVVGNSFVIFVVMRSRHMRTITNIFISNLALSDIIMCLIAVPFTPIALFMNNWTLPASLCKVLPMTMGVSVYVSTLTSTAIAIDRFFIIVHPFIPRMKNSLCGFXXXXXXXXXXXXSLPLAVYQTKR-----NDLQSNTSKCQEVWPIDSSR---EVFTFVSFVLQFVLPCSIISVCYFKISKILRERCKSKVGSGTKSXXXXXXXXXXXXXTNKMLIAMVTIFVICWIPLNSLWMATDMSMNFKYDLRLQFFFPIGFFICHMIAMSSAVYNPFLYAWLNDNFKREFRNLVPC 1313
            +Q ++I  Y  I +LGVVGNS VI VV++ + MRT+TN FI+NLA++D+++  + +PFT     M  W +   LC ++P   G++V VST+T T IA+DR   IV+    ++   +   II + W I+ L++ PLA+++         D +     C E WP +       V++  + ++ +VLP  IIS  Y +I   LR    + V  G  S    +   K      KML+ +V +F + W+PL++  +A D+  +   DL+    + + F + H+IAM S   NP LY W+N N+++ F +   C
Sbjct:   49 VQVILILAYCSIILLGVVGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEWKMGPVLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKRISFLIIGLAWGISALLASPLAIFREYSLIEIIPDFE--IVACTEKWPGEEKSVYGTVYSLSTLLILYVLPLGIISFSYTRIWSKLR----NHVSPGAASDHYHQRRHKM----TKMLVCVVVVFAVSWLPLHAFQLAVDIDSHV-LDLK---EYKLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAFLSAFRC 342          
BLAST of Neuropeptide Y receptor, invertebrate vs. Ensembl Mouse
Match: Npy2r (neuropeptide Y receptor Y2 [Source:MGI Symbol;Acc:MGI:108418])

HSP 1 Score: 142.51 bits (358), Expect = 4.753e-37
Identity = 102/308 (33.12%), Postives = 167/308 (54.22%), Query Frame = 3
Query:  414 LQYLVIAGYSIIFVLGVVGNSFVIFVVMRSRHMRTITNIFISNLALSDIIMCLIAVPFTPIALFMNNWTLPASLCKVLPMTMGVSVYVSTLTSTAIAIDRFFIIVHPFIPRMKNSLCGFXXXXXXXXXXXXSLPLAVYQTKR-----NDLQSNTSKCQEVWPIDSSR---EVFTFVSFVLQFVLPCSIISVCYFKISKILRERCKSKVGSGTKSXXXXXXXXXXXXXTNKMLIAMVTIFVICWIPLNSLWMATDMSMNFKYDLRLQFFFPIGFFICHMIAMSSAVYNPFLYAWLNDNFKREFRNLVPC 1313
            +Q ++I  Y  I +LGVVGNS VI VV++ + MRT+TN FI+NLA++D+++  + +PFT     M  W +   LC ++P   G++V VST+T T IA+DR   IV+    ++   +   II + W I+ L++ PLA+++         D +     C E WP +       V++  + ++ +VLP  IIS  Y +I   LR    + V  G  S    +   K      KML+ +V +F + W+PL++  +A D+  +   DL+    + + F + H+IAM S   NP LY W+N N+++ F +   C
Sbjct:   49 VQVILILAYCSIILLGVVGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEWKMGPVLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKRISFLIIGLAWGISALLASPLAIFREYSLIEIIPDFE--IVACTEKWPGEEKSVYGTVYSLSTLLILYVLPLGIISFSYTRIWSKLR----NHVSPGAASDHYHQRRHKM----TKMLVCVVVVFAVSWLPLHAFQLAVDIDSHV-LDLK---EYKLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAFLSAFRC 342          
BLAST of Neuropeptide Y receptor, invertebrate vs. Ensembl Mouse
Match: Npy2r (neuropeptide Y receptor Y2 [Source:MGI Symbol;Acc:MGI:108418])

HSP 1 Score: 142.51 bits (358), Expect = 4.753e-37
Identity = 102/308 (33.12%), Postives = 167/308 (54.22%), Query Frame = 3
Query:  414 LQYLVIAGYSIIFVLGVVGNSFVIFVVMRSRHMRTITNIFISNLALSDIIMCLIAVPFTPIALFMNNWTLPASLCKVLPMTMGVSVYVSTLTSTAIAIDRFFIIVHPFIPRMKNSLCGFXXXXXXXXXXXXSLPLAVYQTKR-----NDLQSNTSKCQEVWPIDSSR---EVFTFVSFVLQFVLPCSIISVCYFKISKILRERCKSKVGSGTKSXXXXXXXXXXXXXTNKMLIAMVTIFVICWIPLNSLWMATDMSMNFKYDLRLQFFFPIGFFICHMIAMSSAVYNPFLYAWLNDNFKREFRNLVPC 1313
            +Q ++I  Y  I +LGVVGNS VI VV++ + MRT+TN FI+NLA++D+++  + +PFT     M  W +   LC ++P   G++V VST+T T IA+DR   IV+    ++   +   II + W I+ L++ PLA+++         D +     C E WP +       V++  + ++ +VLP  IIS  Y +I   LR    + V  G  S    +   K      KML+ +V +F + W+PL++  +A D+  +   DL+    + + F + H+IAM S   NP LY W+N N+++ F +   C
Sbjct:   49 VQVILILAYCSIILLGVVGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEWKMGPVLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKRISFLIIGLAWGISALLASPLAIFREYSLIEIIPDFE--IVACTEKWPGEEKSVYGTVYSLSTLLILYVLPLGIISFSYTRIWSKLR----NHVSPGAASDHYHQRRHKM----TKMLVCVVVVFAVSWLPLHAFQLAVDIDSHV-LDLK---EYKLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAFLSAFRC 342          
BLAST of Neuropeptide Y receptor, invertebrate vs. Ensembl Mouse
Match: Npy6r (neuropeptide Y receptor Y6 [Source:MGI Symbol;Acc:MGI:1098590])

HSP 1 Score: 142.124 bits (357), Expect = 5.414e-37
Identity = 91/301 (30.23%), Postives = 166/301 (55.15%), Query Frame = 3
Query:  438 YSIIFVLGVVGN-SFVIFVVMRSRHMRTITNIFISNLALSDIIMCLIAVPFTPIALFMNNWTLPASLCKVLPMTMGVSVYVSTLTSTAIAIDRFFIIVHP--FIPRMKNSLCGFXXXXXXXXXXXXSLPLAVYQTKR--------NDLQSNTSKCQEVWPIDSSREVFTFVSFVLQFVLPCSIISVCYFKISKILRERCKSKVGSGTKSXXXXXXXXXXXXXTNKMLIAMVTIFVICWIPLNSLWMATDMSMNFKYDLRLQFFFPIGFFICHMIAMSSAVYNPFLYAWLNDNFKREFRNLV 1307
            Y++I ++G+ GN S +I +  + R  + +TNI I+NL+LSDI++C++ +PFT I   M++W    ++CK+      VSV VS  +   IAI+R+ +IV+P  + PR+ ++  G I+  +  + + I L L+ + T           D+ ++   C E+WP   ++ +F+   F+LQ+ +P   I +CY KI   LR+R +          +  +  +   ++ N MLI++V  F  CW+PLN      ++  ++ +++ +     + F +CH+IAM S   NP  Y +LN NF+++   L+
Sbjct:   42 YTVILIMGIFGNLSLIIIIFKKQREAQNVTNILIANLSLSDILVCVMCIPFTVIYTLMDHWVFGNTMCKLTSYVQSVSVSVSIFSLVLIAIERYQLIVNPRGWKPRVAHAYWGIILIWLISLTLSIPLFLSYHLTNEPFHNLSLPTDIYTHQVACVEIWPSKLNQLLFSTSLFMLQYFVPLGFILICYLKIVLCLRKRTRQ-----VDRRKENKSRLNENKRVNVMLISIVVTFGACWLPLNIF----NVIFDWYHEMLMSCHHDLVFVVCHLIAMVSTCINPLFYGFLNKNFQKDLMMLI 333          
BLAST of Neuropeptide Y receptor, invertebrate vs. UniProt/SwissProt
Match: sp|Q9VNM1|NPFR_DROME (Neuropeptide F receptor OS=Drosophila melanogaster OX=7227 GN=NPFR PE=1 SV=3)

HSP 1 Score: 158.303 bits (399), Expect = 3.926e-41
Identity = 108/308 (35.06%), Postives = 172/308 (55.84%), Query Frame = 3
Query:  420 YLVIAGYSIIFVLGVVGNSFVIFVVMRSRHMRTITNIFISNLALSDIIMCLIAVPFTPIALFMNNWTLPAS--LCKVLPMTMGVSVYVSTLTSTAIAIDRFFIIVHPFIPRMKNSLCGFXXXXXXXXXXXXSLPLAVYQTKRN----------DLQSNTSKCQEVWPIDSSREVFTFVSFVLQFVLPCSIISVCYFKISKILRERCKSKVGSGTKSXXXXXXXXXXXXXTNKMLIAMVTIFVICWIPLNSLWMATDMSMNFKYDLRLQFFFPIGFFICHMIAMSSAVYNPFLYAWLNDNFKREFRNLV 1307
            +++I+ Y ++ V G +GN+ V+  V+R   MRT  N+FI NLA+SD+++CL+ +P T + +    W   +   LCK + M   + ++VST++ TAIA DR+ +IV+P    ++      I+  IW +A+L++ PL VY+   N           LQ     C E WP  + R  ++  S  +Q+++P  I+SV YF I   L+ R  + V     S + K    +R ++TN +LI++  IF + W+PLN   +  DM  +      L     + + ICHMI MSSA  NP LY WLNDNF++EF+ L+
Sbjct:   87 HMLISMYGVLIVFGALGNTLVVIAVIRKPIMRTARNLFILNLAISDLLLCLVTMPLTLMEILSKYWPYGSCSILCKTIAMLQALCIFVSTISITAIAFDRYQVIVYPTRDSLQFVGAVTILAGIWALALLLASPLFVYKELINTDTPALLQQIGLQDTIPYCIEDWPSRNGRFYYSIFSLCVQYLVPILIVSVAYFGIYNKLKSRI-TVVAVQASSAQRKVERGRRMKRTNCLLISIAIIFGVSWLPLNFFNLYADMERSPVTQSML-----VRYAICHMIGMSSACSNPLLYGWLNDNFRKEFQELL 388          
BLAST of Neuropeptide Y receptor, invertebrate vs. UniProt/SwissProt
Match: sp|Q6VMN6|PRLHR_MOUSE (Prolactin-releasing peptide receptor OS=Mus musculus OX=10090 GN=Prlhr PE=2 SV=2)

HSP 1 Score: 154.066 bits (388), Expect = 1.379e-40
Identity = 102/304 (33.55%), Postives = 166/304 (54.61%), Query Frame = 3
Query:  414 LQYLVIAGYSIIFVLGVVGNSFVIFVVMRSRHMRTITNIFISNLALSDIIMCLIAVPFTPIALFM-NNWTLPASLCKVLPMTMGVSVYVSTLTSTAIAIDRFFIIVHPFIPRMKNSLCGFXXXXXXXXXXXXSLPLAVYQTKRNDLQSNTSKCQEVW-PIDSSREVFTFVSFVLQFVLPCSIISVCYFKISKILRERCKSKVGSGTKSXXXXXXXXXXXXXTNKMLIAMVTIFVICWIPLNSLWMATDMSMNFKYDLRLQFFFPIGF----FICHMIAMSSAVYNPFLYAWLNDNFKREFRNLV 1307
            L+ L++  YSI+ V+G+VGN  ++ V+ R R +  +TN  I NLALSD++MC   VP T    F    W     LC ++     V+VYVS  T T IA+DR+ ++VHP   R+   L  + +  IW ++ +++LP AV+         + S C+E W   +  R+++ +   +  ++LP   I + Y ++S  LR R    V  G+ +    + +  R+R+T  +L+ +V +F +CW+PL+          N   DL  +   P  F     +CH +AMSSA YNPF+YAWL+D+F+ E R ++
Sbjct:   59 LKGLIVMLYSIVVVVGLVGNCLLVLVIARVRRLHNVTNFLIGNLALSDVLMCAACVPLTLAYAFEPRGWVFGGGLCHLVFFLQPVTVYVSVFTLTTIALDRYVVLVHPLRRRISLRLSAYAVLGIWALSAVLALPAAVHTYHVELKPHDVSLCEEFWGSQERQRQIYAWGLLLGTYLLPLLAILLSYVRVSVKLRNR----VVPGSVTQSQADWDRARRRRTFCLLVVVVVVFAVCWLPLHIF--------NLLRDLDPRAIDPYAFGLVQLLCHWLAMSSACYNPFIYAWLHDSFREELRKML 350          
BLAST of Neuropeptide Y receptor, invertebrate vs. UniProt/SwissProt
Match: sp|Q64121|PRLHR_RAT (Prolactin-releasing peptide receptor OS=Rattus norvegicus OX=10116 GN=Prlhr PE=2 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 7.007e-40
Identity = 101/304 (33.22%), Postives = 165/304 (54.28%), Query Frame = 3
Query:  414 LQYLVIAGYSIIFVLGVVGNSFVIFVVMRSRHMRTITNIFISNLALSDIIMCLIAVPFT-PIALFMNNWTLPASLCKVLPMTMGVSVYVSTLTSTAIAIDRFFIIVHPFIPRMKNSLCGFXXXXXXXXXXXXSLPLAVYQTKRNDLQSNTSKCQEVW-PIDSSREVFTFVSFVLQFVLPCSIISVCYFKISKILRERCKSKVGSGTKSXXXXXXXXXXXXXTNKMLIAMVTIFVICWIPLNSLWMATDMSMNFKYDLRLQFFFPIGF----FICHMIAMSSAVYNPFLYAWLNDNFKREFRNLV 1307
            L+ L++  YSI+ V+G+VGN  ++ V+ R R +  +TN  I NLALSD++MC   VP T   A     W     LC ++     V+VYVS  T T IA+DR+ ++VHP   R+   L  + +  IW ++ +++LP AV+         +   C+E W   +  R+++ +   +  ++LP   I + Y ++S  LR R    V  G+ +    + +  R+R+T  +L+ +V +F +CW+PL+          N   DL  +   P  F     +CH +AMSSA YNPF+YAWL+D+F+ E R ++
Sbjct:   59 LKGLIVMLYSIVVVVGLVGNCLLVLVIARVRRLHNVTNFLIGNLALSDVLMCAACVPLTLAYAFEPRGWVFGGGLCHLVFFLQPVTVYVSVFTLTTIAVDRYVVLVHPLRRRISLKLSAYAVLGIWALSAVLALPAAVHTYHVELKPHDVRLCEEFWGSQERQRQIYAWGLLLGTYLLPLLAILLSYVRVSVKLRNR----VVPGSVTQSQADWDRARRRRTFCLLVVVVVVFALCWLPLHIF--------NLLRDLDPRAIDPYAFGLVQLLCHWLAMSSACYNPFIYAWLHDSFREELRKML 350          
BLAST of Neuropeptide Y receptor, invertebrate vs. UniProt/SwissProt
Match: sp|G4WMX4|RYAR_TRICA (RYamide receptor OS=Tribolium castaneum OX=7070 GN=RYa-R PE=2 SV=1)

HSP 1 Score: 148.288 bits (373), Expect = 1.994e-38
Identity = 109/347 (31.41%), Postives = 180/347 (51.87%), Query Frame = 3
Query:  426 VIAGYSIIFVLGVVGNSFVIFVVMRSRHMRTITNIFISNLALSDIIMCLIAVPFTPIALFMNNWTLPASLCKVLPMTMGVSVYVSTLTSTAIAIDRFFIIVHPFIPRMKNSLCGFXXXXXXXXXXXXSLPLAVYQTKRND---------LQSNTSKCQEVWPIDSSR--EVFTFVSFVLQFVLPCSIISVCYFKISKILRERCKSKVGSGTKSXXXXXXXXXXXXXTNKMLIAMVTIFVICWIPLNSLWMATDMSMNFKYDLRLQFFFPIGFFICHMIAMSSAVYNPFLYAWLNDNFKREFRNLVPCLSCILKPVLPNNPS--VTCRPDSRIATTYQMTTCEQEEDS 1427
            V + Y+IIFV+ ++GNSFV ++V+ S  MRT+TN FI NLA+ D+++ L+ VPFT ++L M  W     LC V+  +  +SV+VS  T  AI+ID++ II+ P  PR+      +II ++W+IA +  LP A + T  ND          Q +   C E +        +++T V   LQ+V+P  ++   Y  I  ++   C    G    S   +  + K K    KM++ +V ++ ICW+P N L +  +   +    + +  +FP+     H +AMS A YNP +Y ++N  F+  F  ++  + C+ +    N+ S  +TCR   R    Y+  T  Q   +
Sbjct:   33 VYSMYAIIFVVALIGNSFVCYIVLSSPPMRTVTNFFILNLAIGDVLITLLCVPFTSVSLLMQYWPFGGILCPVVNYSQALSVFVSAYTLVAISIDKYMIIMWPLKPRISKRFATYIIALVWLIAGITVLPSATFTTLINDENILGTSAYEQCDKYICAEEYSKVGQEYGDLYTKVLMFLQYVIPSLVLLFTYTSIGVVI--WCHRIPGEAENSRDQRIAKNKTKMI--KMMVTVVCVYTICWLPYNVLMIFKE---HISGSVMVYLYFPL-----HGLAMSHACYNPIIYCYMNARFRNGFLQVMMSIPCLRRCNSINDISKILTCRWKVRRVHLYREITRAQPTSA 367          
BLAST of Neuropeptide Y receptor, invertebrate vs. UniProt/SwissProt
Match: sp|Q4EW11|PRLHR_BOVIN (Prolactin-releasing peptide receptor OS=Bos taurus OX=9913 GN=PRLHR PE=3 SV=1)

HSP 1 Score: 147.902 bits (372), Expect = 2.872e-38
Identity = 106/323 (32.82%), Postives = 176/323 (54.49%), Query Frame = 3
Query:  414 LQYLVIAGYSIIFVLGVVGNSFVIFVVMRSRHMRTITNIFISNLALSDIIMCLIAVPFTPIALFM-NNWTLPASLCKVLPMTMGVSVYVSTLTSTAIAIDRFFIIVHPFIPRMKNSLCGFXXXXXXXXXXXXSLPLAVYQTKRNDLQSNTSK-CQEVW-PIDSSREVFTFVSFVLQFVLPCSIISVCYFKISKILRERCKSKVGSGTKSXXXXXXXXXXXXXTNKMLIAMVTIFVICWIPLNSLWMATDMSMNFKYDLRLQFFFPIGF----FICHMIAMSSAVYNPFLYAWLNDNFKREFRNLVPCLSCILKPVLPNNPSVT 1361
            L+ L++  YSI+ V+G+VGN  ++ V+ R R +  +TN  I NLALSD++MC   VP T    F    W     LC ++     V+VYVS  T T IA+DR+ ++VHP   R+      + +  IW ++ +++LP A++ T   +L+ +  + C+E W   +  R+++ +   ++ ++LP  +I + Y ++S  LR R    V  G  +    + +  R+R+T  +L+ +V +F +CW+PL+          N   DL      P  F     +CH +AMSSA YNPF+YAWL+D+F+ E R L   L    + + P+  S+T
Sbjct:   59 LKGLIVLLYSIVVVVGLVGNCLLVLVIARVRRLHNVTNFLIGNLALSDVLMCTACVPLTLAYAFEPRGWVFGGGLCHLVFFLQPVTVYVSVFTLTTIAVDRYVVLVHPLRRRISLRFSAYAVLAIWALSAVLALPAALH-TYHVELKPHRVRLCEEFWGSQERQRQLYAWGLLLVTYLLPLLVILLSYVRVSVNLRNR----VVPGCVTQSQADWDRARRRRTFCLLVVVVVVFAVCWLPLHVF--------NLLRDLDPHAIDPYAFGLVQLLCHWLAMSSACYNPFIYAWLHDSFREELRKL---LLAWPRKIAPHGQSMT 365          
BLAST of Neuropeptide Y receptor, invertebrate vs. TrEMBL
Match: A0A193KUI6 (NPYR-8 OS=Schmidtea mediterranea OX=79327 GN=npyr-8 PE=2 SV=1)

HSP 1 Score: 700.279 bits (1806), Expect = 0.000e+0
Identity = 371/371 (100.00%), Postives = 371/371 (100.00%), Query Frame = 3
Query:  366 MILSNGTNDIFKNHEGLQYLVIAGYSIIFVLGVVGNSFVIFVVMRSRHMRTITNIFISNLALSDIIMCLIAVPFTPIALFMNNWTLPASLCKVLPMTMGVSVYVSTLTSTAIAIDRFFIIVHPFIPRMKNSLCGFXXXXXXXXXXXXSLPLAVYQTKRNDLQSNTSKCQEVWPIDSSREVFTFVSFVLQFVLPCSIISVCYFKISKILRERCKSKVGSGTKSXXXXXXXXXXXXXTNKMLIAMVTIFVICWIPLNSLWMATDMSMNFKYDLRLQFFFPIGFFICHMIAMSSAVYNPFLYAWLNDNFKREFRNLVPCLSCILKPVLPNNPSVTCRPDSRIATTYQMTTCEQEEDSSKKTLLPNSDSHIGLVN 1478
            MILSNGTNDIFKNHEGLQYLVIAGYSIIFVLGVVGNSFVIFVVMRSRHMRTITNIFISNLALSDIIMCLIAVPFTPIALFMNNWTLPASLCKVLPMTMGVSVYVSTLTSTAIAIDRFFIIVHPFIPRMKNSLCGFIICVIWIIAILISLPLAVYQTKRNDLQSNTSKCQEVWPIDSSREVFTFVSFVLQFVLPCSIISVCYFKISKILRERCKSKVGSGTKSIRGKEGEIKRKRKTNKMLIAMVTIFVICWIPLNSLWMATDMSMNFKYDLRLQFFFPIGFFICHMIAMSSAVYNPFLYAWLNDNFKREFRNLVPCLSCILKPVLPNNPSVTCRPDSRIATTYQMTTCEQEEDSSKKTLLPNSDSHIGLVN
Sbjct:    1 MILSNGTNDIFKNHEGLQYLVIAGYSIIFVLGVVGNSFVIFVVMRSRHMRTITNIFISNLALSDIIMCLIAVPFTPIALFMNNWTLPASLCKVLPMTMGVSVYVSTLTSTAIAIDRFFIIVHPFIPRMKNSLCGFIICVIWIIAILISLPLAVYQTKRNDLQSNTSKCQEVWPIDSSREVFTFVSFVLQFVLPCSIISVCYFKISKILRERCKSKVGSGTKSIRGKEGEIKRKRKTNKMLIAMVTIFVICWIPLNSLWMATDMSMNFKYDLRLQFFFPIGFFICHMIAMSSAVYNPFLYAWLNDNFKREFRNLVPCLSCILKPVLPNNPSVTCRPDSRIATTYQMTTCEQEEDSSKKTLLPNSDSHIGLVN 371          
BLAST of Neuropeptide Y receptor, invertebrate vs. TrEMBL
Match: A0A183W5E7 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Trichobilharzia regenti OX=157069 GN=TRE_LOCUS7584 PE=4 SV=1)

HSP 1 Score: 370.933 bits (951), Expect = 2.538e-119
Identity = 200/330 (60.61%), Postives = 256/330 (77.58%), Query Frame = 3
Query:  375 SNGTNDIFKNHEGLQYLVIAGYSIIFVLGVVGNSFVIFVVMRSRHMRTITNIFISNLALSDIIMCLIAVPFTPIALFMNNWTLPASLCKVLPMTMGVSVYVSTLTSTAIAIDRFFIIVHPFIPRMKNSLCGFXXXXXXXXXXXXSLPLAVYQTKRNDLQSNTSKCQEVWPIDSSREVFTFVSFVLQFVLPCSIISVCYFKISKILRERCKSKVGSGTKSXXXXXXXXXXXXXTNKMLIAMVTIFVICWIPLNSLWMATDM-SMNFKYDLRLQFFFPIGFFICHMIAMSSAVYNPFLYAWLNDNFKREFRNLVPCLSCILKPVLPNNPSVT 1361
            +N T D+ K    ++ L+IA YS I ++GV GN  V+++V+R + ++TITNIFI+NLA+SDI+M L+A PFTP++L+M+NWTLP ++CK+LP TMGVSVYVSTLTS AIA+DRFF+IVHPF+PRMK  LC  II  +WIIA+LIS+PLAVYQ K  D  +N S C+E WP +SSREVFT VSFVLQFV+PCSIISVCYF+IS +LR R  +++GSGTK+   +E EIKRKR+TN MLIAMV IFVICWIPLN LWM  D+ S     D++    F + FF+CH++AMSSAVYNPFLYAW+N+NF++EF  +VPC    LKP   +N   T
Sbjct:   37 TNSTYDVAKEILPVKLLIIALYSCITLMGVTGNLLVVWIVLRVKPLQTITNIFIANLAVSDILMSLVATPFTPLSLYMSNWTLPEAVCKLLPTTMGVSVYVSTLTSMAIALDRFFVIVHPFLPRMKIWLCFIIIFTVWIIAVLISMPLAVYQQKHKDPMNNVSSCRENWPKESSREVFTIVSFVLQFVVPCSIISVCYFRISLLLRSRLHTQIGSGTKTQMKEEREIKRKRRTNTMLIAMVVIFVICWIPLNILWMVMDVHSEEHMNDVQSSKNFSLIFFVCHLLAMSSAVYNPFLYAWMNNNFRKEFHRIVPCF--FLKPRYHSNQMTT 364          
BLAST of Neuropeptide Y receptor, invertebrate vs. TrEMBL
Match: A0A183N3J7 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS22872 PE=4 SV=1)

HSP 1 Score: 364.385 bits (934), Expect = 7.680e-117
Identity = 194/314 (61.78%), Postives = 248/314 (78.98%), Query Frame = 3
Query:  375 SNGTNDIFKNHEGLQYLVIAGYSIIFVLGVVGNSFVIFVVMRSRHMRTITNIFISNLALSDIIMCLIAVPFTPIALFMNNWTLPASLCKVLPMTMGVSVYVSTLTSTAIAIDRFFIIVHPFIPRMKNSLCGFXXXXXXXXXXXXSLPLAVYQTKRNDLQSNTSKCQEVWPIDSSREVFTFVSFVLQFVLPCSIISVCYFKISKILRERCKSKVGSGTKSXXXXXXXXXXXXXTNKMLIAMVTIFVICWIPLNSLWMATDMSMNFKY-DLRLQFFFPIGFFICHMIAMSSAVYNPFLYAWLNDNFKREFRNLVPC 1313
            +N T DI K    ++ L+I  YS I ++GV GN  V+++V+R + ++TITNIFI+NLA+SDI+M L+A PFTP++L+MN+WTLP ++CK+LP TMGVSVYVSTLTS AIA+DRFF+IVHPF+PRMK  LC  II  +WIIA+LIS+PLAVYQ K  D  +N S C+E WP +SSREVFT VSFVLQFV+PCSIISVCYF+IS +LR R  +++GSGTK+   +E EIKRKR+TN MLIAMV IFVICWIPLN LWM  D+    +  D++    F + FFICH++AMSSAVYNPFLYAW+N NF++EF  ++PC
Sbjct:   18 TNYTFDIAKEILPVKLLIIILYSFITLIGVTGNLLVVWIVLRVKLLQTITNIFIANLAISDILMSLVATPFTPLSLYMNDWTLPEAVCKLLPTTMGVSVYVSTLTSMAIALDRFFVIVHPFLPRMKVWLCFIIIFTVWIIAVLISMPLAVYQQKHKDPINNVSSCRENWPKESSREVFTIVSFVLQFVIPCSIISVCYFRISLLLRARLHTQIGSGTKTQMKEEREIKRKRRTNTMLIAMVVIFVICWIPLNILWMVMDVHSEEQINDVQNSKHFTLIFFICHLLAMSSAVYNPFLYAWMNSNFRKEFHRILPC 331          
BLAST of Neuropeptide Y receptor, invertebrate vs. TrEMBL
Match: A0A183NS23 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Schistosoma mattheei OX=31246 GN=SMTD_LOCUS4909 PE=4 SV=1)

HSP 1 Score: 362.073 bits (928), Expect = 5.479e-116
Identity = 193/314 (61.46%), Postives = 248/314 (78.98%), Query Frame = 3
Query:  375 SNGTNDIFKNHEGLQYLVIAGYSIIFVLGVVGNSFVIFVVMRSRHMRTITNIFISNLALSDIIMCLIAVPFTPIALFMNNWTLPASLCKVLPMTMGVSVYVSTLTSTAIAIDRFFIIVHPFIPRMKNSLCGFXXXXXXXXXXXXSLPLAVYQTKRNDLQSNTSKCQEVWPIDSSREVFTFVSFVLQFVLPCSIISVCYFKISKILRERCKSKVGSGTKSXXXXXXXXXXXXXTNKMLIAMVTIFVICWIPLNSLWMATDMSMNFKY-DLRLQFFFPIGFFICHMIAMSSAVYNPFLYAWLNDNFKREFRNLVPC 1313
            +N T D+ K    ++ L+I  YS I ++GV GN  V+++V+R + ++TITNIFI+NLA+SDI+M L+A PFTP++L+MN+WTLP ++CK+LP TMGVSVYVSTLTS AIA+DRFF+IVHPF+PRMK  LC  II  +WIIA+LIS+PLAVYQ K  D  +N S C+E WP +SSREVFT VSFVLQFV+PCSIISVCYF+IS +LR R  +++GSGTK+   +E EIKRKR+TN MLIAMV IFVICWIPLN LWM  D+    +  D++    F + FFICH++AMSSAVYNPFLYAW+N NF++EF  ++PC
Sbjct:   18 TNFTFDVAKEILPVKLLIIILYSFITLIGVTGNLLVVWIVLRVKLLQTITNIFIANLAISDILMSLVATPFTPLSLYMNDWTLPEAVCKLLPTTMGVSVYVSTLTSMAIALDRFFVIVHPFLPRMKVWLCFIIIFTVWIIAVLISMPLAVYQQKHKDPINNVSSCRENWPKESSREVFTIVSFVLQFVIPCSIISVCYFRISLLLRARLHTQIGSGTKTHMKEEREIKRKRRTNTMLIAMVVIFVICWIPLNILWMVMDVHSEEQINDVQNSKNFTLIFFICHLLAMSSAVYNPFLYAWMNSNFRKEFHRILPC 331          
BLAST of Neuropeptide Y receptor, invertebrate vs. TrEMBL
Match: A0A183RUL5 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Schistosoma rodhaini OX=6188 PE=4 SV=1)

HSP 1 Score: 362.073 bits (928), Expect = 5.575e-116
Identity = 193/314 (61.46%), Postives = 248/314 (78.98%), Query Frame = 3
Query:  375 SNGTNDIFKNHEGLQYLVIAGYSIIFVLGVVGNSFVIFVVMRSRHMRTITNIFISNLALSDIIMCLIAVPFTPIALFMNNWTLPASLCKVLPMTMGVSVYVSTLTSTAIAIDRFFIIVHPFIPRMKNSLCGFXXXXXXXXXXXXSLPLAVYQTKRNDLQSNTSKCQEVWPIDSSREVFTFVSFVLQFVLPCSIISVCYFKISKILRERCKSKVGSGTKSXXXXXXXXXXXXXTNKMLIAMVTIFVICWIPLNSLWMATDMSMNFKY-DLRLQFFFPIGFFICHMIAMSSAVYNPFLYAWLNDNFKREFRNLVPC 1313
            +N T D+ K    ++ ++I  YS I ++GV GN  V+++V+R + ++TITNIFI+NLA+SDI+M L+A PFTP++L+MNNWTLP ++CK+LP TMGVSVYVSTLTS AIA+DRFF+IVHPF+PRMK  LC  II  +WIIA+LIS+PLAVYQ K  D  +N S C+E WP +SSREVFT VSFVLQFV+PCSIISVCYF+IS +LR R  +++GSGTK+   +E EIKRKR+TN MLIAMV IFVICWIPLN LWM  D+    +  D++    F + FFICH++AMSSAVYNPFLYAW+N NF++EF  ++PC
Sbjct:   18 TNLTFDVAKEILPVKLIIIILYSFITLMGVTGNLLVVWIVLRVKLLQTITNIFIANLAISDILMSLVATPFTPLSLYMNNWTLPEAVCKLLPTTMGVSVYVSTLTSMAIALDRFFVIVHPFLPRMKVWLCFIIIFTVWIIAVLISMPLAVYQQKHKDPINNVSSCRENWPKESSREVFTIVSFVLQFVIPCSIISVCYFRISLLLRSRLHTQIGSGTKTHIKEEREIKRKRRTNTMLIAMVIIFVICWIPLNILWMVMDVHSEEQINDVQNSKNFSLIFFICHLLAMSSAVYNPFLYAWMNSNFRKEFHRILPC 331          
BLAST of Neuropeptide Y receptor, invertebrate vs. Ensembl Cavefish
Match: npy2rl (neuropeptide Y receptor type 2-like [Source:NCBI gene;Acc:103047056])

HSP 1 Score: 160.999 bits (406), Expect = 5.216e-44
Identity = 110/307 (35.83%), Postives = 172/307 (56.03%), Query Frame = 3
Query:  411 GLQYLVIAGYSIIFVLGVVGNSFVIFVVMRSRHMRTITNIFISNLALSDIIMCLIAVPFTPIALFMNNWTLPASLCKVLPMTMGVSVYVSTLTSTAIAIDRFFIIVHPFIPRMKNSLCGFXXXXXXXXXXXXSLPLAVYQT-KRNDLQSNTS--KCQEVWPIDSSREVFTFVS-FVLQFVLPCSIISVCYFKISKILRERCKSKVGSGTKSXXXXXXXXXXXXXTNKMLIAMVTIFVICWIPLNSLWMATDM--SMNFKYDLRLQFFFPIGFFICHMIAMSSAVYNPFLYAWLNDNFKREFRNLVPC 1313
            G+Q ++I  YS I +LGVVGNS VI+VV R + +RT+TN FI+NLA++D+++  + +PFT     +  W     LC  LP   G++V+VST+T   IA+DR   IV+    RM    C  II + W+I+ +++ PLA+++     +L    S   C E WP  S+      +S  +LQ+VLP ++IS  Y +I   LR    + VG   ++        +R+RKT KML+ MV +F + W+P ++  +A D+  S+    D RL       + + H++AM S   NP LY W+N N++  F  +  C
Sbjct:   42 GVQVILILAYSTIILLGVVGNSVVIYVVCRFKTLRTVTNFFIANLAVADLLVNTLCLPFTLAYTLLGEWKFGQVLCFTLPYAQGLAVHVSTVTLNVIALDRHRCIVYHLETRMSKDTCFLIIAITWVISAVLASPLAIFREYGMVELSPGESIEVCGEKWPGSSTDGTLYSISMLLLQYVLPLAVISFAYIRIWSKLR----NHVGPAERN-----DRHRRRRKTTKMLVTMVVVFAVSWLPFHAFQLAIDIDSSVLVMRDFRLL------YTVFHIVAMCSTFANPILYGWMNRNYRSAFIAVFRC 333          
BLAST of Neuropeptide Y receptor, invertebrate vs. Ensembl Cavefish
Match: npy2rl (neuropeptide Y receptor type 2-like [Source:NCBI gene;Acc:103047056])

HSP 1 Score: 160.999 bits (406), Expect = 5.216e-44
Identity = 110/307 (35.83%), Postives = 172/307 (56.03%), Query Frame = 3
Query:  411 GLQYLVIAGYSIIFVLGVVGNSFVIFVVMRSRHMRTITNIFISNLALSDIIMCLIAVPFTPIALFMNNWTLPASLCKVLPMTMGVSVYVSTLTSTAIAIDRFFIIVHPFIPRMKNSLCGFXXXXXXXXXXXXSLPLAVYQT-KRNDLQSNTS--KCQEVWPIDSSREVFTFVS-FVLQFVLPCSIISVCYFKISKILRERCKSKVGSGTKSXXXXXXXXXXXXXTNKMLIAMVTIFVICWIPLNSLWMATDM--SMNFKYDLRLQFFFPIGFFICHMIAMSSAVYNPFLYAWLNDNFKREFRNLVPC 1313
            G+Q ++I  YS I +LGVVGNS VI+VV R + +RT+TN FI+NLA++D+++  + +PFT     +  W     LC  LP   G++V+VST+T   IA+DR   IV+    RM    C  II + W+I+ +++ PLA+++     +L    S   C E WP  S+      +S  +LQ+VLP ++IS  Y +I   LR    + VG   ++        +R+RKT KML+ MV +F + W+P ++  +A D+  S+    D RL       + + H++AM S   NP LY W+N N++  F  +  C
Sbjct:   42 GVQVILILAYSTIILLGVVGNSVVIYVVCRFKTLRTVTNFFIANLAVADLLVNTLCLPFTLAYTLLGEWKFGQVLCFTLPYAQGLAVHVSTVTLNVIALDRHRCIVYHLETRMSKDTCFLIIAITWVISAVLASPLAIFREYGMVELSPGESIEVCGEKWPGSSTDGTLYSISMLLLQYVLPLAVISFAYIRIWSKLR----NHVGPAERN-----DRHRRRRKTTKMLVTMVVVFAVSWLPFHAFQLAIDIDSSVLVMRDFRLL------YTVFHIVAMCSTFANPILYGWMNRNYRSAFIAVFRC 333          
BLAST of Neuropeptide Y receptor, invertebrate vs. Ensembl Cavefish
Match: npy2rl (neuropeptide Y receptor type 2-like [Source:NCBI gene;Acc:103047056])

HSP 1 Score: 160.999 bits (406), Expect = 5.693e-44
Identity = 110/307 (35.83%), Postives = 172/307 (56.03%), Query Frame = 3
Query:  411 GLQYLVIAGYSIIFVLGVVGNSFVIFVVMRSRHMRTITNIFISNLALSDIIMCLIAVPFTPIALFMNNWTLPASLCKVLPMTMGVSVYVSTLTSTAIAIDRFFIIVHPFIPRMKNSLCGFXXXXXXXXXXXXSLPLAVYQT-KRNDLQSNTS--KCQEVWPIDSSREVFTFVS-FVLQFVLPCSIISVCYFKISKILRERCKSKVGSGTKSXXXXXXXXXXXXXTNKMLIAMVTIFVICWIPLNSLWMATDM--SMNFKYDLRLQFFFPIGFFICHMIAMSSAVYNPFLYAWLNDNFKREFRNLVPC 1313
            G+Q ++I  YS I +LGVVGNS VI+VV R + +RT+TN FI+NLA++D+++  + +PFT     +  W     LC  LP   G++V+VST+T   IA+DR   IV+    RM    C  II + W+I+ +++ PLA+++     +L    S   C E WP  S+      +S  +LQ+VLP ++IS  Y +I   LR    + VG   ++        +R+RKT KML+ MV +F + W+P ++  +A D+  S+    D RL       + + H++AM S   NP LY W+N N++  F  +  C
Sbjct:   45 GVQVILILAYSTIILLGVVGNSVVIYVVCRFKTLRTVTNFFIANLAVADLLVNTLCLPFTLAYTLLGEWKFGQVLCFTLPYAQGLAVHVSTVTLNVIALDRHRCIVYHLETRMSKDTCFLIIAITWVISAVLASPLAIFREYGMVELSPGESIEVCGEKWPGSSTDGTLYSISMLLLQYVLPLAVISFAYIRIWSKLR----NHVGPAERN-----DRHRRRRKTTKMLVTMVVVFAVSWLPFHAFQLAIDIDSSVLVMRDFRLL------YTVFHIVAMCSTFANPILYGWMNRNYRSAFIAVFRC 336          
BLAST of Neuropeptide Y receptor, invertebrate vs. Ensembl Cavefish
Match: npy2r (neuropeptide Y receptor Y2 [Source:ZFIN;Acc:ZDB-GENE-040924-8])

HSP 1 Score: 155.992 bits (393), Expect = 6.140e-42
Identity = 100/305 (32.79%), Postives = 171/305 (56.07%), Query Frame = 3
Query:  411 GLQYLVIAGYSIIFVLGVVGNSFVIFVVMRSRHMRTITNIFISNLALSDIIMCLIAVPFTPIALFMNNWTLPASLCKVLPMTMGVSVYVSTLTSTAIAIDRFFIIVHPFIPRMKNSLCGFXXXXXXXXXXXXSLPLAVYQTKRN-DL--QSNTSKCQEVWPIDSSR-EVFTFVSFVLQFVLPCSIISVCYFKISKILRERCKSKVGSGTKSXXXXXXXXXXXXXTNKMLIAMVTIFVICWIPLNSLWMATDMSMNFKYDLRLQFFFPIGFFICHMIAMSSAVYNPFLYAWLNDNFKREFRNLVPC 1313
            G+Q ++I  YS I + GV GN+ VI+VV + R++ T+TN FI NLA++D+++  + +PFT +      W    ++C +LP   G++V VST+T   IA+DR+  IVH    +M   +C  +I V W+ + +++ PLA+++     DL  + +   C E WP  S+   V++   F LQ+ LP S+IS  Y +I   LR+      G   +         +R++KT KML  +V +F + W+P ++  +A D+  +    L ++  + + + + H++AM SA  NP LY W+N N++  F  +  C
Sbjct:   54 GVQVILILAYSSIILFGVTGNALVIYVVYKFRNLHTVTNFFIVNLAVADLLVNTLCLPFTLMYTLYGEWKFGQAMCYLLPYAQGLAVNVSTITLNIIALDRYRSIVHHMETKMSKDVCAVVIAVTWVASAVLASPLAIFREYVTFDLTPEQSIQGCAEKWPGSSTDGTVYSISMFFLQYGLPLSVISFAYARIWTKLRKHISPGGGRSDRH--------RRRQKTTKMLAVVVAVFAVSWLPFHAFQLAVDIDSSV---LEMK-DYKLLYTVFHIVAMCSAFANPILYGWMNRNYRGAFAAVCKC 346          
BLAST of Neuropeptide Y receptor, invertebrate vs. Ensembl Cavefish
Match: prlhr2b (prolactin-releasing peptide receptor-like [Source:NCBI gene;Acc:103046295])

HSP 1 Score: 154.066 bits (388), Expect = 1.135e-41
Identity = 104/306 (33.99%), Postives = 171/306 (55.88%), Query Frame = 3
Query:  408 EGLQYLVIAGYSIIFVLGVVGNSFVIFVVMRSRHMRTITNIFISNLALSDIIMCLIAVPFTPIALFM-NNWTLPASLCKVLPMTMGVSVYVSTLTSTAIAIDRFFIIVHPFIPRMKNSLCGFXXXXXXXXXXXXSLPLAVYQTKRNDLQSNTSKCQEVW-PIDSSREVFTFVSFVLQFVLPCSIISVCYFKISKILRERCKSKVGSGTKSXXXXXXXXXXXXXTNKMLIAMVTIFVICWIPLNSLWMATDMSMNFKYDLRL--QFFFPIGFFICHMIAMSSAVYNPFLYAWLNDNFKREFRNLVPC 1313
            +  + L++  Y ++ V+GV GN  +I+V+ RSR M  +TN+FI NLA SD++MC+  VPFT    F    WT    +C ++ +   V+VYVS  T TAIA+DR++  VHP   R+    C +I+  IW+++  +  P  V+         + + C+E W   ++ R V+ + + ++ ++LP S + V Y  IS  LR    + V  G ++    E +  RKRK  +++  +V  F +CW+P++   +  D+      D+RL  +  F +   +CH+ AMSS+  NPFLYAWL+D F+ E R +  C
Sbjct:   43 QAFKPLIVPCYVLVVVVGVFGNYLLIYVICRSRKMHNVTNVFIGNLAFSDMLMCVTCVPFTLAYAFNPRGWTFGRFMCYLVFLVQPVTVYVSVFTLTAIAVDRYYATVHPLKKRISMVACVYILSGIWLLSCTLVAPAVVHTYHVEFEGEDLTICEEFWLGQETERLVYAYSTLLITYILPLSAVCVSYLCISVKLR----NCVAPGHRTRAQAEAQRARKRKIFRLVSLVVAAFGVCWLPIHVFNVLRDI------DIRLINKRHFLLIQLLCHLCAMSSSCCNPFLYAWLHDRFRAELRKIFTC 338          
BLAST of Neuropeptide Y receptor, invertebrate vs. Ensembl Sea Lamprey
Match: prlh2r (prolactin releasing hormone 2 receptor [Source:ZFIN;Acc:ZDB-GENE-120411-41])

HSP 1 Score: 163.696 bits (413), Expect = 4.300e-46
Identity = 111/336 (33.04%), Postives = 186/336 (55.36%), Query Frame = 3
Query:  375 SNGTNDIFKNHEGLQYL------VIAGYSIIFVLGVVGNSFVIFVVMRSRHMRTITNIFISNLALSDIIMCLIAVPFTPIALF-MNNWTLPASLCKVLPMTMGVSVYVSTLTSTAIAIDRFFIIVHPFIPRMKNSLCGFXXXXXXXXXXXXSLPLAVYQTKRNDLQSNTSKCQEVWPIDSSRE--VFTFVSFVLQFVLPCSIISVCYFKISKILRERCKSKVGSGTKSXXXXXXXXXXXXXTNKMLIAMVTIFVICWIPLNSLWMATDMSMNFKYDLRL--QFFFPIGFFICHMIAMSSAVYNPFLYAWLNDNFKREFRNLVPCLSCILKPVLPNN 1349
            S+ T +     +G+Q +      V+  Y+ + V+GV+GN  +++V+ R + M  +TN+ I NLA SD++MC + VP T   +F    W   + +C  + +   VSVYVS  T T IA+DR+ + V+P   R+    CG+++  IW+ A  ++ P   +       +   + C+E W I + RE   + + + VL + LP  +IS+ YFKIS     + K++V  GT +    E +  R+RKT ++L+ +VT F +CW+PL+      D+      D+RL  +++F +   +CH  AMSSA YNPF+YAWL+D F+ E + +      + + V P+N
Sbjct:    1 SSATTNASTPFKGVQLIRTLKPFVVLFYTAVVVVGVLGNFLLVYVICRVKKMHNVTNLLIGNLAFSDLLMCAMCVPLTLAYVFDARGWVFGSFMCYFVFLMQPVSVYVSVFTLTVIAVDRYIVTVYPLRRRITIPTCGYLLAAIWVTACALAAPALAHTYYCEFPEQRMTICEEFW-IGTERERLAYAYSTLVLTYGLPLLVISLSYFKIS----VKLKNRVVPGTVTQNQAEMDRARRRKTFRLLVLVVTAFSVCWLPLHIFNFLRDV------DIRLIDKYYFNLVQLLCHWFAMSSACYNPFIYAWLHDRFRSELKKMFT----VKRRVAPSN 321          
BLAST of Neuropeptide Y receptor, invertebrate vs. Ensembl Sea Lamprey
Match: npy8br (neuropeptide Y receptor Y8b [Source:ZFIN;Acc:ZDB-GENE-980526-208])

HSP 1 Score: 144.05 bits (362), Expect = 1.727e-38
Identity = 106/347 (30.55%), Postives = 167/347 (48.13%), Query Frame = 3
Query:  390 DIFKNHEGLQYLVIAGYSIIFVLGVVGNSFVIFVVMRSRHMRTITNIFISNLALSDIIMCLIAVPFTPIALFMNNWTLPASLCKVLPMTMGVSVYVSTLTSTAIAIDRFFIIVHP--FIPRMKNSLCGFXXXXXXXXXXXXSLPLAVYQTKRNDLQSNTSK----------CQEVWPIDSSREVFTFVSFVLQFVLPCSIISVCYFKISKILRERCK----SKVGSGTKSXXXXXXXXXXXXXTNKMLIAMVTIFVICWIPLNSLWMATDMSMNFKYDLRLQFFFPIGFFICHMIAMSSAVYNPFLYAWLNDNFKREFRNLVPCLSCILKPV---LPNNPSVTCRPD 1373
            D  +  + ++  VIA Y ++  LG++GNS ++ V++R   +  +TNI I NLA SD+++ L+ +P T     M++W    +LCK  P     +V VS  +   IAI+R  +I++P  + P + ++        IW+ A  +S P   +    ++   N S           C E+WP D+S+  FT    V QF  P   + +CY +I   LR+R K     + G G              +K N ML+A+V  F ICW+PL +    +D    +   L L     + F +CH+ AM S   NP  Y +LN+NF++E +  + C  C   PV   L N P  T   D
Sbjct:   29 DHCQTPQAVRSFVIATYCVLIALGLLGNSLLVLVILRHSELHNVTNILIVNLAFSDMLVGLVCLPLTIAYTLMDHWIFGEALCKGSPFLQCSAVSVSIFSLVLIAIERHQLIINPTGWKPSLNHAYVAI--GAIWVTAFAMSSPFLAFHVLTDEPYRNLSHYFPDYGEKVACIELWPSDTSKFAFTTSLLVFQFSCPLLFVFLCYLRIFLRLRQRKKMLPTGREGGGNG------VRASHMKKINMMLVAIVAGFAICWLPLYAFNAVSD----WNPTLLLHCQHDLIFSLCHLTAMLSICINPIFYGFLNNNFQKELKATILCCQC--NPVEEDLENFPLSTMNTD 361          
BLAST of Neuropeptide Y receptor, invertebrate vs. Ensembl Sea Lamprey
Match: npffr1l3 (neuropeptide FF receptor 1 like 3 [Source:ZFIN;Acc:ZDB-GENE-070424-44])

HSP 1 Score: 125.561 bits (314), Expect = 5.651e-32
Identity = 102/332 (30.72%), Postives = 163/332 (49.10%), Query Frame = 3
Query:  375 SNGTNDIFKNHE---GLQYLVIAGYSIIFVLGVVGNSFVIFVVMRSRHMRTITNIFISNLALSDIIMCLIAVPFTPIALFMNNWTLPASLCKVLPMTMGVSVYVSTLTSTAIAIDRFFIIVHPFIPRMKNSLCGFXXXXXXXXXXXXSLPLA-------------VYQTKRNDLQSNTSKCQEVWPIDSSREVFTFVSFVLQFVLPCSIISVCYFKISKILRERCKSKVGSGTKSXXXXXXXXXXXXXTN------KMLIAMVTIFVICWIPLNSLWMATDMSMNFKYDLRL--QFFFPIGFFICHMIAMSSAVYNPFLYAWLNDNFKREFR 1298
            +N T   F  H       YL+   Y  IF+L ++GN  V +VV++SR MRT+TN+FI NLA+SD+++ +  +P T +   +  W     +CK+  +  G SV  S  T  AIA+DRF  IV+PF  +++ S   F I VIW +A+ I  P A             VY    ND      +C E WP    R+ +T V F   ++ P ++I + Y +I   L     S   + + +   + G       T       KMLI +  +F++ W+PL ++ M  D +    +DL     + +P+     H +A  ++  NP +Y + N+NF+R F+
Sbjct:   34 TNATFYTFYQHAPPTAAVYLI--AYLFIFLLCMIGNGLVCYVVLQSRRMRTVTNLFILNLAVSDLLVGIFCMPITLVDNLITGWPFGVVVCKMSGLVQGTSVSASVFTLVAIAVDRFRCIVYPFKRKLRISHALFTILVIWALALSIMCPSALMLTAEVSRGHYMVYSDGSNDTHP-LHQCWEAWPDPRMRKAYTTVLFANVYLAPLALILLMYARIGFRLCSLSASAAAAASAAAPSRGGGGGATGVTRRRVKVIKMLIIVAMLFMLSWLPLWTVMMLVDYANLSPWDLAFLNMYVYPVA----HWLAFFNSSVNPIVYGYFNENFRRGFQ 358          
BLAST of Neuropeptide Y receptor, invertebrate vs. Ensembl Sea Lamprey
Match: qrfpr4 (pyroglutamylated RFamide peptide receptor 4 [Source:ZFIN;Acc:ZDB-GENE-091204-354])

HSP 1 Score: 123.25 bits (308), Expect = 3.036e-31
Identity = 86/310 (27.74%), Postives = 159/310 (51.29%), Query Frame = 3
Query:  441 SIIFVLGVVGNSFVIFVVMRSRHMRTITNIFISNLALSDIIMCLIAVPFTPIALFMNNWTLPASLCKVLPMTMGVSVYVSTLTSTAIAIDRFFIIVHPFIPRMKNS-------LCGFXXXXXXXXXXXXSLPLAVYQTKR--NDLQSNTSK--CQEVWPIDSSREVFTFVSFVLQFVLPCSIISVCYFKISKIL--RERCKSKVGSGTKSXXXXXXXXXXXXXTNKMLIAMVTIFVICWIP---LNSLWMATDMSMNFKYDLRLQFFFPIGFFICHMIAMSSAVYNPFLYAWLNDNFKREFRNLVPCLSC 1322
            +++F L + GN+ VIFVV R + + T+ N+F+ +LA+SD+++ +  +P T +  F +NW    +LCK++P     +V  S LT   IA++RF  I+HP   R + +       LCG     +W++ + ++ P+    T +   D+  + S   C E W     R+ +T    ++ FVLP   ++  Y +++  L  + R    V +  +     +    +KR   KM++ +V +F +CW P   +NSL    ++ M+F  +        I   +  +   S++++NP +YA LN N+K++    + CL C
Sbjct:   53 ALVFTLALSGNALVIFVVARRKALHTVANVFVCSLAVSDLMITVFCIPITLMQNFFSNWIAGVALCKLVPFIQVTAVTTSMLTMACIAVERFQGILHPLRSRSRYTTARAASMLCG-----VWLVGLCVAAPMFYAHTVQVTYDVLYDVSHTGCSEQWSHAEHRQAYTTTLLLVTFVLPLLTMTALYTRLAHELWVKTRVHDAVFNALQRSEINKITRSKKRAV-KMMVIVVILFAVCWAPFHVVNSLVPKGNLEMSFDME-------AITLAMVQLFGFSNSLWNPIVYAALNQNYKKQLAIALSCLMC 349          
BLAST of Neuropeptide Y receptor, invertebrate vs. Ensembl Sea Lamprey
Match: kiss1rb (KISS1 receptor b [Source:ZFIN;Acc:ZDB-GENE-060526-54])

HSP 1 Score: 122.094 bits (305), Expect = 6.715e-31
Identity = 92/308 (29.87%), Postives = 160/308 (51.95%), Query Frame = 3
Query:  420 YLVIAGYSIIFVLGVVGNSFVIFVVMRSRHMRTITNIFISNLALSDIIMCLIAVPFTPIALFMNNWTLPASLCKVLPMTMGVSVYVSTLTSTAIAIDRFFIIVHPFIPRMKNSLC--GFXXXXXXXXXXXXSLPLAVY-QTKRNDLQSNTSKCQEVWPIDSSREVFTFVSFVLQFVLPCSIISVCY-FKISKILRERCKSKVGSGTKSXXXXXXXXXXXXXTNKMLIAMVTIFVICWIPLNSLWMATDMSMNFK-----YDLRLQFFFPIGFFICHMIAMSSAVYNPFLYAWLNDNFKREFRNLVPCL 1316
            +LV   +++I ++G+VGNS VIFV+ ++R MRT+TN FI NLA +DII  +  VPFT     + +W     +CK +     V+V  + +T TA+++DR ++ V+P       + C    I   IWI ++++SLP+A+Y +T   +     + C + +P       F   SFVL ++LP   ISVCY   I KI R   + +     +     E     + K  +M++ +V +F++CW P+    +      +F      Y L+            + ++ +++  NPF+Y ++ D+F++ F+   PCL
Sbjct:   37 WLVPLLFALIMLVGLVGNSLVIFVITKNRQMRTVTNFFIVNLAGTDIIFLVCCVPFTATLYPLPSWVFGDFMCKFVNYLQQVTVQATCMTLTAMSVDRCYVTVYPIRSLQHRTPCLAACISIGIWIGSLVMSLPMALYHKTDTKEWYGPKTYCFDAFPSVPHEHAFVLYSFVLVYMLPLVTISVCYSIMIKKIGRPAVEPQ-DDNVQLQMLTERNEATRAKVTRMVVVVVLVFMLCWGPIQLFILFQSFYPHFAISYTTYKLKTW---------ANCMSYANSSINPFVYCFMGDSFRKTFKKAFPCL 334          
BLAST of Neuropeptide Y receptor, invertebrate vs. Ensembl Nematostella
Match: EDO36473 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIH8])

HSP 1 Score: 139.428 bits (350), Expect = 2.311e-37
Identity = 90/290 (31.03%), Postives = 152/290 (52.41%), Query Frame = 3
Query:  438 YSIIFVLGVVGNSFVIFVVMRSRHMRTITNIFISNLALSDIIMCLIAVPFT-PIALFMNNWTLPASLCKVLPMTMGVSVYVSTLTSTAIAIDRFFIIVHPFIPRMKNSLCGFXXXXXXXXXXXXSLPLAVYQTKRNDLQ--SNTSKCQEVWPIDSSREVFTFVSFVLQFVLPCSIISVCYFKISKILRERCKSKVGSGTKSXXXXXXXXXXXXXTNKMLIAMVTIFVICWIPLNSLWMATDMSMNFKYDLRLQFFFPIGFFICHMIAMSSAVYNPFLYAWLNDNFKREFR 1298
            Y+ IF++  VGN+ V  +++R + M+T+TN FI NLA++D+ +  I +PF  P+      W   A +CKVL     ++++ S  T TA+ + R++ IVHP   ++  +    +I  IW+ +++   P A      N L+    T  C+E W     RE+FT V FV Q+VLP  +I   Y  I + LR R  +K G+        +   K       ML  +  +F IC +P N +W+  D       D ++++F+ I  F C+++  +++  NP  Y  LN+ ++REF+
Sbjct:   14 YAAIFLISAVGNTMVCAIIVRRKKMKTVTNYFILNLAVADLALTCICIPFDIPVQEMGYIWPYGAVMCKVLYPLQTLTLFASVYTLTAVGLTRYWAIVHPMKRQLSITQSKLVIAFIWLGSVVPVFPYA------NSLKFTRETHTCEEYWSSKKVREIFTAVIFVFQYVLPLGVIGTAYAAIGRELRRRKATKSGNHKLRHLQAQEARKVV----NMLSVVTMVFAICVLPNNIMWLWLDFG---DADQKVEYFWEIVAF-CNVVTFANSAANPVCYTALNETYRREFK 289          
BLAST of Neuropeptide Y receptor, invertebrate vs. Ensembl Nematostella
Match: EDO49619 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFL1])

HSP 1 Score: 136.732 bits (343), Expect = 1.778e-36
Identity = 95/305 (31.15%), Postives = 156/305 (51.15%), Query Frame = 3
Query:  438 YSIIFVLGVVGNSFVIFVVMRSRHMRTITNIFISNLALSDIIMCLIAVPF-TPIALFMNNWTLPASLCKVLPMTMGVSVYVSTLTSTAIAIDRFFIIVHPFIPRMKNSLCGFXXXXXXXXXXXXSLPLAVYQTKRNDLQSNTSKCQEVWPIDSSREVFTFVSFVLQFVLPCSIISVCYFKISKILRERC----KSKVGSGTKSXXXXXXXXXXXXXTNKMLIAMVTIFVICWIPLNSLWMATDMSMNFKYDLRLQFFFPIGFFICHMIAMSSAVYNPFLYAWLNDNFKREFRNLVPCLSCILKPV 1337
            ++IIF++GVVGNS V  V+ ++ +MR   N  I NLA++DI + L+ +PF   I ++ + W L A++CK++  +M      S  T  AI+ DR+  +VHP+ PR+       +I   W+++ L+ LP  +       L  +   C E W  D  R+++T   FV  + LP  II+  Y +++  LRE+     K+K+ SG  S               KML+ +V I+ +C +P   LW+  +     +++         G     M+   +++ NPFLYA LND FK+ F  L+ C    LK +
Sbjct:    2 FAIIFIVGVVGNSLVCLVIFKTPNMRNTRNYLIVNLAIADITVALVCIPFDVVIRVYGDTWVLGAAMCKMVWPSMTFVATCSAATLAAISFDRYRAVVHPWKPRLSMRQTLAVIVSTWLVSFLVVLPYILV------LGMDGHSCTEFWLKDIHRQLYTVFLFVFAYALPLVIIAFAYSRVALKLREQSNRIEKNKLASGIPSSSKYNWI-------TKMLVTVVLIYALCLLPNQVLWLWMEFGTGNEFEHMNTLLTFTG-----MLVYINSIVNPFLYAGLNDEFKKGFARLLCCKGKYLKSI 288          
BLAST of Neuropeptide Y receptor, invertebrate vs. Ensembl Nematostella
Match: EDO46084 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR06])

HSP 1 Score: 135.576 bits (340), Expect = 2.584e-35
Identity = 96/317 (30.28%), Postives = 163/317 (51.42%), Query Frame = 3
Query:  369 ILSNGTNDIFKNHEGLQYLVIAGYSIIFVLGVVGNSFVIFVVMRSRHMRTITNIFISNLALSDIIMCLIAVPFT-PIALFMNNWTLPASLCKVLPMTMGVSVYVSTLTSTAIAIDRFFIIVHPFIPRMKNSLCGFXXXXXXXXXXXXSLP-LAVYQTKRNDLQSNTSKCQEVWPIDSSREVFTFVSFVLQFVLPCSIISVCYFKISKILRERCKSKVGSGTKSXXXXXXXXXXXXXTNKMLIAMVTIFVICWIPLNSLWMATDMSMNFKYDLRLQFFFPIGFFICHMIAMSSAVYNPFLYAWLNDNFKREFRNLVPC 1313
            + S+   D        + L ++ Y++IF++  VGNS V  V+ R R MRT+TN FI NLA++D+ + LI +PF  P+      W   A +CK++     + ++ S  T  A++++RF+ IV+P    M  S    II +IW I+  +++P + V + K  D       C E WP    R+ +T   FV+Q++LP ++I+  Y KI   LR +C   VG+ T +   +  + +  RK  +MLI +  +F +C +P N +W+  D      Y+   +        + ++I  +++  NP  Y   N+ F+ EFR    C
Sbjct:   19 VFSHSGGDTGGESMTFKVLKLSLYALIFLISTVGNSLVCIVIARRRRMRTVTNYFILNLAIADLAITLICIPFDIPVQENGYKWPYGAFMCKIMYPLQTMCMFASIFTLVAVSLNRFWAIVYPLRQEMSKSQATIIIILIWFISSGLTVPYVTVLELKNGD------DCSESWPEPGYRKAYTACIFVVQYLLPLTLIAFAYLKIGFELR-KC---VGTRTANSALERAKQEDTRKVVRMLIIVTLLFAMCVLPNNVMWLWLDFGNGNDYEHIWEM-----VAVTNIILFANSATNPVAYTICNERFREEFRLYFTC 320          
BLAST of Neuropeptide Y receptor, invertebrate vs. Ensembl Nematostella
Match: EDO46030 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR08])

HSP 1 Score: 128.257 bits (321), Expect = 2.109e-33
Identity = 84/278 (30.22%), Postives = 151/278 (54.32%), Query Frame = 3
Query:  459 GVVGNSFVIFVVMRSRHMRTITNIFISNLALSDIIMCLIAVPFT-PIALFMNNWTLPASLCKVLPMTMGVSVYVSTLTSTAIAIDRFFIIVHPFIPRMKNSLCGFXXXXXXXXXXXXSLPLAVYQTKRNDLQSNTSKCQEVWPIDSSREVFTFVSFVLQFVLPCSIISVCYFKISKILRERCKSKVGSGTKSXXXXXXXXXXXXXTNKMLIAMVTIFVICWIPLNSLWMATDMSMNFKYDLRLQFFFPIGFFICHMIAMSSAVYNPFLYAWLNDNFKR 1289
              +GNS  +FV+MR R M+T+TN FI NLA++D+ + LI +PF  P+      W     +CK+L     + ++ S  T T++++ R+  I+HP  P++       I   IW+++++   P  +Y  +  +    T  C+E W    SR+++T   FV+Q+++P S+I+  Y +I K   E    K+ +  K ++  + E  RK    +MLIA+  +F +C +P N +W+  D     K D    +F+ +  F C+++  +++  NP  Y  LND+++R
Sbjct:   18 SAIGNSLTVFVIMRRRKMKTVTNYFILNLAIADLTLTLICIPFDIPVQEMDYIWPYGPFMCKILYPLQTMCLFASVFTLTSVSVARYRAIIHPLRPQLTVKRAKVITVFIWMLSVVPVSPY-IYVLEHKE---ETQYCEEHWVDTKSRKIYTVTLFVIQYIIPLSLITAAYARIGK---ELGAKKLHADNKHLQSAQAEEARKVI--RMLIAVTALFAVCVLPTNIMWLWLDFG---KADQVFVYFWEVVAF-CNIMTFANSAANPVCYTLLNDHYRR 282          
BLAST of Neuropeptide Y receptor, invertebrate vs. Ensembl Nematostella
Match: EDO36453 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIH9])

HSP 1 Score: 124.405 bits (311), Expect = 1.017e-31
Identity = 86/307 (28.01%), Postives = 165/307 (53.75%), Query Frame = 3
Query:  375 SNGTNDIFKNHEGLQYLVIAGYSIIFVLGVVGNSFVIFVVMRSRHMRTITNIFISNLALSDIIMCLIAVPFT-PIALFMNNWTLPASLCKVLPMTMGVSVYVSTLTSTAIAIDRFFIIVHPFIPRMKNSLCGFXXXXXXXXXXXXSLPLAVYQTKRNDLQSNTSKCQEVWPIDSSREVFTFVSFVLQFVLPCSIISVCYFKISKILRERCKSKVGSGTKSXXXXXXXXXXXXXTNKMLIAMVTIFVICWIPLNSLWMATDMSMNFKYDLRLQFFFPIGFFICHMIAMSSAVYNPFLYAWLNDNFKRE 1292
            S  T+ +  NH  L+ + +  Y++IF++   GN+ V  V+++ + M+T+TN FI NLA++D+ +  I +PF  P+      W   A +CKVL     ++++ S  T TA+++ R++ IVHP   ++  S    ++  IW++++   LP+A Y    + +  ++  C+E W   ++R+ +T   F  Q+V+P +II+  Y  I++ L  R         +S   +  + K  +K  +ML+ +  +F +C +P N +W+  D       D   ++F+ +  F CH+    ++  NP  Y  LN+N+++E
Sbjct:   23 SGTTDPVGSNH--LRTIKLTLYTLIFLVSAAGNTLVCIVILKRKKMKTVTNYFILNLAVADLALTCICIPFDIPVQEMGYIWPYGAVMCKVLYPLQTLTLFASVYTLTAVSLTRYWAIVHPLRKQLSVSKAKTLVIAIWVLSL---LPVAPYMNSLSYV-PHSKYCEENWDNHNARKGYTASLFAFQYVIPLTIIATAYCSITRELSRR-------TIESACVRNQQHKETKKVVRMLMIVTLLFAVCVLPNNVMWLWLDFGAA---DKSFKYFWDVVAF-CHVWTFLNSAANPICYTILNENYRKE 312          
BLAST of Neuropeptide Y receptor, invertebrate vs. Ensembl Medaka
Match: npy2rl (neuropeptide Y receptor type 2 [Source:NCBI gene;Acc:101162714])

HSP 1 Score: 174.096 bits (440), Expect = 1.880e-48
Identity = 106/304 (34.87%), Postives = 174/304 (57.24%), Query Frame = 3
Query:  414 LQYLVIAGYSIIFVLGVVGNSFVIFVVMRSRHMRTITNIFISNLALSDIIMCLIAVPFTPIALFMNNWTLPASLCKVLPMTMGVSVYVSTLTSTAIAIDRFFIIVHPFIPRMKNSLCGFXXXXXXXXXXXXSLPLAVYQTKRN---DLQSNTSKCQEVWPIDSSR-EVFTFVSFVLQFVLPCSIISVCYFKISKILRERCKSKVGSGTKSXXXXXXXXXXXXXTNKMLIAMVTIFVICWIPLNSLWMATDMSMNFKYDLRLQFFFPIGFFICHMIAMSSAVYNPFLYAWLNDNFKREFRNLVPC 1313
            +Q ++I  YS I VLGV+GNS VI+V+ R + +RT+TN FI+NLA++D+++  + +PFT +      W   ++LC +LP   G++V+VST+T   IA+DR   IV+    RM+  +C  +I + W+++ +++ PLA+++   +   +       C E WP  S+   +++    +LQ+ LP SIIS  Y +I   LR       G    S        +R+RKT KML+ MV +F + W+P ++  +ATD+  N   D+R    F + + I H++AM S   NP LY W+N N++  F  +  C
Sbjct:   61 VQVVLILAYSTIIVLGVLGNSLVIYVIYRFKTLRTVTNFFIANLAVADLLVNTLCLPFTLVYTLQGEWKFGSTLCFLLPYAQGLAVHVSTVTLNVIALDRHRCIVYHLETRMRKDVCFGVIALTWVLSAVLASPLAIFREYGSFTLEPGHTIQVCTEKWPGKSTDGTIYSISMLILQYFLPLSIISFAYARIWSKLRGHVSPAEGGANSS--AGSERHRRRRKTTKMLVTMVVVFAVSWLPFHAFQLATDID-NKVLDMR---DFRLLYTIFHVVAMCSTFANPLLYGWMNRNYRAAFLAVFKC 358          
BLAST of Neuropeptide Y receptor, invertebrate vs. Ensembl Medaka
Match: npy2rl (neuropeptide Y receptor type 2 [Source:NCBI gene;Acc:101162714])

HSP 1 Score: 174.096 bits (440), Expect = 1.880e-48
Identity = 106/304 (34.87%), Postives = 174/304 (57.24%), Query Frame = 3
Query:  414 LQYLVIAGYSIIFVLGVVGNSFVIFVVMRSRHMRTITNIFISNLALSDIIMCLIAVPFTPIALFMNNWTLPASLCKVLPMTMGVSVYVSTLTSTAIAIDRFFIIVHPFIPRMKNSLCGFXXXXXXXXXXXXSLPLAVYQTKRN---DLQSNTSKCQEVWPIDSSR-EVFTFVSFVLQFVLPCSIISVCYFKISKILRERCKSKVGSGTKSXXXXXXXXXXXXXTNKMLIAMVTIFVICWIPLNSLWMATDMSMNFKYDLRLQFFFPIGFFICHMIAMSSAVYNPFLYAWLNDNFKREFRNLVPC 1313
            +Q ++I  YS I VLGV+GNS VI+V+ R + +RT+TN FI+NLA++D+++  + +PFT +      W   ++LC +LP   G++V+VST+T   IA+DR   IV+    RM+  +C  +I + W+++ +++ PLA+++   +   +       C E WP  S+   +++    +LQ+ LP SIIS  Y +I   LR       G    S        +R+RKT KML+ MV +F + W+P ++  +ATD+  N   D+R    F + + I H++AM S   NP LY W+N N++  F  +  C
Sbjct:   61 VQVVLILAYSTIIVLGVLGNSLVIYVIYRFKTLRTVTNFFIANLAVADLLVNTLCLPFTLVYTLQGEWKFGSTLCFLLPYAQGLAVHVSTVTLNVIALDRHRCIVYHLETRMRKDVCFGVIALTWVLSAVLASPLAIFREYGSFTLEPGHTIQVCTEKWPGKSTDGTIYSISMLILQYFLPLSIISFAYARIWSKLRGHVSPAEGGANSS--AGSERHRRRRKTTKMLVTMVVVFAVSWLPFHAFQLATDID-NKVLDMR---DFRLLYTIFHVVAMCSTFANPLLYGWMNRNYRAAFLAVFKC 358          
BLAST of Neuropeptide Y receptor, invertebrate vs. Ensembl Medaka
Match: npy2rl (neuropeptide Y receptor type 2 [Source:NCBI gene;Acc:101162714])

HSP 1 Score: 172.94 bits (437), Expect = 1.926e-48
Identity = 106/304 (34.87%), Postives = 174/304 (57.24%), Query Frame = 3
Query:  414 LQYLVIAGYSIIFVLGVVGNSFVIFVVMRSRHMRTITNIFISNLALSDIIMCLIAVPFTPIALFMNNWTLPASLCKVLPMTMGVSVYVSTLTSTAIAIDRFFIIVHPFIPRMKNSLCGFXXXXXXXXXXXXSLPLAVYQTKRN---DLQSNTSKCQEVWPIDSSR-EVFTFVSFVLQFVLPCSIISVCYFKISKILRERCKSKVGSGTKSXXXXXXXXXXXXXTNKMLIAMVTIFVICWIPLNSLWMATDMSMNFKYDLRLQFFFPIGFFICHMIAMSSAVYNPFLYAWLNDNFKREFRNLVPC 1313
            L+ ++I  YS I VLGV+GNS VI+V+ R + +RT+TN FI+NLA++D+++  + +PFT +      W   ++LC +LP   G++V+VST+T   IA+DR   IV+    RM+  +C  +I + W+++ +++ PLA+++   +   +       C E WP  S+   +++    +LQ+ LP SIIS  Y +I   LR       G    S        +R+RKT KML+ MV +F + W+P ++  +ATD+  N   D+R    F + + I H++AM S   NP LY W+N N++  F  +  C
Sbjct:   49 LKVVLILAYSTIIVLGVLGNSLVIYVIYRFKTLRTVTNFFIANLAVADLLVNTLCLPFTLVYTLQGEWKFGSTLCFLLPYAQGLAVHVSTVTLNVIALDRHRCIVYHLETRMRKDVCFGVIALTWVLSAVLASPLAIFREYGSFTLEPGHTIQVCTEKWPGKSTDGTIYSISMLILQYFLPLSIISFAYARIWSKLRGHVSPAEGGANSS--AGSERHRRRRKTTKMLVTMVVVFAVSWLPFHAFQLATDID-NKVLDMR---DFRLLYTIFHVVAMCSTFANPLLYGWMNRNYRAAFLAVFKC 346          
BLAST of Neuropeptide Y receptor, invertebrate vs. Ensembl Medaka
Match: npy2r (neuropeptide Y receptor Y2 [Source:ZFIN;Acc:ZDB-GENE-040924-8])

HSP 1 Score: 165.622 bits (418), Expect = 1.142e-45
Identity = 101/305 (33.11%), Postives = 167/305 (54.75%), Query Frame = 3
Query:  411 GLQYLVIAGYSIIFVLGVVGNSFVIFVVMRSRHMRTITNIFISNLALSDIIMCLIAVPFTPIALFMNNWTLPASLCKVLPMTMGVSVYVSTLTSTAIAIDRFFIIVHPFIPRMKNSLCGFXXXXXXXXXXXXSLPLAVYQTKRN---DLQSNTSKCQEVWPIDS-SREVFTFVSFVLQFVLPCSIISVCYFKISKILRERCKSKVGSGTKSXXXXXXXXXXXXXTNKMLIAMVTIFVICWIPLNSLWMATDMSMNFKYDLRLQFFFPIGFFICHMIAMSSAVYNPFLYAWLNDNFKREFRNLVPC 1313
            G+Q ++I  YS I + GV GNS V++VV + R++RT+TN FI NLA++D+++  + +PFT I    + W     LC +LP   G++V VST+T   IA+DR   IVH    +M   +C  +I   W+I+ L++ PLA+++   +     + +   C E WP  S +  +++    V+Q  +P +I SV Y +I K L+   K       +            RKT KM++ MV +F +CW+P ++  +A D+       L ++  F + F + H++AM S   NP LY W+N+N++  F  +  C
Sbjct:   45 GVQVILILAYSTIILFGVTGNSLVVYVVYKFRNLRTVTNFFIINLAVADLLVNTLCLPFTLIYTLYDEWMFGQVLCYLLPFAQGMTVQVSTITLNIIALDRHRSIVHHMETKMSKDMCAMVIVFSWVISALLASPLAIFREYGSFDFSPEESIQVCTEKWPGSSMNGRLYSMSMLVVQVAIPLAINSVAYIRIWKKLKHHMKCGRNDHQRR-----------RKTTKMMLTMVVVFAVCWLPFHAFQLAIDIDNTV---LHMK-DFKLVFTVFHILAMCSTCVNPILYGWMNNNYRTAFLTVCKC 334          
BLAST of Neuropeptide Y receptor, invertebrate vs. Ensembl Medaka
Match: prlhr2a (prolactin-releasing peptide receptor [Source:NCBI gene;Acc:101174270])

HSP 1 Score: 156.377 bits (394), Expect = 2.054e-42
Identity = 101/305 (33.11%), Postives = 170/305 (55.74%), Query Frame = 3
Query:  408 EGLQYLVIAGYSIIFVLGVVGNSFVIFVVMRSRHMRTITNIFISNLALSDIIMCLIAVPFTPIALFM-NNWTLPASLCKVLPMTMGVSVYVSTLTSTAIAIDRFFIIVHPFIPRMKNSLCGFXXXXXXXXXXXXSLPLAVYQTKRNDLQSNT-SKCQEVW-PIDSSREVFTFVSFVLQFVLPCSIISVCYFKISKILRERCKSKVGSGTKSXXXXXXXXXXXXXTNKMLIAMVTIFVICWIPLNSLWMATDMSMNFKYDLRLQFFFPIGFFICHMIAMSSAVYNPFLYAWLNDNFKREFRNLVPC 1313
            +  + L+I  Y+++ ++G+ GN  +++V+ RSR M  +TN FI NLA SD++MC   VPFT    F  + W     +C ++ +   V+VYVS  T TAI +DR++  VHP   R+    C +++  IW+++  +  P AV  T   + ++   + C+E W   +  R  + + + ++ +VLP S + + Y  IS  LR    S V  G  +    E +  RKRKT +++  +V  F +CW+P++   +  D+ +    DL  + +F +   +CH+ AMSS+  NPFLYAWL+D F+ E R +  C
Sbjct:   52 QSFKLLIIPSYTVVALVGIFGNYLLLYVICRSRKMHNVTNFFIGNLAFSDMLMCATWVPFTLAYAFNPHGWVFGRFMCYLVYLIQPVTVYVSVFTLTAIGVDRYYATVHPLKKRISVLACTYLLSGIWLLSCGLVAP-AVAHTYHVEFKNEGFTICEEFWMGQERERLAYAYSTLLITYVLPLSTLCISYLCISVKLR----SCVVPGHHTQSQAEAQRMRKRKTFRLVSLVVAAFGVCWMPISVFNVLRDIDI----DLIDKRYFLLIQLLCHLCAMSSSCCNPFLYAWLHDRFRAELRKMFTC 347          
BLAST of Neuropeptide Y receptor, invertebrate vs. Planmine SMEST
Match: SMESG000059151.1 (SMESG000059151.1)

HSP 1 Score: 700.279 bits (1806), Expect = 0.000e+0
Identity = 371/371 (100.00%), Postives = 371/371 (100.00%), Query Frame = 3
Query:  366 MILSNGTNDIFKNHEGLQYLVIAGYSIIFVLGVVGNSFVIFVVMRSRHMRTITNIFISNLALSDIIMCLIAVPFTPIALFMNNWTLPASLCKVLPMTMGVSVYVSTLTSTAIAIDRFFIIVHPFIPRMKNSLCGFXXXXXXXXXXXXSLPLAVYQTKRNDLQSNTSKCQEVWPIDSSREVFTFVSFVLQFVLPCSIISVCYFKISKILRERCKSKVGSGTKSXXXXXXXXXXXXXTNKMLIAMVTIFVICWIPLNSLWMATDMSMNFKYDLRLQFFFPIGFFICHMIAMSSAVYNPFLYAWLNDNFKREFRNLVPCLSCILKPVLPNNPSVTCRPDSRIATTYQMTTCEQEEDSSKKTLLPNSDSHIGLVN 1478
            MILSNGTNDIFKNHEGLQYLVIAGYSIIFVLGVVGNSFVIFVVMRSRHMRTITNIFISNLALSDIIMCLIAVPFTPIALFMNNWTLPASLCKVLPMTMGVSVYVSTLTSTAIAIDRFFIIVHPFIPRMKNSLCGFIICVIWIIAILISLPLAVYQTKRNDLQSNTSKCQEVWPIDSSREVFTFVSFVLQFVLPCSIISVCYFKISKILRERCKSKVGSGTKSIRGKEGEIKRKRKTNKMLIAMVTIFVICWIPLNSLWMATDMSMNFKYDLRLQFFFPIGFFICHMIAMSSAVYNPFLYAWLNDNFKREFRNLVPCLSCILKPVLPNNPSVTCRPDSRIATTYQMTTCEQEEDSSKKTLLPNSDSHIGLVN
Sbjct:    1 MILSNGTNDIFKNHEGLQYLVIAGYSIIFVLGVVGNSFVIFVVMRSRHMRTITNIFISNLALSDIIMCLIAVPFTPIALFMNNWTLPASLCKVLPMTMGVSVYVSTLTSTAIAIDRFFIIVHPFIPRMKNSLCGFIICVIWIIAILISLPLAVYQTKRNDLQSNTSKCQEVWPIDSSREVFTFVSFVLQFVLPCSIISVCYFKISKILRERCKSKVGSGTKSIRGKEGEIKRKRKTNKMLIAMVTIFVICWIPLNSLWMATDMSMNFKYDLRLQFFFPIGFFICHMIAMSSAVYNPFLYAWLNDNFKREFRNLVPCLSCILKPVLPNNPSVTCRPDSRIATTYQMTTCEQEEDSSKKTLLPNSDSHIGLVN 371          
BLAST of Neuropeptide Y receptor, invertebrate vs. Planmine SMEST
Match: SMESG000066072.1 (SMESG000066072.1)

HSP 1 Score: 324.709 bits (831), Expect = 1.522e-106
Identity = 171/344 (49.71%), Postives = 235/344 (68.31%), Query Frame = 3
Query:  414 LQYLVIAGYSIIFVLGVVGNSFVIFVVMRSRHMRTITNIFISNLALSDIIMCLIAVPFTPIALFMNNWTLPASLCKVLPMTMGVSVYVSTLTSTAIAIDRFFIIVHPFIPRMKNSLCGFXXXXXXXXXXXXSLPLAVYQTKRNDLQSNTSKCQEVWPIDSSREVFTFVSFVLQFVLPCSIISVCYFKISKILRERCKSKVGSGTKSXXXXXXXXXXXXXTNKMLIAMVTIFVICWIPLNSLWMATDM-SMNFKYDLRLQFFFPIGFFICHMIAMSSAVYNPFLYAWLNDNFKREFRNLVPCLSCILKPVLPNNPSVTCRPDSRIATTYQMTTCEQEEDSSKKTL 1442
            L+  +I+ YS+IFVLG+ GN+ VIFV++R++ M T+TN FI+NLA SDI+MC++AVPFTPIAL++ NWTLP  +CK+LPMTM +SVYVSTLTS  I+IDR+F+IV+PF  RMK S C F++ +IW +AIL S PLA Y  K ND+  N S C E WP +  + ++T  SF++QFVLP   IS CYF+IS+ L+ RC  K+    KS+     +IKRKRKTNKMLIAMV IF++CWIPLN LW+ TD+   + +  L    +F   FFICH+IAM SA+YNPFLY W+N+NF++EF ++  C       ++  N +          + Y ++  E  +    + L
Sbjct:   26 LKTFIISSYSMIFVLGLSGNALVIFVILRNKAMYTVTNFFITNLAASDILMCIVAVPFTPIALYLENWTLPELVCKLLPMTMAISVYVSTLTSLVISIDRYFVIVYPFKVRMKLSFCRFLLVLIWGLAILASFPLAKYHKKENDVLRNISTCHEKWPDNRWKGIYTVSSFIVQFVLPTIAISFCYFQISRTLQSRCNRKLSKKIKSLSRVLNDIKRKRKTNKMLIAMVVIFIVCWIPLNVLWIITDLIYSDEQSKLNTNLYFTTIFFICHLIAMCSALYNPFLYGWMNENFRQEFCSVFSCWRSRRALLIEQNSTFRKNSKKHPISDYHLSLIEANKKPHNELL 369          
BLAST of Neuropeptide Y receptor, invertebrate vs. Planmine SMEST
Match: SMESG000036403.1 (SMESG000036403.1)

HSP 1 Score: 276.174 bits (705), Expect = 3.576e-88
Identity = 151/275 (54.91%), Postives = 202/275 (73.45%), Query Frame = 3
Query:  510 MRTITNIFISNLALSDIIMCLIAVPFTPIALFMNNWTLPASLCKVLPMTMGVSVYVSTLTSTAIAIDRFFIIVHPFIPRMKNSLCGFXXXXXXXXXXXXSLPLAVYQTKRNDLQSNTSKCQEVWPIDSSREVFTFVSFVLQFVLPCSIISVCYFKISKILRERCKSKVGSGTKSXXXXXXXXXXXXXTNKMLIAMVTIFVICWIPLNSLWMATDMSMNFKYDLRLQFFFPIGFFICHMIAMSSAVYNPFLYAWLNDNFKREFRNLVPCLSCILKP 1334
            M+TITN+FI+NLALSDI+  LIA+PFTPIA+++  W  PA LCK+LPMTMG+SVYVSTLTSTAIA+DR+ +IVHPFIPRMK  +C  +I +IW++  LI+LPLAVYQ+K     +N + C EVW    SRE++T  +F+LQF++PC I S+CYF++SK+L  R  +K+G   KS   +E E+KRKR+TN MLIAMV IFV+CW PLN LW+  ++   F   L     F + F   H+IAMS  +YNPFLY W+N NF+ EF+ ++PCL   ++P
Sbjct:    1 MQTITNMFITNLALSDILTTLIAIPFTPIAVYLEEWIFPAFLCKLLPMTMGLSVYVSTLTSTAIALDRYIMIVHPFIPRMKMKVCILLIFLIWVVGTLITLPLAVYQSKLFMNSTNRTDCVEVWQTPKSREIYTSFNFILQFIMPCLITSICYFQVSKVLNMRGANKIGCRIKSREREELEVKRKRRTNHMLIAMVIIFVMCWTPLNLLWIFGEILQKFDISLSQSGHFFLFFLCFHLIAMSGTMYNPFLYGWMNKNFRLEFQKVLPCLKIPVEP 275          
BLAST of Neuropeptide Y receptor, invertebrate vs. Planmine SMEST
Match: SMESG000053241.1 (SMESG000053241.1)

HSP 1 Score: 143.28 bits (360), Expect = 1.248e-37
Identity = 109/363 (30.03%), Postives = 191/363 (52.62%), Query Frame = 3
Query:  312 FLNKIL--TFQREYIVIILAMILSNGTNDIFKNHEGLQYLV--IAGYSIIFVLGVVGNSFVIFVVMRSRHMRTITNIFISNLALSDIIMCLIAVPFTPIAL--FMNNWTLPASLCKVLPMTMGVSVYVSTLTSTAIAIDRFFIIVHPFIPRMKNSLCGFXXXXXXXXXXXXSL----PLAVYQTKR--NDLQSNTSKCQEVWPIDSSREV---FTFVSFVLQFVLPCSIISVCYFKISKILRERCKSKVGSGTKSXXXXXXXXXXXXXTNK-------------MLIAMVTIFVICWIPLNSLWMATDMSMNFK------YDLRLQFFFPIGFFICHMIAMSSAVYNPFLYAWLNDNFKREFR 1298
            F+NK L  +F++ Y+ I+   ++       F     L +L+  +  Y  + V+G +G+S VI+VV+RS+ +RT  N+FI NLA++D+I+C  + PF  I L  F   W     +CK++ +  G +V VST++ TAIA+DR+ +I+ P     +NSL       + +   ++SL    PL ++      N L++N ++C E       R++   ++  + VL +V+P SI+++ Y KI +I+++R  +      +S        K +  T+K             +L+++  +F I W+PLN + M  D+ + +         LR+Q        IC ++ ++SA  NP LY WLNDNF+ EF+
Sbjct:   17 FVNKCLNESFRQAYLEILQDEMIRGRNMGKF----SLSFLIPLVLSYIAMIVIGTLGSSLVIYVVLRSKTLRTPRNMFILNLAITDLILCAFSQPFNIIRLLSFHKEWIFGEWVCKLVGLFTGTNVCVSTISITAIALDRYQVILCP----TRNSLQLIGAIKVMLGIWILSLIIASPLVLFSGVETVNMLKANHTRCTEHTVEIYMRKLKVGYSIATLVLLYVIPLSIVTITYMKIYRIIKQRMNNLHKKDLESSNSLPNSHKMELLTDKQKYDIQRQRRANILLLSITIVFAISWLPLNLINMIMDLYLMYNESTVGPMSLRIQ-------SICLLMVLTSACTNPILYGWLNDNFRHEFK 364          
BLAST of Neuropeptide Y receptor, invertebrate vs. Planmine SMEST
Match: SMESG000004267.1 (SMESG000004267.1)

HSP 1 Score: 135.576 bits (340), Expect = 2.553e-34
Identity = 105/352 (29.83%), Postives = 182/352 (51.70%), Query Frame = 3
Query:  414 LQYLVIAG-------YSIIFVLGVVGNSFVIFVVMRSRHMRTITNIFISNLALSDIIMCLIAVPFTPIALFM--NNWTLPASLCKVLPMTMGVSVYVSTLTSTAIAIDRFFIIVHPFIPRMKNSLCGFXXXXXXXXXXXXSLPLAVYQTKRNDLQSNTSKCQEVWPIDSSREVFTFVSFVLQFVLPCSIISVCYFKI---------------SKILRERCKSKVGSGTKSXXXXXXXXXXXXXTNKMLIAMVTIFVICWIPLN--SLWMATDMSMNFKY-----DLRLQFFFPIGFF-------------------ICHMIAMSSAVYNPFLYAWLNDNFKREFRNLVPCLS 1319
            L+ L +AG       + ++ + GV GN+ V+F VMR R ++T  N+FI NLA+SD+ +C+   PF  + L +  + WT    LCK+  +  G +V+VST+T TAIA+DRF +I++P    +++      +C IWII+ +++ PL ++     D +   S  ++ +   +++ V+T +S V Q+ +P  I+S+ Y +I                +I   + K +  +  K    ++ E +R+R+TN +L  +  +F + W+PLN  +L+MA     NF +     D +  F  P   F                   +C M+ ++SA  NP LY WLNDNF++    ++ C S
Sbjct:   59 LEKLELAGLITILTIFILMIIFGVFGNALVVFAVMRYRQLQTARNVFILNLAISDLCLCIFTQPFNLLRLLVKYHPWTYGDVLCKMSALLQGTNVFVSTITITAIALDRFQVIIYPTRSAVQSLEAVLCLCSIWIISCIMASPLLLFSRVYKDHRDYYSCGEDDFRQKTNKLVYTIISIVFQYFVPILIVSIAYIRIYLRIKYRLINSAINTKQIKENKSKYESINSGKFSAKQKKEKQRQRRTNMLLANLSILFALSWLPLNIVNLYMAVK-EHNFNFTISTGDKKSSFSIPSTNFSNNLYDTNSNDSYSNFIQAVCLMLVLASACINPILYGWLNDNFRKVLPKMLKCSS 409          
The following BLAST results are available for this feature:
BLAST of Neuropeptide Y receptor, invertebrate vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NPY2R3.346e-3733.12neuropeptide Y receptor Y2 [Source:HGNC Symbol;Acc... [more]
NPY2R3.346e-3733.12neuropeptide Y receptor Y2 [Source:HGNC Symbol;Acc... [more]
NPFFR23.761e-3530.51neuropeptide FF receptor 2 [Source:HGNC Symbol;Acc... [more]
NPFFR23.955e-3530.51neuropeptide FF receptor 2 [Source:HGNC Symbol;Acc... [more]
NPY1R1.845e-3430.67neuropeptide Y receptor Y1 [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of Neuropeptide Y receptor, invertebrate vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
npr-65.925e-4336.13NeuroPeptide Receptor family [Source:UniProtKB/Tr... [more]
npr-102.395e-3832.69NeuroPeptide Receptor family [Source:UniProtKB/Tr... [more]
npr-21.123e-3630.49NeuroPeptide Receptor family [Source:UniProtKB/Tr... [more]
npr-21.472e-3630.49NeuroPeptide Receptor family [Source:UniProtKB/Tr... [more]
npr-22.236e-3630.49NeuroPeptide Receptor family [Source:UniProtKB/Tr... [more]
back to top
BLAST of Neuropeptide Y receptor, invertebrate vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NPFR3.864e-4235.06gene:FBgn0037408 transcript:FBtr0308318[more]
NPFR3.917e-4235.06gene:FBgn0037408 transcript:FBtr0078590[more]
NPFR1.046e-3933.71gene:FBgn0037408 transcript:FBtr0308316[more]
NPFR1.229e-3933.71gene:FBgn0037408 transcript:FBtr0308317[more]
sNPF-R5.675e-3652.05gene:FBgn0036934 transcript:FBtr0332667[more]
back to top
BLAST of Neuropeptide Y receptor, invertebrate vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
npy2rl1.874e-4834.13neuropeptide Y receptor Y2, like [Source:ZFIN;Acc:... [more]
npy2r7.182e-4032.46neuropeptide Y receptor Y2 [Source:ZFIN;Acc:ZDB-GE... [more]
npy2r8.779e-4032.46neuropeptide Y receptor Y2 [Source:ZFIN;Acc:ZDB-GE... [more]
prlhr2a8.861e-4031.82prolactin releasing hormone receptor 2a [Source:ZF... [more]
npffr1l31.060e-3930.47neuropeptide FF receptor 1 like 3 [Source:ZFIN;Acc... [more]
back to top
BLAST of Neuropeptide Y receptor, invertebrate vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
taf1b2.626e-4533.03TATA-box binding protein associated factor, RNA po... [more]
ENSXETT00000044281.19.121e-4333.11pep primary_assembly:Xenopus_tropicalis_v9.1:3:115... [more]
NPY2R9.968e-3932.57neuropeptide Y receptor Y2 [Source:NCBI gene;Acc:1... [more]
gamt9.014e-3832.95guanidinoacetate N-methyltransferase [Source:Xenba... [more]
GPR831.171e-3735.95G protein-coupled receptor 83 [Source:NCBI gene;Ac... [more]
back to top
BLAST of Neuropeptide Y receptor, invertebrate vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Prlhr1.971e-4133.55prolactin releasing hormone receptor [Source:MGI S... [more]
Npy2r4.753e-3733.12neuropeptide Y receptor Y2 [Source:MGI Symbol;Acc:... [more]
Npy2r4.753e-3733.12neuropeptide Y receptor Y2 [Source:MGI Symbol;Acc:... [more]
Npy2r4.753e-3733.12neuropeptide Y receptor Y2 [Source:MGI Symbol;Acc:... [more]
Npy6r5.414e-3730.23neuropeptide Y receptor Y6 [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of Neuropeptide Y receptor, invertebrate vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9VNM1|NPFR_DROME3.926e-4135.06Neuropeptide F receptor OS=Drosophila melanogaster... [more]
sp|Q6VMN6|PRLHR_MOUSE1.379e-4033.55Prolactin-releasing peptide receptor OS=Mus muscul... [more]
sp|Q64121|PRLHR_RAT7.007e-4033.22Prolactin-releasing peptide receptor OS=Rattus nor... [more]
sp|G4WMX4|RYAR_TRICA1.994e-3831.41RYamide receptor OS=Tribolium castaneum OX=7070 GN... [more]
sp|Q4EW11|PRLHR_BOVIN2.872e-3832.82Prolactin-releasing peptide receptor OS=Bos taurus... [more]
back to top
BLAST of Neuropeptide Y receptor, invertebrate vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A193KUI60.000e+0100.00NPYR-8 OS=Schmidtea mediterranea OX=79327 GN=npyr-... [more]
A0A183W5E72.538e-11960.61G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A183N3J77.680e-11761.78G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A183NS235.479e-11661.46G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A183RUL55.575e-11661.46G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
back to top
BLAST of Neuropeptide Y receptor, invertebrate vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
npy2rl5.216e-4435.83neuropeptide Y receptor type 2-like [Source:NCBI g... [more]
npy2rl5.216e-4435.83neuropeptide Y receptor type 2-like [Source:NCBI g... [more]
npy2rl5.693e-4435.83neuropeptide Y receptor type 2-like [Source:NCBI g... [more]
npy2r6.140e-4232.79neuropeptide Y receptor Y2 [Source:ZFIN;Acc:ZDB-GE... [more]
prlhr2b1.135e-4133.99prolactin-releasing peptide receptor-like [Source:... [more]
back to top
BLAST of Neuropeptide Y receptor, invertebrate vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prlh2r4.300e-4633.04prolactin releasing hormone 2 receptor [Source:ZFI... [more]
npy8br1.727e-3830.55neuropeptide Y receptor Y8b [Source:ZFIN;Acc:ZDB-G... [more]
npffr1l35.651e-3230.72neuropeptide FF receptor 1 like 3 [Source:ZFIN;Acc... [more]
qrfpr43.036e-3127.74pyroglutamylated RFamide peptide receptor 4 [Sourc... [more]
kiss1rb6.715e-3129.87KISS1 receptor b [Source:ZFIN;Acc:ZDB-GENE-060526-... [more]
back to top
BLAST of Neuropeptide Y receptor, invertebrate vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neuropeptide Y receptor, invertebrate vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO364732.311e-3731.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO496191.778e-3631.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO460842.584e-3530.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO460302.109e-3330.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO364531.017e-3128.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Neuropeptide Y receptor, invertebrate vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
npy2rl1.880e-4834.87neuropeptide Y receptor type 2 [Source:NCBI gene;A... [more]
npy2rl1.880e-4834.87neuropeptide Y receptor type 2 [Source:NCBI gene;A... [more]
npy2rl1.926e-4834.87neuropeptide Y receptor type 2 [Source:NCBI gene;A... [more]
npy2r1.142e-4533.11neuropeptide Y receptor Y2 [Source:ZFIN;Acc:ZDB-GE... [more]
prlhr2a2.054e-4233.11prolactin-releasing peptide receptor [Source:NCBI ... [more]
back to top
BLAST of Neuropeptide Y receptor, invertebrate vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000059151.10.000e+0100.00SMESG000059151.1[more]
SMESG000066072.11.522e-10649.71SMESG000066072.1[more]
SMESG000036403.13.576e-8854.91SMESG000036403.1[more]
SMESG000053241.11.248e-3730.03SMESG000053241.1[more]
SMESG000004267.12.553e-3429.83SMESG000004267.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024342 ID=SMED30024342|Name=Neuropeptide Y receptor, invertebrate|organism=Schmidtea mediterranea sexual|type=transcript|length=1666bp
GGAACCTTCAAATTATGTTTTACCAATTTATAGTTTAGAATTTTAAAAAT
TAAAAATATTAAATTTTATAAATATTTCTTTAAAAGAAAGAGAAAAATTC
CTAAATATAAAATAATAAATAATAAACGGGGAAGTGTTAAAATAATTGTA
ACTTAAAGTTAGAAAAATAAGTCATAGGAAATTATCGATCCTCATTAGAA
AAATTGTGTGTATTGGTAAATTTTCTTGTTTTTTCTACTCATGAAAATAA
AAATAAATACCATTTGAAAACAAGAATTCATCATATTAAGATAATTTATT
AAATGAATTACTTCTTAAATAAAATTTTAACTTTTCAAAGAGAGTATATA
GTAATTATTCTCGCAATGATTTTATCGAATGGCACAAATGACATATTCAA
GAATCACGAGGGACTTCAGTATTTAGTGATTGCCGGTTATTCAATAATTT
TCGTTTTGGGAGTGGTCGGCAACAGCTTTGTCATATTTGTGGTAATGCGC
AGTCGTCATATGCGGACAATTACAAACATTTTTATTAGCAATCTTGCACT
CTCTGATATCATTATGTGTTTAATTGCAGTACCATTTACGCCAATTGCTT
TATTTATGAATAATTGGACACTTCCAGCCTCTCTGTGTAAAGTTCTTCCG
ATGACTATGGGAGTTTCAGTTTATGTGTCAACACTTACTTCAACTGCAAT
AGCAATAGATAGATTCTTTATTATAGTTCATCCATTTATACCTCGAATGA
AGAACAGTTTATGTGGTTTTATAATTTGTGTTATTTGGATAATTGCGATT
CTCATATCTCTTCCTCTTGCAGTTTATCAAACAAAACGCAATGATCTACA
AAGCAACACTTCAAAATGTCAAGAGGTTTGGCCAATAGATTCATCAAGAG
AGGTATTTACATTTGTCAGTTTTGTGCTTCAATTTGTTCTACCATGCAGC
ATTATATCAGTTTGTTACTTTAAAATCAGTAAAATTCTTCGAGAACGATG
TAAATCGAAAGTAGGATCCGGAACAAAAAGTATTCGAGGAAAGGAAGGTG
AAATAAAAAGGAAGCGAAAAACTAACAAAATGCTTATTGCCATGGTAACG
ATATTTGTAATATGTTGGATTCCCTTGAATTCATTATGGATGGCAACGGA
TATGTCTATGAATTTTAAATATGATTTGAGACTGCAGTTTTTTTTCCCGA
TTGGATTTTTTATCTGCCACATGATAGCAATGAGTAGCGCGGTTTACAAC
CCATTTTTGTACGCTTGGTTAAATGATAACTTTAAAAGGGAATTCAGAAA
TTTGGTTCCTTGTCTAAGCTGCATATTGAAACCGGTGTTACCCAACAATC
CTAGCGTAACATGCCGACCAGACAGCAGAATTGCAACGACATACCAGATG
ACCACTTGCGAACAAGAAGAAGACTCATCCAAGAAAACTCTCCTTCCGAA
CTCTGATTCTCATATTGGATTAGTAAATTAAACTGTGATTATTTTTTATT
TACATGTATGAGTTTGCATTTATAAACAAGGATACCTTTAGGTTAATTAA
ATAATATTATTCTTTATTACATTTAAGGAATGTTTTGTGTTTTGTATTAT
TTGTAAACAAATTATAAAATACTACTTTAATTGTGATGTGAATAAATTTA
TTTTACTGAAAAAAAA
back to top

protein sequence of SMED30024342-orf-1

>SMED30024342-orf-1 ID=SMED30024342-orf-1|Name=SMED30024342-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=393bp
MNYFLNKILTFQREYIVIILAMILSNGTNDIFKNHEGLQYLVIAGYSIIF
VLGVVGNSFVIFVVMRSRHMRTITNIFISNLALSDIIMCLIAVPFTPIAL
FMNNWTLPASLCKVLPMTMGVSVYVSTLTSTAIAIDRFFIIVHPFIPRMK
NSLCGFIICVIWIIAILISLPLAVYQTKRNDLQSNTSKCQEVWPIDSSRE
VFTFVSFVLQFVLPCSIISVCYFKISKILRERCKSKVGSGTKSIRGKEGE
IKRKRKTNKMLIAMVTIFVICWIPLNSLWMATDMSMNFKYDLRLQFFFPI
GFFICHMIAMSSAVYNPFLYAWLNDNFKREFRNLVPCLSCILKPVLPNNP
SVTCRPDSRIATTYQMTTCEQEEDSSKKTLLPNSDSHIGLVN*
back to top
Aliases
The feature 'Neuropeptide Y receptor, invertebrate' has the following synonyms
Synonym
Smed_09627
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000017photoreceptor neuron
PLANA:0000044cephalic ganglia
PLANA:0000099neuron
PLANA:0000208testis
PLANA:0000418head
PLANA:0002056medial muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR000611NPY_rcpt
IPR000276GPCR_Rhodpsn
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: molecular function
TermDefinition
GO:0004983neuropeptide Y receptor activity
GO:0004930G-protein coupled receptor activity
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
GO:0007218neuropeptide signaling pathway
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000611Neuropeptide Y receptor familyPRINTSPR01012NRPEPTIDEYRcoord: 45..57
score: 41.96
coord: 297..310
score: 41.56
coord: 98..113
score: 46.31
coord: 286..295
score: 40.45
IPR000276G protein-coupled receptor, rhodopsin-likePRINTSPR00237GPCRRHODOPSNcoord: 236..260
score: 26.44
coord: 132..153
score: 24.36
coord: 182..205
score: 27.94
coord: 53..74
score: 34.24
coord: 98..120
score: 28.12
coord: 20..44
score: 28.57
coord: 281..307
score: 26.79
IPR000276G protein-coupled receptor, rhodopsin-likeSMARTSM013817TM_GPCR_Srsx_2coord: 29..314
e-value: 2.7E-4
score: -46.3
IPR000276G protein-coupled receptor, rhodopsin-likePFAMPF000017tm_1coord: 35..299
e-value: 3.4E-51
score: 174.1
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 4..355
e-value: 1.4E-88
score: 298.8
NoneNo IPR availablePANTHERPTHR24235:SF12GH23382Pcoord: 8..340
NoneNo IPR availablePANTHERPTHR24235FAMILY NOT NAMEDcoord: 8..340
NoneNo IPR availableCDDcd152037tmA_NPYR-likecoord: 19..310
e-value: 3.04013E-122
score: 352.677
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 10..333
NoneNo IPR availableTMHMMTMhelixcoord: 239..261
NoneNo IPR availableTMHMMTMhelixcoord: 20..42
NoneNo IPR availableTMHMMTMhelixcoord: 55..77
NoneNo IPR availableTMHMMTMhelixcoord: 180..202
NoneNo IPR availableTMHMMTMhelixcoord: 132..154
NoneNo IPR availableTMHMMTMhelixcoord: 97..119
NoneNo IPR availableTMHMMTMhelixcoord: 276..298
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 35..299
score: 45.026