SAM pointed domain-containing Ets transcription factor-like protein

Overview
NameSAM pointed domain-containing Ets transcription factor-like protein
Smed IDSMED30024319
Length (bp)1779
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SAM pointed domain-containing Ets transcription factor-like protein (SMED30024319) t-SNE clustered cells

Violin plots show distribution of expression levels for SAM pointed domain-containing Ets transcription factor-like protein (SMED30024319) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SAM pointed domain-containing Ets transcription factor-like protein (SMED30024319) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SAM pointed domain-containing Ets transcription factor-like protein (SMED30024319) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024319

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30024319SMESG000080567.1 SMESG000031150.1 SMESG000019154.1 SMESG000015263.1 dd_Smed_v4_6015_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30024319SMESG000080567.1 SMESG000031150.1 SMESG000019154.1 SMESG000015263.1 dd_Smed_v4_6015_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30024319SMESG000080567.1 SMESG000031150.1 SMESG000019154.1 SMESG000015263.1 dd_Smed_v4_6015_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30024319SMESG000005612.1 Contig595GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30024319SMESG000080567.1 Contig595GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30024319SMESG000080567.1 SMESG000031150.1 SMESG000019154.1 SMESG000015263.1 dd_Smed_v4_6015_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SAM pointed domain-containing Ets transcription factor-like protein vs. Ensembl Human
Match: SPDEF (SAM pointed domain containing ETS transcription factor [Source:HGNC Symbol;Acc:HGNC:17257])

HSP 1 Score: 94.7449 bits (234), Expect = 1.542e-20
Identity = 61/205 (29.76%), Postives = 99/205 (48.29%), Query Frame = 1
Query:  613 KDIDFIEETRNIFKLPYDYREWTNENIENWLYWIRHKLRFKFPKLSKEIIDIRKEEFQTIEVWQEKFGTDAGG-CMFKHFKMWLKYHQMKSKSDVGRKH--GNEYNKSSVDKPRRRNEKKDGLYLWQILLTMLFSKHC-SPYIHWTDYESGMFKIKDPHSVSIIWGESKGNRNMTYDKMSRSMRQYYKSNLLKKTN-HDKLNYCF 1212
            KDI+   +  NI   P D   W+  N++ WL W  H+  ++ P + K   ++  +E   +   Q +  +  GG  +  H  +W     MK ++  G  H   +   +S  D     +     ++LWQ L  +L   H    +I W + E G+FKI+D   V+ +WG  K    M YDK+SRS+RQYYK  +++K +   +L Y F
Sbjct:  132 KDIETACKLLNITADPMD---WSPSNVQKWLLWTEHQ--YRLPPMGKAFQELAGKELCAMSEEQFRQRSPLGGDVLHAHLDIWKSAAWMKERTSPGAIHYCASTSEESWTDSEVDSSCSGQPIHLWQFLKELLLKPHSYGRFIRWLNKEKGIFKIEDSAQVARLWGIRKNRPAMNYDKLSRSIRQYYKKGIIRKPDISQRLVYQF 331          
BLAST of SAM pointed domain-containing Ets transcription factor-like protein vs. Ensembl Human
Match: SPDEF (SAM pointed domain containing ETS transcription factor [Source:HGNC Symbol;Acc:HGNC:17257])

HSP 1 Score: 86.2705 bits (212), Expect = 7.651e-18
Identity = 58/203 (28.57%), Postives = 94/203 (46.31%), Query Frame = 1
Query:  613 KDIDFIEETRNIFKLPYDYREWTNENIENWLYWIRHKLRFKFPKLSKEIIDIRKEEFQTIEVWQEKFGTDAGG-CMFKHFKMWLKYHQMKSKSDVGRKHGNEYNKSSVDKPRRRNEKKDGLYLWQILLTMLFSKHC-SPYIHWTDYESGMFKIKDPHSVSIIWGESKGNRNMTYDKMSRSMRQYYKSNLLKKTN-HDKLNYCF 1212
            KDI+   +  NI   P D   W+  N++ WL W  H+  ++ P + K   ++  +E   +   Q +  +  GG  +  H  +W              K  +   +S  D     +     ++LWQ L  +L   H    +I W + E G+FKI+D   V+ +WG  K    M YDK+SRS+RQYYK  +++K +   +L Y F
Sbjct:  132 KDIETACKLLNITADPMD---WSPSNVQKWLLWTEHQ--YRLPPMGKAFQELAGKELCAMSEEQFRQRSPLGGDVLHAHLDIW--------------KSASTSEESWTDSEVDSSCSGQPIHLWQFLKELLLKPHSYGRFIRWLNKEKGIFKIEDSAQVARLWGIRKNRPAMNYDKLSRSIRQYYKKGIIRKPDISQRLVYQF 315          
BLAST of SAM pointed domain-containing Ets transcription factor-like protein vs. Ensembl Human
Match: ELF1 (E74 like ETS transcription factor 1 [Source:HGNC Symbol;Acc:HGNC:3316])

HSP 1 Score: 80.1073 bits (196), Expect = 4.294e-15
Identity = 49/173 (28.32%), Postives = 79/173 (45.66%), Query Frame = 1
Query:  775 EEFQTIEVWQEKFGTDAGGCMFKHFKMWLKYHQMKSKSDVGRKHGNEYNKSSVDKPRRRNEKKD--------------------------GLYLWQILLTMLFSKH-CSPYIHWTDYESGMFKIKDPHSVSIIWGESKGNRNMTYDKMSRSMRQYYKSNLLKKTNHDKLNYCF 1212
            E  +TIE  +     D+ G M    ++      M+++  V  K+ +    SS ++P+R+  +K                            +YLW+ LL +L  K  C  YI WT  E G+FK+ D  +VS +WG+ K   +M Y+ M R++R YY+  +L K    +L Y F
Sbjct:   94 ETIETIEAAEALLNMDSPGPMLDEKRINGIPEVMETQ-QVQEKYADSPGASSPEQPKRKKGRKTKPPRPDSPATTPNISVKKKNKDGKGNTIYLWEFLLALLQDKATCPKYIKWTQREKGIFKLVDSKAVSRLWGKHKNKPDMNYETMGRALRYYYQRGILAKVEGQRLVYQF 265          
BLAST of SAM pointed domain-containing Ets transcription factor-like protein vs. Ensembl Human
Match: ETV7 (ETS variant transcription factor 7 [Source:HGNC Symbol;Acc:HGNC:18160])

HSP 1 Score: 72.7886 bits (177), Expect = 3.345e-14
Identity = 33/83 (39.76%), Postives = 50/83 (60.24%), Query Frame = 1
Query:  964 DGLYLWQILLTMLFSKHCSPYIHWTDYESGMFKIKDPHSVSIIWGESKGNRNMTYDKMSRSMRQYYKSNLLKKTNHDKLNYCF 1212
            D   LW  +  +L      PYI W D ++ +F++ DP+ ++ +WG  K   NMTY+KMSR++R YYK N++KK    KL + F
Sbjct:   71 DCRLLWDYVYQLLLDTRYEPYIKWEDKDAKIFRVVDPNGLARLWGNHKNRVNMTYEKMSRALRHYYKLNIIKKEPGQKLLFRF 153          
BLAST of SAM pointed domain-containing Ets transcription factor-like protein vs. Ensembl Human
Match: ELF2 (E74 like ETS transcription factor 2 [Source:HGNC Symbol;Acc:HGNC:3317])

HSP 1 Score: 72.0182 bits (175), Expect = 7.632e-14
Identity = 35/89 (39.33%), Postives = 53/89 (59.55%), Query Frame = 1
Query:  949 RNEKKDGLYLWQILLTMLFSKHCSP-YIHWTDYESGMFKIKDPHSVSIIWGESKGNRNMTYDKMSRSMRQYYKSNLLKKTNHDKLNYCF 1212
            + +K +  YLW+ LL +L  K+  P YI WT  E G+FK+ D  +VS +WG+ K   +M Y+ M R++R YY+  +L K    +L Y F
Sbjct:  100 KKKKGNTTYLWEFLLDLLQDKNTCPRYIKWTQREKGIFKLVDSKAVSKLWGKHKNKPDMNYETMGRALRYYYQRGILAKVEGQRLVYQF 188          
BLAST of SAM pointed domain-containing Ets transcription factor-like protein vs. Ensembl Celegans
Match: elf-1 (ETS-Like transcription Factor homolog [Source:UniProtKB/TrEMBL;Acc:Q400M2])

HSP 1 Score: 70.0922 bits (170), Expect = 1.406e-12
Identity = 37/104 (35.58%), Postives = 58/104 (55.77%), Query Frame = 1
Query:  910 NEYNKSSVDKPRRRNEKKDG--LYLWQILLTMLFSKHCSP-YIHWTDYESGMFKIKDPHSVSIIWGESKGNRNMTYDKMSRSMRQYYKSNLLKKTNHDKLNYCF 1212
            +E N + + +     ++KDG   YLW+ LL +L     SP +I W D   G+FK+ D  +VS +WG  K    M Y+ M R++R YY+  +L+K +  +L Y F
Sbjct:  271 SEPNPAPLAQRTPGKKQKDGQVTYLWEFLLRLLQDDQYSPKFIKWIDQAKGIFKLVDSKAVSRLWGMHKNKPGMNYETMGRALRYYYQRGILQKVDGQRLVYRF 374          
BLAST of SAM pointed domain-containing Ets transcription factor-like protein vs. Ensembl Celegans
Match: elf-1 (ETS-Like transcription Factor homolog [Source:UniProtKB/TrEMBL;Acc:Q400M2])

HSP 1 Score: 70.0922 bits (170), Expect = 1.406e-12
Identity = 37/104 (35.58%), Postives = 58/104 (55.77%), Query Frame = 1
Query:  910 NEYNKSSVDKPRRRNEKKDG--LYLWQILLTMLFSKHCSP-YIHWTDYESGMFKIKDPHSVSIIWGESKGNRNMTYDKMSRSMRQYYKSNLLKKTNHDKLNYCF 1212
            +E N + + +     ++KDG   YLW+ LL +L     SP +I W D   G+FK+ D  +VS +WG  K    M Y+ M R++R YY+  +L+K +  +L Y F
Sbjct:  271 SEPNPAPLAQRTPGKKQKDGQVTYLWEFLLRLLQDDQYSPKFIKWIDQAKGIFKLVDSKAVSRLWGMHKNKPGMNYETMGRALRYYYQRGILQKVDGQRLVYRF 374          
BLAST of SAM pointed domain-containing Ets transcription factor-like protein vs. Ensembl Celegans
Match: elf-1 (ETS-Like transcription Factor homolog [Source:UniProtKB/TrEMBL;Acc:Q400M2])

HSP 1 Score: 70.0922 bits (170), Expect = 1.613e-12
Identity = 39/111 (35.14%), Postives = 61/111 (54.95%), Query Frame = 1
Query:  889 DVGRKHGNEYNKSSVDKPRRRNEKKDG--LYLWQILLTMLFSKHCSP-YIHWTDYESGMFKIKDPHSVSIIWGESKGNRNMTYDKMSRSMRQYYKSNLLKKTNHDKLNYCF 1212
            D  R+  +E N + + +     ++KDG   YLW+ LL +L     SP +I W D   G+FK+ D  +VS +WG  K    M Y+ M R++R YY+  +L+K +  +L Y F
Sbjct:  266 DTSRRF-SEPNPAPLAQRTPGKKQKDGQVTYLWEFLLRLLQDDQYSPKFIKWIDQAKGIFKLVDSKAVSRLWGMHKNKPGMNYETMGRALRYYYQRGILQKVDGQRLVYRF 375          
BLAST of SAM pointed domain-containing Ets transcription factor-like protein vs. Ensembl Celegans
Match: elf-1 (ETS-Like transcription Factor homolog [Source:UniProtKB/TrEMBL;Acc:Q400M2])

HSP 1 Score: 70.0922 bits (170), Expect = 1.613e-12
Identity = 39/111 (35.14%), Postives = 61/111 (54.95%), Query Frame = 1
Query:  889 DVGRKHGNEYNKSSVDKPRRRNEKKDG--LYLWQILLTMLFSKHCSP-YIHWTDYESGMFKIKDPHSVSIIWGESKGNRNMTYDKMSRSMRQYYKSNLLKKTNHDKLNYCF 1212
            D  R+  +E N + + +     ++KDG   YLW+ LL +L     SP +I W D   G+FK+ D  +VS +WG  K    M Y+ M R++R YY+  +L+K +  +L Y F
Sbjct:  266 DTSRRF-SEPNPAPLAQRTPGKKQKDGQVTYLWEFLLRLLQDDQYSPKFIKWIDQAKGIFKLVDSKAVSRLWGMHKNKPGMNYETMGRALRYYYQRGILQKVDGQRLVYRF 375          
BLAST of SAM pointed domain-containing Ets transcription factor-like protein vs. Ensembl Celegans
Match: ets-8 (ETS class transcription factor [Source:UniProtKB/TrEMBL;Acc:O44138])

HSP 1 Score: 65.0846 bits (157), Expect = 2.225e-12
Identity = 38/106 (35.85%), Postives = 58/106 (54.72%), Query Frame = 1
Query:  907 GNEYNKSSVDKPRRRNEKKDGLYLWQILLTMLFSKHCSPYIHWTDYESGMFKIKDPHSVSIIWGESKGNRNMTYDKMSRSMRQYYKSNLLKKTNHDKLNYCFNMDD 1224
            GN+ N++  + PR  + KK   YL+Q++L     K+ +  I WT   S  F++ D   V+ +WG  KGN  M Y+ +SRS+R YYKS +++K       Y F  D 
Sbjct:   10 GNQENRNPKN-PRSTSHKKLRNYLFQMILKSENDKNVAKIIKWTKKSSLEFQMVDRQEVARLWGAEKGNLKMDYEFLSRSIRSYYKSGIMRKIPGKDFRYQFIADS 114          
BLAST of SAM pointed domain-containing Ets transcription factor-like protein vs. Ensembl Fly
Match: Ets21C (gene:FBgn0005660 transcript:FBtr0078079)

HSP 1 Score: 91.6633 bits (226), Expect = 2.516e-19
Identity = 58/199 (29.15%), Postives = 95/199 (47.74%), Query Frame = 1
Query:  649 FKLPYDYREWTNENIENWLYWIRHKLRF-------KFPKLSKEIIDIRKEEFQTIEVWQEKFGTDAGGCMFKHFKMWLKYHQMKSKSD--VGRKHGNEYNKSSVDKPRRRNEKKDG-LYLWQILLTMLFSKHCSPYIHWTDYESGMFKIKDPHSVSIIWGESKGNRNMTYDKMSRSMRQYYKSNLLKKTNHDKLNYCFN 1215
             ++P D   WT E+I +W+ W   K +        +FPK ++E+ D+ + +F     W        G  + +HF + L YH    ++   +     N Y   +    R   +   G + LWQ LL +L     +  I W + +SG F++ DP  V+  WGE K   NM YDK+SR++R YY  N++ K +  +  Y F+
Sbjct:  144 VEVPVDPHAWTPEDIASWVRWATRKFKLDPEPDIDRFPKDAQELCDLSRADF-----WVCAGSRRGGMLLAQHFAISL-YHATGRETSPMLNDDEPNPYQLLNAASHRLVAQGSGGQIQLWQFLLELLADSSNANAISW-EGQSGEFRLIDPDEVARRWGERKAKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFD 335          
BLAST of SAM pointed domain-containing Ets transcription factor-like protein vs. Ensembl Fly
Match: Ets21C (gene:FBgn0005660 transcript:FBtr0345429)

HSP 1 Score: 91.6633 bits (226), Expect = 2.516e-19
Identity = 58/199 (29.15%), Postives = 95/199 (47.74%), Query Frame = 1
Query:  649 FKLPYDYREWTNENIENWLYWIRHKLRF-------KFPKLSKEIIDIRKEEFQTIEVWQEKFGTDAGGCMFKHFKMWLKYHQMKSKSD--VGRKHGNEYNKSSVDKPRRRNEKKDG-LYLWQILLTMLFSKHCSPYIHWTDYESGMFKIKDPHSVSIIWGESKGNRNMTYDKMSRSMRQYYKSNLLKKTNHDKLNYCFN 1215
             ++P D   WT E+I +W+ W   K +        +FPK ++E+ D+ + +F     W        G  + +HF + L YH    ++   +     N Y   +    R   +   G + LWQ LL +L     +  I W + +SG F++ DP  V+  WGE K   NM YDK+SR++R YY  N++ K +  +  Y F+
Sbjct:  144 VEVPVDPHAWTPEDIASWVRWATRKFKLDPEPDIDRFPKDAQELCDLSRADF-----WVCAGSRRGGMLLAQHFAISL-YHATGRETSPMLNDDEPNPYQLLNAASHRLVAQGSGGQIQLWQFLLELLADSSNANAISW-EGQSGEFRLIDPDEVARRWGERKAKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFD 335          
BLAST of SAM pointed domain-containing Ets transcription factor-like protein vs. Ensembl Fly
Match: Ets21C (gene:FBgn0005660 transcript:FBtr0344014)

HSP 1 Score: 91.6633 bits (226), Expect = 2.516e-19
Identity = 58/199 (29.15%), Postives = 95/199 (47.74%), Query Frame = 1
Query:  649 FKLPYDYREWTNENIENWLYWIRHKLRF-------KFPKLSKEIIDIRKEEFQTIEVWQEKFGTDAGGCMFKHFKMWLKYHQMKSKSD--VGRKHGNEYNKSSVDKPRRRNEKKDG-LYLWQILLTMLFSKHCSPYIHWTDYESGMFKIKDPHSVSIIWGESKGNRNMTYDKMSRSMRQYYKSNLLKKTNHDKLNYCFN 1215
             ++P D   WT E+I +W+ W   K +        +FPK ++E+ D+ + +F     W        G  + +HF + L YH    ++   +     N Y   +    R   +   G + LWQ LL +L     +  I W + +SG F++ DP  V+  WGE K   NM YDK+SR++R YY  N++ K +  +  Y F+
Sbjct:  144 VEVPVDPHAWTPEDIASWVRWATRKFKLDPEPDIDRFPKDAQELCDLSRADF-----WVCAGSRRGGMLLAQHFAISL-YHATGRETSPMLNDDEPNPYQLLNAASHRLVAQGSGGQIQLWQFLLELLADSSNANAISW-EGQSGEFRLIDPDEVARRWGERKAKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFD 335          
BLAST of SAM pointed domain-containing Ets transcription factor-like protein vs. Ensembl Fly
Match: Eip74EF (gene:FBgn0000567 transcript:FBtr0075204)

HSP 1 Score: 73.1738 bits (178), Expect = 4.320e-13
Identity = 34/91 (37.36%), Postives = 55/91 (60.44%), Query Frame = 1
Query:  943 RRRNEKKDGLYLWQILLTMLFSK-HCSPYIHWTDYESGMFKIKDPHSVSIIWGESKGNRNMTYDKMSRSMRQYYKSNLLKKTNHDKLNYCF 1212
            +RR+ +    YLW+ LL +L  + +C  +I WT+ E G+FK+ D  +VS +WG  K   +M Y+ M R++R YY+  +L K +  +L Y F
Sbjct:  778 KRRSREGSTTYLWEFLLKLLQDREYCPRFIKWTNREKGVFKLVDSKAVSRLWGMHKNKPDMNYETMGRALRYYYQRGILAKVDGQRLVYQF 868          
BLAST of SAM pointed domain-containing Ets transcription factor-like protein vs. Ensembl Fly
Match: Eip74EF (gene:FBgn0000567 transcript:FBtr0100411)

HSP 1 Score: 73.1738 bits (178), Expect = 4.320e-13
Identity = 34/91 (37.36%), Postives = 55/91 (60.44%), Query Frame = 1
Query:  943 RRRNEKKDGLYLWQILLTMLFSK-HCSPYIHWTDYESGMFKIKDPHSVSIIWGESKGNRNMTYDKMSRSMRQYYKSNLLKKTNHDKLNYCF 1212
            +RR+ +    YLW+ LL +L  + +C  +I WT+ E G+FK+ D  +VS +WG  K   +M Y+ M R++R YY+  +L K +  +L Y F
Sbjct:  778 KRRSREGSTTYLWEFLLKLLQDREYCPRFIKWTNREKGVFKLVDSKAVSRLWGMHKNKPDMNYETMGRALRYYYQRGILAKVDGQRLVYQF 868          
BLAST of SAM pointed domain-containing Ets transcription factor-like protein vs. Ensembl Zebrafish
Match: SPDEF (SAM pointed domain containing ETS transcription factor [Source:NCBI gene;Acc:100003543])

HSP 1 Score: 86.6557 bits (213), Expect = 4.456e-18
Identity = 70/267 (26.22%), Postives = 120/267 (44.94%), Query Frame = 1
Query:  469 PSLSHAQISINNKNRVPVIEKKTCITIGDAPEFCKNLQEKNRNCDLDQ-------KDIDFIEETRNIFKLPYDYREWTNENIENWLYWIRHKLRFKFPKLSKEIIDIRKEEFQTIEVWQEKFGTDAGGC---MFKHFKMWLKYHQMKSKSDVGR---KHG----NEYNKSSVDKPRRRNEKKDGLYLWQILLTMLFSKHC-SPYIHWTDYESGMFKIKDPHSVSIIWGESKGNRNMTYDKMSRSMRQYYKSNLLKKTN-HDKLNYCF 1212
            P+ + A++      + PVI+      +G +P     L+E+     L+Q       + +  IE    +  +  D  EW   N++ WL W  H   ++ P++ K   D+  ++  ++   +E F   +  C   +  H  +W     MK +   G    + G    +E + S   +P         ++LWQ L  +L   H     I W + E G+FKI+D   V+ +WG  K    M YDK+SRS+RQYYK  +++K +   +L Y F
Sbjct:   75 PAAAGARL---EPEQCPVIDSPG---LGASP-LSPTLEEQVEERSLEQVQSLVVGEVLKDIETACKLLNITPDPMEWNCGNVQKWLLWTEH--LYRLPQVGKAFQDLDGKDLCSMS--EEDFRQRSPQCSETLHAHLDIWKSAAWMKERCSGGETRMREGEELWSEADSSCSGQP---------IHLWQFLRELLLKPHSYGRCIRWLNKEKGIFKIEDSAHVARLWGLRKNRPAMNYDKLSRSIRQYYKKGIIRKPDVSQRLVYQF 321          
BLAST of SAM pointed domain-containing Ets transcription factor-like protein vs. Ensembl Zebrafish
Match: elf2a (E74-like factor 2a (ets domain transcription factor) [Source:ZFIN;Acc:ZDB-GENE-040822-41])

HSP 1 Score: 77.7962 bits (190), Expect = 1.088e-14
Identity = 50/152 (32.89%), Postives = 72/152 (47.37%), Query Frame = 1
Query:  829 GCMFKHFKMWLKYHQMKSKSDVGRKHGNEYN--KSSVD---KPRRRNEKKDGLYLWQILLTMLFSKH-CSPYIHWTDYESGMFKIKDPHSVSIIWGESKGNRNMTYDKMSRSMRQYYKSNLLKKTNHDKLNYCF-------------NMDDN 1227
            G + K   +  +   +K K   GRK     N    S+D   K + ++ K    YLW+ LL +L  K  C  YI WT  E G+FK+ D  +VS +WG  K   +M Y+ M R++R YY+  +L K    +L Y F             NMDD+
Sbjct:  138 GPVAKDIIVLQEADSLKKKKRAGRKPRTPRNCCDGSLDLVYKRKSKDSKGSTTYLWEFLLDLLQDKETCPKYIKWTQKEKGIFKLVDSKAVSKLWGRHKNKPDMNYETMGRALRYYYQRGILSKVEGQRLVYQFKEMPKDIVFIDDDNMDDS 289          
BLAST of SAM pointed domain-containing Ets transcription factor-like protein vs. Ensembl Zebrafish
Match: elf2b (E74-like factor 2b (ets domain transcription factor) [Source:ZFIN;Acc:ZDB-GENE-031215-1])

HSP 1 Score: 75.0998 bits (183), Expect = 7.223e-14
Identity = 49/161 (30.43%), Postives = 79/161 (49.07%), Query Frame = 1
Query:  745 LSKEIIDIRKEEFQTIEVW---QEKFGTDAGGCMFKHFKMWLKYHQMKSKS-DVGRKHGNEYNKSSVDKPRRRNEKKDGLYLWQILLTMLFSKHCSP-YIHWTDYESGMFKIKDPHSVSIIWGESKGNRNMTYDKMSRSMRQYYKSNLLKKTNHDKLNYCF 1212
            L++ ++++  E+ + +EV    QE    D      +      K H + + S D+G K             ++  E K   YLW+ LL +L  K+  P YI WT  E G+FK+ D  +VS +WG+ K   +M Y+ M R++R YY+  +L K    +L Y F
Sbjct:   36 LTETVVEVSTEDMEPMEVVTVIQEPEMLDTEPSKRRKSGRKPKPHHISNGSPDMGIK-------------KKSREGKGSTYLWEFLLDLLQDKNTCPRYIKWTQREKGIFKLVDSKAVSKLWGKHKNKPDMNYETMGRALRYYYQRGILAKVEGQRLVYQF 183          
BLAST of SAM pointed domain-containing Ets transcription factor-like protein vs. Ensembl Zebrafish
Match: elf2b (E74-like factor 2b (ets domain transcription factor) [Source:ZFIN;Acc:ZDB-GENE-031215-1])

HSP 1 Score: 75.0998 bits (183), Expect = 9.470e-14
Identity = 49/161 (30.43%), Postives = 79/161 (49.07%), Query Frame = 1
Query:  745 LSKEIIDIRKEEFQTIEVW---QEKFGTDAGGCMFKHFKMWLKYHQMKSKS-DVGRKHGNEYNKSSVDKPRRRNEKKDGLYLWQILLTMLFSKHCSP-YIHWTDYESGMFKIKDPHSVSIIWGESKGNRNMTYDKMSRSMRQYYKSNLLKKTNHDKLNYCF 1212
            L++ ++++  E+ + +EV    QE    D      +      K H + + S D+G K             ++  E K   YLW+ LL +L  K+  P YI WT  E G+FK+ D  +VS +WG+ K   +M Y+ M R++R YY+  +L K    +L Y F
Sbjct:   78 LTETVVEVSTEDMEPMEVVTVIQEPEMLDTEPSKRRKSGRKPKPHHISNGSPDMGIK-------------KKSREGKGSTYLWEFLLDLLQDKNTCPRYIKWTQREKGIFKLVDSKAVSKLWGKHKNKPDMNYETMGRALRYYYQRGILAKVEGQRLVYQF 225          
BLAST of SAM pointed domain-containing Ets transcription factor-like protein vs. Ensembl Zebrafish
Match: elf2b (E74-like factor 2b (ets domain transcription factor) [Source:ZFIN;Acc:ZDB-GENE-031215-1])

HSP 1 Score: 75.0998 bits (183), Expect = 9.470e-14
Identity = 49/161 (30.43%), Postives = 79/161 (49.07%), Query Frame = 1
Query:  745 LSKEIIDIRKEEFQTIEVW---QEKFGTDAGGCMFKHFKMWLKYHQMKSKS-DVGRKHGNEYNKSSVDKPRRRNEKKDGLYLWQILLTMLFSKHCSP-YIHWTDYESGMFKIKDPHSVSIIWGESKGNRNMTYDKMSRSMRQYYKSNLLKKTNHDKLNYCF 1212
            L++ ++++  E+ + +EV    QE    D      +      K H + + S D+G K             ++  E K   YLW+ LL +L  K+  P YI WT  E G+FK+ D  +VS +WG+ K   +M Y+ M R++R YY+  +L K    +L Y F
Sbjct:   78 LTETVVEVSTEDMEPMEVVTVIQEPEMLDTEPSKRRKSGRKPKPHHISNGSPDMGIK-------------KKSREGKGSTYLWEFLLDLLQDKNTCPRYIKWTQREKGIFKLVDSKAVSKLWGKHKNKPDMNYETMGRALRYYYQRGILAKVEGQRLVYQF 225          
BLAST of SAM pointed domain-containing Ets transcription factor-like protein vs. Ensembl Xenopus
Match: spdef (SAM pointed domain containing ETS transcription factor [Source:NCBI gene;Acc:779866])

HSP 1 Score: 85.1149 bits (209), Expect = 1.912e-17
Identity = 55/208 (26.44%), Postives = 96/208 (46.15%), Query Frame = 1
Query:  628 IEETRNIFKLPYDYREWTNENIENWLYWIRHKLRFKFPKLSKEIIDIRKEEFQTIEVWQEKF---GTDAGGCMFKHFKMWLKYHQMKSKSDVGRKH--------GNEYNKSSVDKPRRRNEKKDGLYLWQILLTMLFSKHC-SPYIHWTDYESGMFKIKDPHSVSIIWGESKGNRNMTYDKMSRSMRQYYKSNLLKKTN-HDKLNYCF 1212
            IE    +  +  D  EW+  N++ W+ W  H+  ++ P++ +   ++  ++   +   ++ F       G  ++ H  +W     MK K+  G           G  +  + VD     +     ++LWQ L  +L   H     I W + E G+FKI+D   V+ +WG  K    M YDK+SRS+RQYYK  +++K +   +L Y F
Sbjct:  114 IETACKLLNISADPMEWSAGNVQKWILWTEHQ--YRLPQVGRSFQELTGKDLCALS--EDNFRERSPLCGDVLYAHLDIWKSAAWMKEKTGPGELRYCGGSGVVGECWADTEVDS----SGSGQPIHLWQFLKELLLKPHSYGRSIRWLNKEKGIFKIEDSAQVARLWGIRKNRPAMNYDKLSRSIRQYYKKGIIRKPDVSQRLVYQF 313          
BLAST of SAM pointed domain-containing Ets transcription factor-like protein vs. Ensembl Xenopus
Match: plekhm2 (pleckstrin homology and RUN domain containing M2 [Source:Xenbase;Acc:XB-GENE-5717447])

HSP 1 Score: 73.9442 bits (180), Expect = 2.878e-13
Identity = 36/91 (39.56%), Postives = 54/91 (59.34%), Query Frame = 1
Query:  943 RRRNEKKDGLYLWQILLTMLFSKHCSP-YIHWTDYESGMFKIKDPHSVSIIWGESKGNRNMTYDKMSRSMRQYYKSNLLKKTNHDKLNYCF 1212
            ++R  K +  YLW+ LL +L  K+  P YI WT  E G+FK+ D  +VS +WG+ K   +M Y+ M R++R YY+  +L K    +L Y F
Sbjct:  200 KQREGKGNTTYLWEFLLDLLQDKNTCPRYIKWTQREKGIFKLVDSKAVSRLWGKHKNKPDMNYETMGRALRYYYQRGILAKVEGQRLVYQF 290          
BLAST of SAM pointed domain-containing Ets transcription factor-like protein vs. Ensembl Xenopus
Match: plekhm2 (pleckstrin homology and RUN domain containing M2 [Source:Xenbase;Acc:XB-GENE-5717447])

HSP 1 Score: 73.559 bits (179), Expect = 3.407e-13
Identity = 36/91 (39.56%), Postives = 54/91 (59.34%), Query Frame = 1
Query:  943 RRRNEKKDGLYLWQILLTMLFSKHCSP-YIHWTDYESGMFKIKDPHSVSIIWGESKGNRNMTYDKMSRSMRQYYKSNLLKKTNHDKLNYCF 1212
            ++R  K +  YLW+ LL +L  K+  P YI WT  E G+FK+ D  +VS +WG+ K   +M Y+ M R++R YY+  +L K    +L Y F
Sbjct:  139 KQREGKGNTTYLWEFLLDLLQDKNTCPRYIKWTQREKGIFKLVDSKAVSRLWGKHKNKPDMNYETMGRALRYYYQRGILAKVEGQRLVYQF 229          
BLAST of SAM pointed domain-containing Ets transcription factor-like protein vs. Ensembl Xenopus
Match: oat (ornithine aminotransferase [Source:Xenbase;Acc:XB-GENE-5969095])

HSP 1 Score: 72.7886 bits (177), Expect = 7.769e-13
Identity = 41/113 (36.28%), Postives = 61/113 (53.98%), Query Frame = 1
Query:  895 GRKHGNEYNKSSVDKP------RRRNEKKDGLYLWQILLTMLFSKH-CSPYIHWTDYESGMFKIKDPHSVSIIWGESKGNRNMTYDKMSRSMRQYYKSNLLKKTNHDKLNYCF 1212
            GRK  N   +S    P      + ++ K + +YLW+ LL +L  K  C  YI WT  E G+FK+ D  +VS +WG+ K   +M Y+ M R++R YY+  +L K    +L Y F
Sbjct:  173 GRKPRNPRPESPTTTPNISVKKKNKDGKGNTIYLWEFLLALLQDKATCPKYIKWTQREKGIFKLVDSKAVSRLWGKHKNKPDMNYETMGRALRYYYQRGILAKVEGQRLVYQF 285          
BLAST of SAM pointed domain-containing Ets transcription factor-like protein vs. Ensembl Xenopus
Match: oat (ornithine aminotransferase [Source:Xenbase;Acc:XB-GENE-5969095])

HSP 1 Score: 72.7886 bits (177), Expect = 7.937e-13
Identity = 41/113 (36.28%), Postives = 61/113 (53.98%), Query Frame = 1
Query:  895 GRKHGNEYNKSSVDKP------RRRNEKKDGLYLWQILLTMLFSKH-CSPYIHWTDYESGMFKIKDPHSVSIIWGESKGNRNMTYDKMSRSMRQYYKSNLLKKTNHDKLNYCF 1212
            GRK  N   +S    P      + ++ K + +YLW+ LL +L  K  C  YI WT  E G+FK+ D  +VS +WG+ K   +M Y+ M R++R YY+  +L K    +L Y F
Sbjct:  173 GRKPRNPRPESPTTTPNISVKKKNKDGKGNTIYLWEFLLALLQDKATCPKYIKWTQREKGIFKLVDSKAVSRLWGKHKNKPDMNYETMGRALRYYYQRGILAKVEGQRLVYQF 285          
BLAST of SAM pointed domain-containing Ets transcription factor-like protein vs. Ensembl Mouse
Match: Spdef (SAM pointed domain containing ets transcription factor [Source:MGI Symbol;Acc:MGI:1353422])

HSP 1 Score: 92.8189 bits (229), Expect = 3.624e-20
Identity = 61/235 (25.96%), Postives = 103/235 (43.83%), Query Frame = 1
Query:  559 PEFCKNLQEKNRNCDLDQKDIDF------------IEETRNIFKLPYDYREWTNENIENWLYWIRHKLRFKFPKLSKEIIDIRKEEFQTIEVWQEKFGTDAGG-CMFKHFKMWLKYHQMKSKSDVGRKH--GNEYNKSSVDKPRRRNEKKDGLYLWQILLTMLFSKHC-SPYIHWTDYESGMFKIKDPHSVSIIWGESKGNRNMTYDKMSRSMRQYYKSNLLKKTN-HDKLNYCF 1212
            PE C  +  +     LD+  ++             IE    +  +  D  +W+  N++ WL W  H+  ++ P   K   ++  +E   +   Q +     GG  +  H  +W     MK ++  G  H   +   +   D     +     ++LWQ L  +L   H    +I W + E G+FKI+D   V+ +WG  K    M YDK+SRS+RQYYK  +++K +   +L Y F
Sbjct:   89 PEQCPVIDSQASGSTLDEHSLEQVQSMVVGEVLKDIETACKLLNITADPGDWSPGNVQKWLLWTEHQ--YRLPPAGKAFQELGGKELCAMSEEQFRQRAPLGGDVLHAHLDIWKSAAWMKERTSPGTLHYCASTSEEGWTDGEVDSSCSGQPIHLWQFLKELLLKPHSYGRFIRWLNKEKGIFKIEDSAQVARLWGVRKNRPAMNYDKLSRSIRQYYKKGIIRKPDISQRLVYQF 321          
BLAST of SAM pointed domain-containing Ets transcription factor-like protein vs. Ensembl Mouse
Match: Spdef (SAM pointed domain containing ets transcription factor [Source:MGI Symbol;Acc:MGI:1353422])

HSP 1 Score: 92.8189 bits (229), Expect = 3.624e-20
Identity = 61/235 (25.96%), Postives = 103/235 (43.83%), Query Frame = 1
Query:  559 PEFCKNLQEKNRNCDLDQKDIDF------------IEETRNIFKLPYDYREWTNENIENWLYWIRHKLRFKFPKLSKEIIDIRKEEFQTIEVWQEKFGTDAGG-CMFKHFKMWLKYHQMKSKSDVGRKH--GNEYNKSSVDKPRRRNEKKDGLYLWQILLTMLFSKHC-SPYIHWTDYESGMFKIKDPHSVSIIWGESKGNRNMTYDKMSRSMRQYYKSNLLKKTN-HDKLNYCF 1212
            PE C  +  +     LD+  ++             IE    +  +  D  +W+  N++ WL W  H+  ++ P   K   ++  +E   +   Q +     GG  +  H  +W     MK ++  G  H   +   +   D     +     ++LWQ L  +L   H    +I W + E G+FKI+D   V+ +WG  K    M YDK+SRS+RQYYK  +++K +   +L Y F
Sbjct:   89 PEQCPVIDSQASGSTLDEHSLEQVQSMVVGEVLKDIETACKLLNITADPGDWSPGNVQKWLLWTEHQ--YRLPPAGKAFQELGGKELCAMSEEQFRQRAPLGGDVLHAHLDIWKSAAWMKERTSPGTLHYCASTSEEGWTDGEVDSSCSGQPIHLWQFLKELLLKPHSYGRFIRWLNKEKGIFKIEDSAQVARLWGVRKNRPAMNYDKLSRSIRQYYKKGIIRKPDISQRLVYQF 321          
BLAST of SAM pointed domain-containing Ets transcription factor-like protein vs. Ensembl Mouse
Match: Spdef (SAM pointed domain containing ets transcription factor [Source:MGI Symbol;Acc:MGI:1353422])

HSP 1 Score: 89.7373 bits (221), Expect = 3.054e-19
Identity = 63/235 (26.81%), Postives = 105/235 (44.68%), Query Frame = 1
Query:  553 DAPEFCKNLQEKNRNCDLDQKDIDF------------IEETRNIFKLPYDYREWTNENIENWLYWIRHKLRFKFPKLSKEIIDIRKEEFQTIEVWQEKFGTDAGG-CMFKHFKMWLKYHQMKSKSDVGRKHGNEYNKSSVDKPRRRNEKKDGLYLWQILLTMLFSKHC-SPYIHWTDYESGMFKIKDPHSVSIIWGESKGNRNMTYDKMSRSMRQYYKSNLLKKTN-HDKLNYCF 1212
            + PE C  +  +     LD+  ++             IE    +  +  D  +W+  N++ WL W  H+  ++ P   K   ++  +E   +   Q +     GG  +  H  +W    +  S S+ G   G E + S   +P         ++LWQ L  +L   H    +I W + E G+FKI+D   V+ +WG  K    M YDK+SRS+RQYYK  +++K +   +L Y F
Sbjct:   87 EEPEQCPVIDSQASGSTLDEHSLEQVQSMVVGEVLKDIETACKLLNITADPGDWSPGNVQKWLLWTEHQ--YRLPPAGKAFQELGGKELCAMSEEQFRQRAPLGGDVLHAHLDIW----KSASTSEEGWTDG-EVDSSCSGQP---------IHLWQFLKELLLKPHSYGRFIRWLNKEKGIFKIEDSAQVARLWGVRKNRPAMNYDKLSRSIRQYYKKGIIRKPDISQRLVYQF 305          
BLAST of SAM pointed domain-containing Ets transcription factor-like protein vs. Ensembl Mouse
Match: Elf4 (E74-like factor 4 (ets domain transcription factor) [Source:MGI Symbol;Acc:MGI:1928377])

HSP 1 Score: 78.5666 bits (192), Expect = 4.087e-15
Identity = 43/112 (38.39%), Postives = 62/112 (55.36%), Query Frame = 1
Query:  898 RKHGNEYNKSSVDKPRR--RNEKKDG----LYLWQILLTMLFSKH-CSPYIHWTDYESGMFKIKDPHSVSIIWGESKGNRNMTYDKMSRSMRQYYKSNLLKKTNHDKLNYCF 1212
            RK  N  + S V  P    R + KDG    +YLW+ LL +L  ++ C  YI WT  E G+FK+ D  +VS +WG+ K   +M Y+ M R++R YY+  +L K    +L Y F
Sbjct:  178 RKTKNNRSTSPVTDPSMPIRKKSKDGKGSTIYLWEFLLALLQDRNTCPKYIKWTQREKGIFKLVDSKAVSKLWGKQKNKPDMNYETMGRALRYYYQRGILAKVEGQRLVYQF 289          
BLAST of SAM pointed domain-containing Ets transcription factor-like protein vs. Ensembl Mouse
Match: Elf4 (E74-like factor 4 (ets domain transcription factor) [Source:MGI Symbol;Acc:MGI:1928377])

HSP 1 Score: 77.7962 bits (190), Expect = 1.588e-14
Identity = 43/112 (38.39%), Postives = 62/112 (55.36%), Query Frame = 1
Query:  898 RKHGNEYNKSSVDKPRR--RNEKKDG----LYLWQILLTMLFSKH-CSPYIHWTDYESGMFKIKDPHSVSIIWGESKGNRNMTYDKMSRSMRQYYKSNLLKKTNHDKLNYCF 1212
            RK  N  + S V  P    R + KDG    +YLW+ LL +L  ++ C  YI WT  E G+FK+ D  +VS +WG+ K   +M Y+ M R++R YY+  +L K    +L Y F
Sbjct:  178 RKTKNNRSTSPVTDPSMPIRKKSKDGKGSTIYLWEFLLALLQDRNTCPKYIKWTQREKGIFKLVDSKAVSKLWGKQKNKPDMNYETMGRALRYYYQRGILAKVEGQRLVYQF 289          
BLAST of SAM pointed domain-containing Ets transcription factor-like protein vs. UniProt/SwissProt
Match: sp|O95238|SPDEF_HUMAN (SAM pointed domain-containing Ets transcription factor OS=Homo sapiens OX=9606 GN=SPDEF PE=1 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 7.404e-20
Identity = 61/205 (29.76%), Postives = 99/205 (48.29%), Query Frame = 1
Query:  613 KDIDFIEETRNIFKLPYDYREWTNENIENWLYWIRHKLRFKFPKLSKEIIDIRKEEFQTIEVWQEKFGTDAGG-CMFKHFKMWLKYHQMKSKSDVGRKH--GNEYNKSSVDKPRRRNEKKDGLYLWQILLTMLFSKHC-SPYIHWTDYESGMFKIKDPHSVSIIWGESKGNRNMTYDKMSRSMRQYYKSNLLKKTN-HDKLNYCF 1212
            KDI+   +  NI   P D   W+  N++ WL W  H+  ++ P + K   ++  +E   +   Q +  +  GG  +  H  +W     MK ++  G  H   +   +S  D     +     ++LWQ L  +L   H    +I W + E G+FKI+D   V+ +WG  K    M YDK+SRS+RQYYK  +++K +   +L Y F
Sbjct:  132 KDIETACKLLNITADPMD---WSPSNVQKWLLWTEHQ--YRLPPMGKAFQELAGKELCAMSEEQFRQRSPLGGDVLHAHLDIWKSAAWMKERTSPGAIHYCASTSEESWTDSEVDSSCSGQPIHLWQFLKELLLKPHSYGRFIRWLNKEKGIFKIEDSAQVARLWGIRKNRPAMNYDKLSRSIRQYYKKGIIRKPDISQRLVYQF 331          
BLAST of SAM pointed domain-containing Ets transcription factor-like protein vs. UniProt/SwissProt
Match: sp|Q9WTP3|SPDEF_MOUSE (SAM pointed domain-containing Ets transcription factor OS=Mus musculus OX=10090 GN=Spdef PE=2 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 2.535e-19
Identity = 61/235 (25.96%), Postives = 103/235 (43.83%), Query Frame = 1
Query:  559 PEFCKNLQEKNRNCDLDQKDIDF------------IEETRNIFKLPYDYREWTNENIENWLYWIRHKLRFKFPKLSKEIIDIRKEEFQTIEVWQEKFGTDAGG-CMFKHFKMWLKYHQMKSKSDVGRKH--GNEYNKSSVDKPRRRNEKKDGLYLWQILLTMLFSKHC-SPYIHWTDYESGMFKIKDPHSVSIIWGESKGNRNMTYDKMSRSMRQYYKSNLLKKTN-HDKLNYCF 1212
            PE C  +  +     LD+  ++             IE    +  +  D  +W+  N++ WL W  H+  ++ P   K   ++  +E   +   Q +     GG  +  H  +W     MK ++  G  H   +   +   D     +     ++LWQ L  +L   H    +I W + E G+FKI+D   V+ +WG  K    M YDK+SRS+RQYYK  +++K +   +L Y F
Sbjct:   89 PEQCPVIDSQASGSTLDEHSLEQVQSMVVGEVLKDIETACKLLNITADPGDWSPGNVQKWLLWTEHQ--YRLPPAGKAFQELGGKELCAMSEEQFRQRAPLGGDVLHAHLDIWKSAAWMKERTSPGTLHYCASTSEEGWTDGEVDSSCSGQPIHLWQFLKELLLKPHSYGRFIRWLNKEKGIFKIEDSAQVARLWGVRKNRPAMNYDKLSRSIRQYYKKGIIRKPDISQRLVYQF 321          
BLAST of SAM pointed domain-containing Ets transcription factor-like protein vs. UniProt/SwissProt
Match: sp|P29776|ETS6_DROME (DNA-binding protein D-ETS-6 OS=Drosophila melanogaster OX=7227 GN=Ets21C PE=2 SV=2)

HSP 1 Score: 91.6633 bits (226), Expect = 2.522e-18
Identity = 58/199 (29.15%), Postives = 95/199 (47.74%), Query Frame = 1
Query:  649 FKLPYDYREWTNENIENWLYWIRHKLRF-------KFPKLSKEIIDIRKEEFQTIEVWQEKFGTDAGGCMFKHFKMWLKYHQMKSKSD--VGRKHGNEYNKSSVDKPRRRNEKKDG-LYLWQILLTMLFSKHCSPYIHWTDYESGMFKIKDPHSVSIIWGESKGNRNMTYDKMSRSMRQYYKSNLLKKTNHDKLNYCFN 1215
             ++P D   WT E+I +W+ W   K +        +FPK ++E+ D+ + +F     W        G  + +HF + L YH    ++   +     N Y   +    R   +   G + LWQ LL +L     +  I W + +SG F++ DP  V+  WGE K   NM YDK+SR++R YY  N++ K +  +  Y F+
Sbjct:  144 VEVPVDPHAWTPEDIASWVRWATRKFKLDPEPDIDRFPKDAQELCDLSRADF-----WVCAGSRRGGMLLAQHFAISL-YHATGRETSPMLNDDEPNPYQLLNAASHRLVAQGSGGQIQLWQFLLELLADSSNANAISW-EGQSGEFRLIDPDEVARRWGERKAKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFD 335          
BLAST of SAM pointed domain-containing Ets transcription factor-like protein vs. UniProt/SwissProt
Match: sp|Q9Z2U4|ELF4_MOUSE (ETS-related transcription factor Elf-4 OS=Mus musculus OX=10090 GN=Elf4 PE=1 SV=2)

HSP 1 Score: 77.7962 bits (190), Expect = 1.111e-13
Identity = 43/112 (38.39%), Postives = 62/112 (55.36%), Query Frame = 1
Query:  898 RKHGNEYNKSSVDKPRR--RNEKKDG----LYLWQILLTMLFSKH-CSPYIHWTDYESGMFKIKDPHSVSIIWGESKGNRNMTYDKMSRSMRQYYKSNLLKKTNHDKLNYCF 1212
            RK  N  + S V  P    R + KDG    +YLW+ LL +L  ++ C  YI WT  E G+FK+ D  +VS +WG+ K   +M Y+ M R++R YY+  +L K    +L Y F
Sbjct:  178 RKTKNNRSTSPVTDPSMPIRKKSKDGKGSTIYLWEFLLALLQDRNTCPKYIKWTQREKGIFKLVDSKAVSKLWGKQKNKPDMNYETMGRALRYYYQRGILAKVEGQRLVYQF 289          
BLAST of SAM pointed domain-containing Ets transcription factor-like protein vs. UniProt/SwissProt
Match: sp|Q99607|ELF4_HUMAN (ETS-related transcription factor Elf-4 OS=Homo sapiens OX=9606 GN=ELF4 PE=1 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 4.802e-13
Identity = 44/119 (36.97%), Postives = 65/119 (54.62%), Query Frame = 1
Query:  877 KSKSDVGRKHGNEYNKSSVDK--PRRRNEKKDG----LYLWQILLTMLFSKH-CSPYIHWTDYESGMFKIKDPHSVSIIWGESKGNRNMTYDKMSRSMRQYYKSNLLKKTNHDKLNYCF 1212
            KSK  + +  GN       D   P R+ + KDG    +YLW+ LL +L  ++ C  YI WT  E G+FK+ D  +VS +WG+ K   +M Y+ M R++R YY+  +L K    +L Y F
Sbjct:  173 KSKKRIRKTKGNRSTSPVTDPSIPIRK-KSKDGKGSTIYLWEFLLALLQDRNTCPKYIKWTQREKGIFKLVDSKAVSKLWGKQKNKPDMNYETMGRALRYYYQRGILAKVEGQRLVYQF 290          
BLAST of SAM pointed domain-containing Ets transcription factor-like protein vs. TrEMBL
Match: A0A0B8RTF6 (SAM pointed domain-containing Ets transcription factor-like protein OS=Boiga irregularis OX=92519 PE=3 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 2.539e-18
Identity = 63/204 (30.88%), Postives = 100/204 (49.02%), Query Frame = 1
Query:  628 IEETRNIFKLPYDYREWTNENIENWLYWIRHKLRFKFPKLSKEIIDIRKEEFQTIEVWQEKF---GTDAGGCMFKHFKMWLKYHQMKSKSDVGRKH--GNEYN--KSSVDKPRRRNEKKDGLYLWQILLTMLFSKH-CSPYIHWTDYESGMFKIKDPHSVSIIWGESKGNRNMTYDKMSRSMRQYYKSNLLKKTN-HDKLNYCF 1212
            IE    +  +  D  +W+  N++ W+ W  H+  ++ P++ K   D+  +E    ++ +E F       G  +  H  +W     MK K+  G  H  GNE N   S VD     +     ++LWQ L  +L   H    +I W + E G+FKI+D   V+ +WG  K    M YDK+SRS+RQYYK  +++K +   +L Y F
Sbjct:  144 IETACKLLNIAADPADWSPGNVQKWILWTEHQ--YRLPQIGKSFQDLSGKEL--CDMTEEGFRQRSPSCGDVLHAHLDIWKSAAWMKEKTAPGELHYCGNEENWTDSEVDS----SCSGQPIHLWQFLKELLLKPHNYGRFIRWLNKEKGIFKIEDSAQVARLWGIRKNRPAMNYDKLSRSIRQYYKKGIIRKPDISQRLVYQF 339          
BLAST of SAM pointed domain-containing Ets transcription factor-like protein vs. TrEMBL
Match: G1KRL3 (SAM pointed domain containing ETS transcription factor OS=Anolis carolinensis OX=28377 GN=SPDEF PE=3 SV=2)

HSP 1 Score: 97.8265 bits (242), Expect = 3.210e-18
Identity = 62/204 (30.39%), Postives = 101/204 (49.51%), Query Frame = 1
Query:  628 IEETRNIFKLPYDYREWTNENIENWLYWIRHKLRFKFPKLSKEIIDIRKEEFQTIEVWQEKFGTDAGGC---MFKHFKMWLKYHQMKSKSDVGRKH--GNEYN--KSSVDKPRRRNEKKDGLYLWQILLTMLFSKH-CSPYIHWTDYESGMFKIKDPHSVSIIWGESKGNRNMTYDKMSRSMRQYYKSNLLKKTN-HDKLNYCF 1212
            IE    +  +  D  +W+  N++ W+ W  H+  ++ P++ K   D+  ++   +   +E+F   +  C   +  H  +W     MK K+  G  H  GNE N   S VD     +     ++LWQ L  +L   H    +I W + E G+FKI+D   V+ +WG  K    M YDK+SRS+RQYYK  +++K +   +L Y F
Sbjct:  177 IETACKLLNIAADPADWSPGNVQKWILWTEHQ--YRLPQIGKSFQDLSGKDLCAMS--EEQFRQRSPACGDVLHAHLDIWKSAAWMKEKAAPGEMHYCGNEENWTDSEVDS----SCSGQPIHLWQFLKELLLKPHNYGRFIRWLNKEKGIFKIEDSAQVARLWGIRKNRPAMNYDKLSRSIRQYYKKGIIRKPDISQRLVYQF 372          
BLAST of SAM pointed domain-containing Ets transcription factor-like protein vs. TrEMBL
Match: U3FYX5 (SAM pointed domain-containing Ets transcription factor OS=Micrurus fulvius OX=8637 PE=2 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 3.392e-18
Identity = 63/204 (30.88%), Postives = 100/204 (49.02%), Query Frame = 1
Query:  628 IEETRNIFKLPYDYREWTNENIENWLYWIRHKLRFKFPKLSKEIIDIRKEEFQTIEVWQEKF---GTDAGGCMFKHFKMWLKYHQMKSKSDVGRKH--GNEYN--KSSVDKPRRRNEKKDGLYLWQILLTMLFSKH-CSPYIHWTDYESGMFKIKDPHSVSIIWGESKGNRNMTYDKMSRSMRQYYKSNLLKKTN-HDKLNYCF 1212
            IE    +  +  D  +W+  N++ W+ W  H+  ++ P++ K   D+  +E    ++ +E F       G  +  H  +W     MK K+  G  H  GNE N   S VD     +     ++LWQ L  +L   H    +I W + E G+FKI+D   V+ +WG  K    M YDK+SRS+RQYYK  +++K +   +L Y F
Sbjct:  144 IETACKLLNIAADPADWSPGNVQKWILWTEHQ--YRLPQIGKSFHDLSGKEL--CDMTEEGFRQRSPSCGDVLHAHLDIWKSAAWMKEKTAPGELHYCGNEENWTDSEVDS----SCSGQPIHLWQFLKELLLKPHNYGRFIRWLNKEKGIFKIEDSAQVARLWGIRKNRPAMNYDKLSRSIRQYYKKGIIRKPDISQRLVYQF 339          
BLAST of SAM pointed domain-containing Ets transcription factor-like protein vs. TrEMBL
Match: Q29N54 (Uncharacterized protein, isoform A OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=Dpse\GA15514 PE=3 SV=2)

HSP 1 Score: 98.9821 bits (245), Expect = 3.620e-18
Identity = 68/245 (27.76%), Postives = 112/245 (45.71%), Query Frame = 1
Query:  514 VPVIEKKTCITIGDAPEFCKNLQEKNRNCDLDQKDIDFIEETRNIFKLPYDYREWTNENIENWLYWIRHKLRF-------KFPKLSKEIIDIRKEEFQTIEVWQEKFGTDAGGCMFKHFKMWLKYHQMKSKSDVGRKHGNEYNKSSV--DKPRRRNEKKDG--LYLWQILLTMLFSKHCSPYIHWTDYESGMFKIKDPHSVSIIWGESKGNRNMTYDKMSRSMRQYYKSNLLKKTNHDKLNYCFN 1215
            VP+ E +T      +P     ++ ++R   ++  D      +    ++P D   WT E+I +W+ W+  K +        +FPK  +E+ ++ + +F     W        G  M KHF + L  +Q   +      H NE N   +      R   +  G  + LWQ LL +L       YI W + +SG F++ DP  V+  WGE K   NM YDK+SR++R YY  N++ K +  +  Y F+
Sbjct:  125 VPLPEPQT------SPPLPLPIRSESREPSIESSD------SVTPVEVPVDPHAWTTEDIASWVKWLTRKFKIDPEPDIGRFPKDGQELCELSRADF-----WVCAGSRRGGTLMAKHFALSL--YQATGRETSPMLHENEPNPYQLLNAASHRLVAQGSGGQIQLWQFLLELLADSSNVAYISW-EGQSGEFRLIDPDEVAKRWGERKAKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFD 349          
BLAST of SAM pointed domain-containing Ets transcription factor-like protein vs. TrEMBL
Match: B4G887 (GL19256 OS=Drosophila persimilis OX=7234 GN=Dper\GL19256 PE=3 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 3.620e-18
Identity = 68/245 (27.76%), Postives = 112/245 (45.71%), Query Frame = 1
Query:  514 VPVIEKKTCITIGDAPEFCKNLQEKNRNCDLDQKDIDFIEETRNIFKLPYDYREWTNENIENWLYWIRHKLRF-------KFPKLSKEIIDIRKEEFQTIEVWQEKFGTDAGGCMFKHFKMWLKYHQMKSKSDVGRKHGNEYNKSSV--DKPRRRNEKKDG--LYLWQILLTMLFSKHCSPYIHWTDYESGMFKIKDPHSVSIIWGESKGNRNMTYDKMSRSMRQYYKSNLLKKTNHDKLNYCFN 1215
            VP+ E +T      +P     ++ ++R   ++  D      +    ++P D   WT E+I +W+ W+  K +        +FPK  +E+ ++ + +F     W        G  M KHF + L  +Q   +      H NE N   +      R   +  G  + LWQ LL +L       YI W + +SG F++ DP  V+  WGE K   NM YDK+SR++R YY  N++ K +  +  Y F+
Sbjct:  125 VPLPEPQT------SPPLPLPIRSESREPSIESSD------SVTPVEVPVDPHAWTTEDIASWVKWLTRKFKIDPEPDIGRFPKDGQELCELSRADF-----WVCAGSRRGGTLMAKHFALSL--YQATGRETSPMLHENEPNPYQLLNAASHRLVAQGSGGQIQLWQFLLELLADSSNVAYISW-EGQSGEFRLIDPDEVAKRWGERKAKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFD 349          
BLAST of SAM pointed domain-containing Ets transcription factor-like protein vs. Ensembl Cavefish
Match: SPDEF (SAM pointed domain containing ETS transcription factor [Source:NCBI gene;Acc:103037006])

HSP 1 Score: 89.3521 bits (220), Expect = 5.868e-19
Identity = 60/202 (29.70%), Postives = 93/202 (46.04%), Query Frame = 1
Query:  628 IEETRNIFKLPYDYREWTNENIENWLYWIRHKLRFKFPKLSKEIIDIRKEEFQTIEVWQEKF---GTDAGGCMFKHFKMWLKYHQMKSKSDVG--RKHGNEYNKSSVDKPRRRNEKKDGLYLWQILLTMLFSKHC-SPYIHWTDYESGMFKIKDPHSVSIIWGESKGNRNMTYDKMSRSMRQYYKSNLLKKTN-HDKLNYCF 1212
            IE    +  +  D  EW+  N++ WL W  H   ++ P++ K   D+  ++   +   +E F       G  +  H  +W     MK +  VG  R    E   S  D     +     ++LWQ L  +L   H     I W + E G+FKI+D   V+ +WG  K    M YDK+SRS+RQYYK  +++K +   +L Y F
Sbjct:  142 IETACKLLNITPDPVEWSCGNVQKWLLWTEH--LYRLPQVGKAFQDLDGKDLCAMT--EEDFRQRSPQCGDTLHAHLDIWKSAAWMKQRCSVGESRITAGEELWSEADS----SCSGQPIHLWQFLRELLLKPHSYGRCIRWLNKEKGIFKIEDSAHVARLWGLRKNRPAMNYDKLSRSIRQYYKKGIIRKPDVSQRLVYQF 335          
BLAST of SAM pointed domain-containing Ets transcription factor-like protein vs. Ensembl Cavefish
Match: SPDEF (SAM pointed domain containing ETS transcription factor [Source:NCBI gene;Acc:103037006])

HSP 1 Score: 89.3521 bits (220), Expect = 5.868e-19
Identity = 60/202 (29.70%), Postives = 93/202 (46.04%), Query Frame = 1
Query:  628 IEETRNIFKLPYDYREWTNENIENWLYWIRHKLRFKFPKLSKEIIDIRKEEFQTIEVWQEKF---GTDAGGCMFKHFKMWLKYHQMKSKSDVG--RKHGNEYNKSSVDKPRRRNEKKDGLYLWQILLTMLFSKHC-SPYIHWTDYESGMFKIKDPHSVSIIWGESKGNRNMTYDKMSRSMRQYYKSNLLKKTN-HDKLNYCF 1212
            IE    +  +  D  EW+  N++ WL W  H   ++ P++ K   D+  ++   +   +E F       G  +  H  +W     MK +  VG  R    E   S  D     +     ++LWQ L  +L   H     I W + E G+FKI+D   V+ +WG  K    M YDK+SRS+RQYYK  +++K +   +L Y F
Sbjct:  142 IETACKLLNITPDPVEWSCGNVQKWLLWTEH--LYRLPQVGKAFQDLDGKDLCAMT--EEDFRQRSPQCGDTLHAHLDIWKSAAWMKQRCSVGESRITAGEELWSEADS----SCSGQPIHLWQFLRELLLKPHSYGRCIRWLNKEKGIFKIEDSAHVARLWGLRKNRPAMNYDKLSRSIRQYYKKGIIRKPDVSQRLVYQF 335          
BLAST of SAM pointed domain-containing Ets transcription factor-like protein vs. Ensembl Cavefish
Match: SPDEF (SAM pointed domain containing ETS transcription factor [Source:NCBI gene;Acc:103037006])

HSP 1 Score: 89.3521 bits (220), Expect = 5.868e-19
Identity = 60/202 (29.70%), Postives = 93/202 (46.04%), Query Frame = 1
Query:  628 IEETRNIFKLPYDYREWTNENIENWLYWIRHKLRFKFPKLSKEIIDIRKEEFQTIEVWQEKF---GTDAGGCMFKHFKMWLKYHQMKSKSDVG--RKHGNEYNKSSVDKPRRRNEKKDGLYLWQILLTMLFSKHC-SPYIHWTDYESGMFKIKDPHSVSIIWGESKGNRNMTYDKMSRSMRQYYKSNLLKKTN-HDKLNYCF 1212
            IE    +  +  D  EW+  N++ WL W  H   ++ P++ K   D+  ++   +   +E F       G  +  H  +W     MK +  VG  R    E   S  D     +     ++LWQ L  +L   H     I W + E G+FKI+D   V+ +WG  K    M YDK+SRS+RQYYK  +++K +   +L Y F
Sbjct:  142 IETACKLLNITPDPVEWSCGNVQKWLLWTEH--LYRLPQVGKAFQDLDGKDLCAMT--EEDFRQRSPQCGDTLHAHLDIWKSAAWMKQRCSVGESRITAGEELWSEADS----SCSGQPIHLWQFLRELLLKPHSYGRCIRWLNKEKGIFKIEDSAHVARLWGLRKNRPAMNYDKLSRSIRQYYKKGIIRKPDVSQRLVYQF 335          
BLAST of SAM pointed domain-containing Ets transcription factor-like protein vs. Ensembl Cavefish
Match: ENSAMXT00000045637.1 (SAM pointed domain-containing Ets transcription factor-like [Source:NCBI gene;Acc:103035055])

HSP 1 Score: 84.3445 bits (207), Expect = 2.092e-17
Identity = 55/199 (27.64%), Postives = 87/199 (43.72%), Query Frame = 1
Query:  628 IEETRNIFKLPYDYREWTNENIENWLYWIRHKLRFKFPKLSKEIIDIRKEEFQTIEVWQEKF---GTDAGGCMFKHFKMWLKYHQMKSKSDVGRKHG--------NEYNKSSVDKPRRRNEKKDGLYLWQILLTMLFSKH-CSPYIHWTDYESGMFKIKDPHSVSIIWGESKGNRNMTYDKMSRSMRQYYKSNLLKKTN 1188
            IE    +  +  D  EWT+  ++ WL W  H   ++ P + +   D+   E   +   ++ F    +  G  +  H  +W     MK +      H          E + S   +P         ++LWQ L  +L   H     I W + E G+FKI+D   V+ +WG  K    M YDK+SRS+RQYYK  ++KK +
Sbjct:  126 IETACKLLNITPDPAEWTSGQVQKWLLWTEH--LYRLPPVGRAFQDLSGSELCMLS--EDDFRQRTSQCGDVLHAHLDIWKSAAWMKERCSSESNHTFLGADEVCTEADSSCTGQP---------IHLWQFLRELLLKPHNYGRSIRWLNKEKGIFKIEDSAHVAKLWGIRKNRPAMNYDKLSRSIRQYYKKGIIKKPD 311          
BLAST of SAM pointed domain-containing Ets transcription factor-like protein vs. Ensembl Cavefish
Match: ENSAMXT00000053181.1 (SAM pointed domain-containing Ets transcription factor-like [Source:NCBI gene;Acc:103035055])

HSP 1 Score: 84.3445 bits (207), Expect = 2.092e-17
Identity = 55/199 (27.64%), Postives = 87/199 (43.72%), Query Frame = 1
Query:  628 IEETRNIFKLPYDYREWTNENIENWLYWIRHKLRFKFPKLSKEIIDIRKEEFQTIEVWQEKF---GTDAGGCMFKHFKMWLKYHQMKSKSDVGRKHG--------NEYNKSSVDKPRRRNEKKDGLYLWQILLTMLFSKH-CSPYIHWTDYESGMFKIKDPHSVSIIWGESKGNRNMTYDKMSRSMRQYYKSNLLKKTN 1188
            IE    +  +  D  EWT+  ++ WL W  H   ++ P + +   D+   E   +   ++ F    +  G  +  H  +W     MK +      H          E + S   +P         ++LWQ L  +L   H     I W + E G+FKI+D   V+ +WG  K    M YDK+SRS+RQYYK  ++KK +
Sbjct:  126 IETACKLLNITPDPAEWTSGQVQKWLLWTEH--LYRLPPVGRAFQDLSGSELCMLS--EDDFRQRTSQCGDVLHAHLDIWKSAAWMKERCSSESNHTFLGADEVCTEADSSCTGQP---------IHLWQFLRELLLKPHNYGRSIRWLNKEKGIFKIEDSAHVAKLWGIRKNRPAMNYDKLSRSIRQYYKKGIIKKPD 311          
BLAST of SAM pointed domain-containing Ets transcription factor-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010868.1 (pep scaffold:Pmarinus_7.0:GL477036:347958:349079:-1 gene:ENSPMAG00000009848.1 transcript:ENSPMAT00000010868.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 72.0182 bits (175), Expect = 9.868e-16
Identity = 37/98 (37.76%), Postives = 57/98 (58.16%), Query Frame = 1
Query:  970 LYLWQILLTMLFSKHCSP-YIHWTDYESGMFKIKDPHSVSIIWGESKGNRNMTYDKMSRSMRQYYKSNLLKKTNHDKLNYCFNMDDNSVKKFIKRCSE 1260
            +YLW+ LL++L  K+  P  I WT+ E G+FK+ D  +VS +WG+ K   +M Y+ M R++R YY+  +L K    +L Y F   D      ++ CSE
Sbjct:    4 VYLWEFLLSLLQDKNTCPRLIKWTEKEKGIFKLVDSKAVSRLWGKHKNKPDMNYETMGRALRYYYQRGILAKVEGQRLVYQFK--DMPRNLLLEDCSE 99          
BLAST of SAM pointed domain-containing Ets transcription factor-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010870.1 (pep scaffold:Pmarinus_7.0:GL477036:348390:353437:-1 gene:ENSPMAG00000009848.1 transcript:ENSPMAT00000010870.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 75.0998 bits (183), Expect = 2.012e-15
Identity = 37/97 (38.14%), Postives = 58/97 (59.79%), Query Frame = 1
Query:  931 VDKPRRRNEKKDG--LYLWQILLTMLFSKHCSP-YIHWTDYESGMFKIKDPHSVSIIWGESKGNRNMTYDKMSRSMRQYYKSNLLKKTNHDKLNYCF 1212
             D P R+  ++D   +YLW+ LL++L  K+  P  I WT+ E G+FK+ D  +VS +WG+ K   +M Y+ M R++R YY+  +L K    +L Y F
Sbjct:  140 TDGPLRKKSREDSHTVYLWEFLLSLLQDKNTCPRLIKWTEKEKGIFKLVDSKAVSRLWGKHKNKPDMNYETMGRALRYYYQRGILAKVEGQRLVYQF 236          
BLAST of SAM pointed domain-containing Ets transcription factor-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010869.1 (pep scaffold:Pmarinus_7.0:GL477036:348366:352508:-1 gene:ENSPMAG00000009848.1 transcript:ENSPMAT00000010869.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 74.3294 bits (181), Expect = 2.973e-15
Identity = 40/112 (35.71%), Postives = 64/112 (57.14%), Query Frame = 1
Query:  931 VDKP-RRRNEKKDGLYLWQILLTMLFSKHCSP-YIHWTDYESGMFKIKDPHSVSIIWGESKGNRNMTYDKMSRSMRQYYKSNLLKKTNHDKLNYCFNMDDNSVKKFIKRCSE 1260
             D P R+++ +   +YLW+ LL++L  K+  P  I WT+ E G+FK+ D  +VS +WG+ K   +M Y+ M R++R YY+  +L K    +L Y F   D      ++ CSE
Sbjct:  123 TDGPLRKKSREGHTVYLWEFLLSLLQDKNTCPRLIKWTEKEKGIFKLVDSKAVSRLWGKHKNKPDMNYETMGRALRYYYQRGILAKVEGQRLVYQFK--DMPRNLLLEDCSE 232          
BLAST of SAM pointed domain-containing Ets transcription factor-like protein vs. Ensembl Sea Lamprey
Match: ehf (ets homologous factor [Source:ZFIN;Acc:ZDB-GENE-060312-7])

HSP 1 Score: 64.3142 bits (155), Expect = 4.294e-13
Identity = 29/89 (32.58%), Postives = 51/89 (57.30%), Query Frame = 1
Query:  967 GLYLWQILLTMLFSKHCSP-YIHWTDYESGMFKIKDPHSVSIIWGESKGNRNMTYDKMSRSMRQYYKSNLLKKTNHDKLNYCFNMDDNS 1230
            G +LW+ +  +L     +P  + W D   G+F+     +V+ +WG+ K N +MTY+K+SR+MR YYK  +L + +  +L Y F  + + 
Sbjct:    2 GNHLWEFIRDLLLQPEQNPGLLKWEDRRQGVFRFVKSDAVARLWGKKKNNSSMTYEKLSRAMRYYYKKEILDRVDGRRLVYKFGRNSSG 90          
BLAST of SAM pointed domain-containing Ets transcription factor-like protein vs. Ensembl Sea Lamprey
Match: fli1a (Fli-1 proto-oncogene, ETS transcription factor a [Source:ZFIN;Acc:ZDB-GENE-980526-426])

HSP 1 Score: 67.0106 bits (162), Expect = 5.543e-13
Identity = 47/145 (32.41%), Postives = 68/145 (46.90%), Query Frame = 1
Query:  871 QMKSKSDVGRKHGNEYNKSSVDKPRRRNEKKDGLYLWQILLTMLFSKHCSPYIHWTDYESGMFKIKDPHSVSIIWGESKGNRNMTYDKMSRSMRQYYKSNLLKKTNHDKLNYCFNMDDNSVKKFIKRCSEGLPYIKIPSNLHQLS 1305
            Q  +KS  GR   + Y        R  N     + LWQ LL +L     +  I W +  +G FK+ DP  V+  WGE K   NM YDK+SR++R YY  N++ K  H K  Y +  D + + + ++         K PS L  +S
Sbjct:    1 QSLNKSTEGRTQPDPYQILGPTSSRLANPGSGQIQLWQFLLELLSDSSNANCITW-EGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKV-HGK-RYAYKFDFHGIAQALQPHPTESSVYKYPSELSYVS 142          
BLAST of SAM pointed domain-containing Ets transcription factor-like protein vs. Ensembl Nematostella
Match: EDO45310 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSZ6])

HSP 1 Score: 74.3294 bits (181), Expect = 1.803e-16
Identity = 33/82 (40.24%), Postives = 51/82 (62.20%), Query Frame = 1
Query:  967 GLYLWQILLTMLFSKHCSPYIHWTDYESGMFKIKDPHSVSIIWGESKGNRNMTYDKMSRSMRQYYKSNLLKKTNHDKLNYCF 1212
             ++LW+ LL +L  + C+  I WT  E G FK+++   V+  WG+ K    M YDK+SR++R YY+ N++KK N  +L Y F
Sbjct:    2 AVHLWEFLLELLADESCASMISWTKKEEGEFKLRNQEEVARRWGDLKQRPGMNYDKLSRALRYYYQKNIIKKVNGQRLVYKF 83          
BLAST of SAM pointed domain-containing Ets transcription factor-like protein vs. Ensembl Nematostella
Match: EDO46190 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQM1])

HSP 1 Score: 72.0182 bits (175), Expect = 1.006e-15
Identity = 33/82 (40.24%), Postives = 54/82 (65.85%), Query Frame = 1
Query:  970 LYLWQILLTMLFSKHCSP-YIHWTDYESGMFKIKDPHSVSIIWGESKGNRNMTYDKMSRSMRQYYKSNLLKKTNHDKLNYCF 1212
            ++LW+ L  +L +K  SP +I W   + GMF++ D  +V+ +WG+ K   +MTY+KMSR++R YY+  ++K  +  KLNY F
Sbjct:    1 IHLWEFLEELLDNKAYSPKFITWVSRDDGMFRLVDSKAVARLWGQRKNRHDMTYEKMSRAIRYYYERKIIKHVDGQKLNYQF 82          
BLAST of SAM pointed domain-containing Ets transcription factor-like protein vs. Ensembl Nematostella
Match: EDO42771 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0P0])

HSP 1 Score: 70.0922 bits (170), Expect = 4.806e-15
Identity = 31/80 (38.75%), Postives = 51/80 (63.75%), Query Frame = 1
Query:  973 YLWQILLTMLFSKHCSPYIHWTDYESGMFKIKDPHSVSIIWGESKGNRNMTYDKMSRSMRQYYKSNLLKKTNHDKLNYCF 1212
            YLW+ L  ++  K    YI W + + G+F++ D + V+ +WG+ K  +NMTYDK+SR++R YY  ++L K +  +L Y F
Sbjct:    1 YLWEFLHYLVTDKKYEKYIAWQNPQKGIFRMVDHNGVAKLWGKHKKRKNMTYDKLSRALRYYYSKDILAKVSGQRLTYKF 80          
BLAST of SAM pointed domain-containing Ets transcription factor-like protein vs. Ensembl Nematostella
Match: EDO49143 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RH18])

HSP 1 Score: 69.707 bits (169), Expect = 8.150e-15
Identity = 32/85 (37.65%), Postives = 54/85 (63.53%), Query Frame = 1
Query:  970 LYLWQILLTMLFSKHCSP-YIHWTDYESGMFKIKDPHSVSIIWGESKGNRNMTYDKMSRSMRQYYKSNLLKKTNHDKLNYCFNMD 1221
            L+LW+ L  +L ++   P YI W   E G+F++ +  +V+ +WG+ K  RNM Y+KMSR++R YY+ ++L++    +L Y F  D
Sbjct:    2 LHLWEFLKELLENEETCPRYITWISREEGVFRLVNSGAVAKLWGQRKNRRNMNYEKMSRALRYYYERHILERVPGQRLIYKFAAD 86          
BLAST of SAM pointed domain-containing Ets transcription factor-like protein vs. Ensembl Nematostella
Match: EDO44339 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RW27])

HSP 1 Score: 65.4698 bits (158), Expect = 2.060e-13
Identity = 32/82 (39.02%), Postives = 48/82 (58.54%), Query Frame = 1
Query:  967 GLYLWQILLTMLFSKHCSPYIHWTDYESGMFKIKDPHSVSIIWGESKGNRNMTYDKMSRSMRQYYKSNLLKKTNHDKLNYCF 1212
             ++LW+ LL +L     S  I WT+ ESG FK+ +   V+  WG  K    M YDK+SR++R YY+  ++KK +  +L Y F
Sbjct:    2 AIHLWEFLLDLLADGRYSSIISWTNRESGEFKLLNQEEVARRWGHLKHRPGMNYDKLSRALRYYYQKGIIKKVHGQRLVYKF 83          
BLAST of SAM pointed domain-containing Ets transcription factor-like protein vs. Ensembl Medaka
Match: SPDEF (SAM pointed domain containing ETS transcription factor [Source:NCBI gene;Acc:101167865])

HSP 1 Score: 85.1149 bits (209), Expect = 1.379e-17
Identity = 72/279 (25.81%), Postives = 127/279 (45.52%), Query Frame = 1
Query:  445 ISRKTQCIPSLSHAQISINNKN---RVPVIEKKTCITIGDAPEFCKNLQEKNRNCDLDQ-------KDIDFIEETRNIFKLPYDYREWTNENIENWLYWIRHKLRF-----KFPKLS-KEIIDIRKEEFQTIEVWQEKFGTDAGGCMFKHFKMWLKYHQMKSKSDVG--RKHGNEYNKSSVDKPRRRNEKKDGLYLWQILLTMLFSKH----CSPYIHWTDYESGMFKIKDPHSVSIIWGESKGNRNMTYDKMSRSMRQYYKSNLLKKTN-HDKLNYCF 1212
            + + ++  P+L+     + ++    + PVI+ +     G +PE  + ++E++    L+Q       + +  IE    +  +  D  EW   N++ WL W  H  R       F +L+ K++  + +EEF+       +     G  +  H  +W     MK +  +G  +   +E   S  D     +     ++LWQ L  +L   H    C   I W + E G+FKI+D   V+ +WG  K    M YDK+SRS+RQYYK  +++K +   +L Y F
Sbjct:   71 LVKLSEASPALALPMTRMESREEPEQCPVIDSQE---QGLSPELERQVEERS----LEQVQSMVVGEVLKDIETACKLLNITPDPMEWNMGNVQKWLLWTEHLYRLPHAGKAFQELTGKDLCAMSEEEFR-------QRSPQCGDTLHAHLDIWKSAAWMKERCSLGDNKTTASEELWSEADS----SCSGQPIHLWQFLRELLLKPHNYGRC---IRWLNKEKGIFKIEDSAHVARLWGLRKNRPAMNYDKLSRSIRQYYKKGIIRKPDVSQRLVYQF 328          
BLAST of SAM pointed domain-containing Ets transcription factor-like protein vs. Ensembl Medaka
Match: elf2b (E74 like ETS transcription factor 2 [Source:NCBI gene;Acc:101160385])

HSP 1 Score: 75.8702 bits (185), Expect = 5.534e-14
Identity = 41/107 (38.32%), Postives = 59/107 (55.14%), Query Frame = 1
Query:  904 HGNEYNKSSVD---KPRRRNEKKDGLYLWQILLTMLFSKHCSP-YIHWTDYESGMFKIKDPHSVSIIWGESKGNRNMTYDKMSRSMRQYYKSNLLKKTNHDKLNYCF 1212
            H   ++  SVD   K + R  K    YLW+ LL +L  K+  P YI WT  E G+FK+ D  +VS +WG+ K   +M Y+ M R++R YY+  +L K    +L Y F
Sbjct:  209 HQTTFSNGSVDLSIKKKPREGKGSTTYLWEFLLELLQDKNTCPRYIKWTQREKGIFKLVDSKAVSRLWGKHKNKPDMNYETMGRALRYYYQRGILSKVEGQRLVYQF 315          
BLAST of SAM pointed domain-containing Ets transcription factor-like protein vs. Ensembl Medaka
Match: elf2b (E74 like ETS transcription factor 2 [Source:NCBI gene;Acc:101160385])

HSP 1 Score: 75.485 bits (184), Expect = 6.189e-14
Identity = 41/107 (38.32%), Postives = 59/107 (55.14%), Query Frame = 1
Query:  904 HGNEYNKSSVD---KPRRRNEKKDGLYLWQILLTMLFSKHCSP-YIHWTDYESGMFKIKDPHSVSIIWGESKGNRNMTYDKMSRSMRQYYKSNLLKKTNHDKLNYCF 1212
            H   ++  SVD   K + R  K    YLW+ LL +L  K+  P YI WT  E G+FK+ D  +VS +WG+ K   +M Y+ M R++R YY+  +L K    +L Y F
Sbjct:  125 HQTTFSNGSVDLSIKKKPREGKGSTTYLWEFLLELLQDKNTCPRYIKWTQREKGIFKLVDSKAVSRLWGKHKNKPDMNYETMGRALRYYYQRGILSKVEGQRLVYQF 231          
BLAST of SAM pointed domain-containing Ets transcription factor-like protein vs. Ensembl Medaka
Match: ENSORLT00000038111.1 (ETS-related transcription factor Elf-1-like [Source:NCBI gene;Acc:105358126])

HSP 1 Score: 72.7886 bits (177), Expect = 1.080e-13
Identity = 38/129 (29.46%), Postives = 67/129 (51.94%), Query Frame = 1
Query:  856 WLKYHQMKSKSDV-GRKHGNEYNKSSVDKP-------RRRNEKKDGLYLWQILLTMLFSKHCSP-YIHWTDYESGMFKIKDPHSVSIIWGESKGNRNMTYDKMSRSMRQYYKSNLLKKTNHDKLNYCFN 1215
            W   H  +  + +  RK G ++     + P       + +  K + LYLWQ L+ +L  +   P YI WT+ ++G+FK+ +  +V+ +WG+ K   +M Y+ M R++R YY+  +L K    +L Y F 
Sbjct:  119 WKSLHSKRPVAQLQSRKRGQKFKHRRAESPTPEITVKKDKYNKGNTLYLWQFLMELLQDRQVCPRYIKWTNPQAGIFKLVNSKAVARLWGKHKNKPDMNYETMGRALRYYYQRGILNKVEGQRLVYQFT 247          
BLAST of SAM pointed domain-containing Ets transcription factor-like protein vs. Ensembl Medaka
Match: elf1 (E74 like ETS transcription factor 4 [Source:NCBI gene;Acc:101161899])

HSP 1 Score: 74.3294 bits (181), Expect = 1.538e-13
Identity = 35/91 (38.46%), Postives = 54/91 (59.34%), Query Frame = 1
Query:  943 RRRNEKKDGLYLWQILLTMLFSKH-CSPYIHWTDYESGMFKIKDPHSVSIIWGESKGNRNMTYDKMSRSMRQYYKSNLLKKTNHDKLNYCF 1212
            + +  K + +YLW+ LL +L  K+ C  YI WT  E G+FK+ D  +VS +WG+ K   +M Y+ M R++R YY+  +L K    +L Y F
Sbjct:  194 KSKEGKGNTIYLWEFLLALLQDKNTCPKYIKWTQREKGIFKLVDSKAVSKLWGKHKNKPDMNYETMGRALRYYYQRGILAKVEGQRLVYQF 284          
BLAST of SAM pointed domain-containing Ets transcription factor-like protein vs. Planmine SMEST
Match: SMESG000080567.1 (SMESG000080567.1)

HSP 1 Score: 719.924 bits (1857), Expect = 0.000e+0
Identity = 348/353 (98.58%), Postives = 351/353 (99.43%), Query Frame = 1
Query:  253 MQNLNSSIYDNYHKSFSLQSSYFKDDREWCNNNYSDSHQNIETNDLPYSNRISQDQWTNNNRISISRKTQCIPSLSHAQISINNKNRVPVIEKKTCITIGDAPEFCKNLQEKNRNCDLDQKDIDFIEETRNIFKLPYDYREWTNENIENWLYWIRHKLRFKFPKLSKEIIDIRKEEFQTIEVWQEKFGTDAGGCMFKHFKMWLKYHQMKSKSDVGRKHGNEYNKSSVDKPRRRNEKKDGLYLWQILLTMLFSKHCSPYIHWTDYESGMFKIKDPHSVSIIWGESKGNRNMTYDKMSRSMRQYYKSNLLKKTNHDKLNYCFNMDDNSVKKFIKRCSEGLPYIKIPSNLHQLSNS 1311
            MQNLNSSIYDNYHKSFSLQSSYFKDDREWCNNNYSDSHQNIETNDLPYSNRISQDQWTNNNRISISRKTQCIPSLSHAQISINNKNRVPVIEKKTCITIGDAPEFCKNLQEKNRNCDLDQKDIDFIEETRNIFKLPYDYREWTNENIENWLYWIRHKLRFKFPKLSKEIIDIRKEEFQTIEVWQEKFGTDAGGCMFKHFKMWLKYHQMKSKSD+GRKHGNEY+KSSVDKPRRRNEKKDGLYLWQILLTMLF+KHCSPYIHWTDYESGMFKIKDPHSVSIIWGESKGNRNMTYDKMSRSMRQYYKSNLLKKTNHDKLNYCFNMDDNSVKKFIKRCSE LP IKIPSNLHQLSNS
Sbjct:    1 MQNLNSSIYDNYHKSFSLQSSYFKDDREWCNNNYSDSHQNIETNDLPYSNRISQDQWTNNNRISISRKTQCIPSLSHAQISINNKNRVPVIEKKTCITIGDAPEFCKNLQEKNRNCDLDQKDIDFIEETRNIFKLPYDYREWTNENIENWLYWIRHKLRFKFPKLSKEIIDIRKEEFQTIEVWQEKFGTDAGGCMFKHFKMWLKYHQMKSKSDIGRKHGNEYSKSSVDKPRRRNEKKDGLYLWQILLTMLFNKHCSPYIHWTDYESGMFKIKDPHSVSIIWGESKGNRNMTYDKMSRSMRQYYKSNLLKKTNHDKLNYCFNMDDNSVKKFIKRCSERLPDIKIPSNLHQLSNS 353          
BLAST of SAM pointed domain-containing Ets transcription factor-like protein vs. Planmine SMEST
Match: SMESG000031150.1 (SMESG000031150.1)

HSP 1 Score: 267.314 bits (682), Expect = 1.031e-86
Identity = 128/134 (95.52%), Postives = 131/134 (97.76%), Query Frame = 1
Query:  910 NEYNKSSVDKPRRRNEKKDGLYLWQILLTMLFSKHCSPYIHWTDYESGMFKIKDPHSVSIIWGESKGNRNMTYDKMSRSMRQYYKSNLLKKTNHDKLNYCFNMDDNSVKKFIKRCSEGLPYIKIPSNLHQLSNS 1311
            +EYNKSSVDKPRRRNEKKDGLYLWQILLTMLF+KHCSPYIHWTDYESGMFKIKDPHSVSIIWGESKGNR MTYDKMSRSMRQYYKSNLLKK+NHDKLNYCFNMDDNSVKKFIKRCSE LP IKIPSNLHQLSNS
Sbjct:   39 DEYNKSSVDKPRRRNEKKDGLYLWQILLTMLFNKHCSPYIHWTDYESGMFKIKDPHSVSIIWGESKGNRKMTYDKMSRSMRQYYKSNLLKKSNHDKLNYCFNMDDNSVKKFIKRCSERLPNIKIPSNLHQLSNS 172          
BLAST of SAM pointed domain-containing Ets transcription factor-like protein vs. Planmine SMEST
Match: SMESG000030652.1 (SMESG000030652.1)

HSP 1 Score: 249.595 bits (636), Expect = 4.262e-78
Identity = 130/171 (76.02%), Postives = 137/171 (80.12%), Query Frame = 1
Query:  238 DFILIMQNLNSSIYDNYHKSFSLQSSYFKDDREWCNNNYSDSHQNIETNDLPYSNRISQDQWTNNNRISISRKTQCIPSLSHAQISINNKNRVPVIEKKTCITIGDAPEFCKNLQEKNRNCDLDQKDIDFIEETRNIFKLPYDYREWTNENIENWLYWIRHKLRFKFPKLS 750
            DFILIM++L+SSIYDNYHKSFSL                 DS QNIETNDLPYS RISQDQWTNNNR SISRKT CI SLSH QIS  NKN VPVIEKKTCITI ++PEFC NLQEKNRNCDLDQKDI+F EETRNIFK P DYREW  ENI+NWLYWIRHKLRFKF KLS
Sbjct:  148 DFILIMKSLDSSIYDNYHKSFSLH----------------DSDQNIETNDLPYSKRISQDQWTNNNRKSISRKTPCIHSLSHTQIS--NKNGVPVIEKKTCITIANSPEFCNNLQEKNRNCDLDQKDIEFTEETRNIFKFPNDYREWIKENIKNWLYWIRHKLRFKFRKLS 300          
BLAST of SAM pointed domain-containing Ets transcription factor-like protein vs. Planmine SMEST
Match: SMESG000038556.1 (SMESG000038556.1)

HSP 1 Score: 240.736 bits (613), Expect = 8.794e-77
Identity = 127/172 (73.84%), Postives = 135/172 (78.49%), Query Frame = 1
Query:  253 MQNLNSSIYDNYHKSFSLQSSYFKDDREWCNNNYSDSHQNIETNDLPYSNRISQDQWTNNNRISISRKTQCIPSLSHAQISINNKNRVPVIEKKTCITIGDAPEFCKNLQEKNRNCDLDQKDIDFIEETRNIFKLPYDYREWTNENIENWLYWIRHKLRFKFPKLSKEIIDI 768
            MQ+L+SSIY+NYHKSFSL                 DSHQNIETNDLPYSNRISQ QWTNNN ISIS  T CI  LSHAQISINNKN VPVIEKK    I ++PEFCKNLQEK R CDL+QKDI FIEETRNIFK PYDYREW  ENIENWL+WI HKL+FKFPKLSKEIIDI
Sbjct:    1 MQSLDSSIYNNYHKSFSLH----------------DSHQNIETNDLPYSNRISQYQWTNNNTISISLMTPCIDLLSHAQISINNKNGVPVIEKK----IANSPEFCKNLQEKYRKCDLEQKDIKFIEETRNIFKFPYDYREWIKENIENWLHWIHHKLQFKFPKLSKEIIDI 152          
BLAST of SAM pointed domain-containing Ets transcription factor-like protein vs. Planmine SMEST
Match: SMESG000063801.1 (SMESG000063801.1)

HSP 1 Score: 243.047 bits (619), Expect = 8.967e-76
Identity = 126/177 (71.19%), Postives = 136/177 (76.84%), Query Frame = 1
Query:  238 DFILIMQNLNSSIYDNYHKSFSLQSSYFKDDREWCNNNYSDSHQNIETNDLPYSNRISQDQWTNNNRISISRKTQCIPSLSHAQISINNKNRVPVIEKKTCITIGDAPEFCKNLQEKNRNCDLDQKDIDFIEETRNIFKLPYDYREWTNENIENWLYWIRHKLRFKFPKLSKEIIDI 768
            DFILI+Q+L++SIYDNYHKSFSL                 DSHQNI TND  YSNRISQDQWT NNR SIS KT CI  LS+ +ISINNKN VPVIEKKT ITI ++PEFCK LQE NRNC LDQKDI+FIEETRNIFK PYDY EW  ENIEN L+WIRHK RF FPKL KEIIDI
Sbjct:   15 DFILIIQSLDNSIYDNYHKSFSLH----------------DSHQNIATNDFTYSNRISQDQWTKNNRTSISWKTPCIHPLSYTKISINNKNGVPVIEKKTFITIANSPEFCKYLQENNRNCVLDQKDIEFIEETRNIFKFPYDYYEWIKENIENLLHWIRHKSRFNFPKLCKEIIDI 175          
The following BLAST results are available for this feature:
BLAST of SAM pointed domain-containing Ets transcription factor-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SPDEF1.542e-2029.76SAM pointed domain containing ETS transcription fa... [more]
SPDEF7.651e-1828.57SAM pointed domain containing ETS transcription fa... [more]
ELF14.294e-1528.32E74 like ETS transcription factor 1 [Source:HGNC S... [more]
ETV73.345e-1439.76ETS variant transcription factor 7 [Source:HGNC Sy... [more]
ELF27.632e-1439.33E74 like ETS transcription factor 2 [Source:HGNC S... [more]
back to top
BLAST of SAM pointed domain-containing Ets transcription factor-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
elf-11.406e-1235.58ETS-Like transcription Factor homolog [Source:Uni... [more]
elf-11.406e-1235.58ETS-Like transcription Factor homolog [Source:Uni... [more]
elf-11.613e-1235.14ETS-Like transcription Factor homolog [Source:Uni... [more]
elf-11.613e-1235.14ETS-Like transcription Factor homolog [Source:Uni... [more]
ets-82.225e-1235.85ETS class transcription factor [Source:UniProtKB/... [more]
back to top
BLAST of SAM pointed domain-containing Ets transcription factor-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ets21C2.516e-1929.15gene:FBgn0005660 transcript:FBtr0078079[more]
Ets21C2.516e-1929.15gene:FBgn0005660 transcript:FBtr0345429[more]
Ets21C2.516e-1929.15gene:FBgn0005660 transcript:FBtr0344014[more]
Eip74EF4.320e-1337.36gene:FBgn0000567 transcript:FBtr0075204[more]
Eip74EF4.320e-1337.36gene:FBgn0000567 transcript:FBtr0100411[more]
back to top
BLAST of SAM pointed domain-containing Ets transcription factor-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SPDEF4.456e-1826.22SAM pointed domain containing ETS transcription fa... [more]
elf2a1.088e-1432.89E74-like factor 2a (ets domain transcription facto... [more]
elf2b7.223e-1430.43E74-like factor 2b (ets domain transcription facto... [more]
elf2b9.470e-1430.43E74-like factor 2b (ets domain transcription facto... [more]
elf2b9.470e-1430.43E74-like factor 2b (ets domain transcription facto... [more]
back to top
BLAST of SAM pointed domain-containing Ets transcription factor-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
spdef1.912e-1726.44SAM pointed domain containing ETS transcription fa... [more]
plekhm22.878e-1339.56pleckstrin homology and RUN domain containing M2 [... [more]
plekhm23.407e-1339.56pleckstrin homology and RUN domain containing M2 [... [more]
oat7.769e-1336.28ornithine aminotransferase [Source:Xenbase;Acc:XB-... [more]
oat7.937e-1336.28ornithine aminotransferase [Source:Xenbase;Acc:XB-... [more]
back to top
BLAST of SAM pointed domain-containing Ets transcription factor-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Spdef3.624e-2025.96SAM pointed domain containing ets transcription fa... [more]
Spdef3.624e-2025.96SAM pointed domain containing ets transcription fa... [more]
Spdef3.054e-1926.81SAM pointed domain containing ets transcription fa... [more]
Elf44.087e-1538.39E74-like factor 4 (ets domain transcription factor... [more]
Elf41.588e-1438.39E74-like factor 4 (ets domain transcription factor... [more]
back to top
BLAST of SAM pointed domain-containing Ets transcription factor-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O95238|SPDEF_HUMAN7.404e-2029.76SAM pointed domain-containing Ets transcription fa... [more]
sp|Q9WTP3|SPDEF_MOUSE2.535e-1925.96SAM pointed domain-containing Ets transcription fa... [more]
sp|P29776|ETS6_DROME2.522e-1829.15DNA-binding protein D-ETS-6 OS=Drosophila melanoga... [more]
sp|Q9Z2U4|ELF4_MOUSE1.111e-1338.39ETS-related transcription factor Elf-4 OS=Mus musc... [more]
sp|Q99607|ELF4_HUMAN4.802e-1336.97ETS-related transcription factor Elf-4 OS=Homo sap... [more]
back to top
BLAST of SAM pointed domain-containing Ets transcription factor-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0B8RTF62.539e-1830.88SAM pointed domain-containing Ets transcription fa... [more]
G1KRL33.210e-1830.39SAM pointed domain containing ETS transcription fa... [more]
U3FYX53.392e-1830.88SAM pointed domain-containing Ets transcription fa... [more]
Q29N543.620e-1827.76Uncharacterized protein, isoform A OS=Drosophila p... [more]
B4G8873.620e-1827.76GL19256 OS=Drosophila persimilis OX=7234 GN=Dper\G... [more]
back to top
BLAST of SAM pointed domain-containing Ets transcription factor-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SPDEF5.868e-1929.70SAM pointed domain containing ETS transcription fa... [more]
SPDEF5.868e-1929.70SAM pointed domain containing ETS transcription fa... [more]
SPDEF5.868e-1929.70SAM pointed domain containing ETS transcription fa... [more]
ENSAMXT00000045637.12.092e-1727.64SAM pointed domain-containing Ets transcription fa... [more]
ENSAMXT00000053181.12.092e-1727.64SAM pointed domain-containing Ets transcription fa... [more]
back to top
BLAST of SAM pointed domain-containing Ets transcription factor-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000010868.19.868e-1637.76pep scaffold:Pmarinus_7.0:GL477036:347958:349079:-... [more]
ENSPMAT00000010870.12.012e-1538.14pep scaffold:Pmarinus_7.0:GL477036:348390:353437:-... [more]
ENSPMAT00000010869.12.973e-1535.71pep scaffold:Pmarinus_7.0:GL477036:348366:352508:-... [more]
ehf4.294e-1332.58ets homologous factor [Source:ZFIN;Acc:ZDB-GENE-06... [more]
fli1a5.543e-1332.41Fli-1 proto-oncogene, ETS transcription factor a [... [more]
back to top
BLAST of SAM pointed domain-containing Ets transcription factor-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SAM pointed domain-containing Ets transcription factor-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO453101.803e-1640.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO461901.006e-1540.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO427714.806e-1538.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO491438.150e-1537.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO443392.060e-1339.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SAM pointed domain-containing Ets transcription factor-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SPDEF1.379e-1725.81SAM pointed domain containing ETS transcription fa... [more]
elf2b5.534e-1438.32E74 like ETS transcription factor 2 [Source:NCBI g... [more]
elf2b6.189e-1438.32E74 like ETS transcription factor 2 [Source:NCBI g... [more]
ENSORLT00000038111.11.080e-1329.46ETS-related transcription factor Elf-1-like [Sourc... [more]
elf11.538e-1338.46E74 like ETS transcription factor 4 [Source:NCBI g... [more]
back to top
BLAST of SAM pointed domain-containing Ets transcription factor-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000080567.10.000e+098.58SMESG000080567.1[more]
SMESG000031150.11.031e-8695.52SMESG000031150.1[more]
SMESG000030652.14.262e-7876.02SMESG000030652.1[more]
SMESG000038556.18.794e-7773.84SMESG000038556.1[more]
SMESG000063801.18.967e-7671.19SMESG000063801.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024319 ID=SMED30024319|Name=SAM pointed domain-containing Ets transcription factor-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1779bp
AATTGGCCAATATTTATACGCTGATGAAATATAGGTCATATCTATCTGAC
CAATCAAATTTTGAATTAGTTATTGTTGTCATTCGTTGTTAATCGTACAA
GGACGTATATTATTAAATAATATTTTATCTTTTAATTTTTATAATAAAGA
CATTTTGTACGTTAAACTTTTAAATATAAATTTTTAAAATTGTCATTCTT
TGAAATTTTAATTATTCTAGAATTAGTTAATCTTTTGGATTTTATTTTAA
TTATGCAAAATTTGAACAGCAGTATTTATGACAATTATCACAAATCATTT
TCGTTACAGTCAAGTTATTTTAAAGATGACAGGGAATGGTGTAATAATAA
TTATAGTGACAGCCATCAAAATATTGAAACTAATGACCTTCCTTACAGTA
ACAGAATATCTCAAGATCAGTGGACCAATAATAACAGAATATCGATTTCA
CGAAAGACACAATGTATCCCTTCATTAAGCCACGCTCAAATATCAATTAA
TAACAAAAATAGGGTACCCGTTATAGAAAAGAAAACCTGTATCACAATTG
GGGACGCACCAGAATTTTGTAAAAATCTTCAAGAAAAGAATCGGAACTGT
GATTTGGATCAGAAAGACATTGATTTTATTGAGGAAACAAGAAATATATT
TAAATTGCCATATGATTATCGCGAATGGACCAATGAAAACATTGAGAACT
GGCTTTATTGGATTCGCCATAAATTACGATTCAAATTTCCAAAACTATCC
AAGGAAATAATCGACATTCGAAAAGAAGAATTTCAAACCATTGAGGTTTG
GCAAGAGAAATTCGGTACTGATGCCGGTGGATGCATGTTTAAGCATTTCA
AAATGTGGTTGAAATATCATCAAATGAAATCGAAATCAGACGTTGGTAGG
AAACATGGAAATGAATACAATAAATCATCTGTTGATAAACCTCGGCGAAG
AAATGAAAAGAAAGATGGTTTATATCTTTGGCAAATTCTCCTAACGATGT
TGTTCAGCAAACATTGTTCTCCATATATCCATTGGACTGATTACGAGAGC
GGGATGTTCAAAATTAAAGATCCCCATTCCGTGTCGATAATTTGGGGAGA
ATCGAAAGGTAATCGAAATATGACATATGACAAAATGAGCAGATCAATGA
GACAATATTACAAATCAAATTTACTGAAAAAAACTAATCATGATAAATTA
AATTATTGTTTTAATATGGACGATAATTCAGTTAAGAAATTTATCAAACG
CTGCTCGGAAGGATTACCATATATAAAAATCCCATCAAATTTACATCAGT
TATCAAATTCCTAAAACTTTATTCCAATCCCTTTCCCGAAATTATATACA
CCTTTTATTAACACCTCATTTCGTGCCTTTGAAATTTTATATTTTTATAA
TTATACAAAGCAGCTTTTTACCTTTTATTAATTGTCACTTTAAATATATT
TTTCTATATACTTATGTGAATATTAAAAGGTCGTAGTTTATTTAAAAACG
ATAATGAATTATTCGAAGCTGTGATTGATGTAATATTAGTAGTTTTGGTG
TCCAACGTGATGTATTTTGTGTCTTGATAAAATGTATTATAAAGAGGTGC
CTAAATTTGTATGTAATAAACACGGATGTTTATTAATACCGTTTTTTTGC
ATCCGATGACGAACGACAATATATGATAATTTTATTAATATTATTATTAT
TAAATGGACACACCTTATTCTTTCATGTAGATACATTTGTATAATCTGTT
TTGATGCTCAATATTCTACTTATTTGTAA
back to top

protein sequence of SMED30024319-orf-1

>SMED30024319-orf-1 ID=SMED30024319-orf-1|Name=SMED30024319-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=354bp
MQNLNSSIYDNYHKSFSLQSSYFKDDREWCNNNYSDSHQNIETNDLPYSN
RISQDQWTNNNRISISRKTQCIPSLSHAQISINNKNRVPVIEKKTCITIG
DAPEFCKNLQEKNRNCDLDQKDIDFIEETRNIFKLPYDYREWTNENIENW
LYWIRHKLRFKFPKLSKEIIDIRKEEFQTIEVWQEKFGTDAGGCMFKHFK
MWLKYHQMKSKSDVGRKHGNEYNKSSVDKPRRRNEKKDGLYLWQILLTML
FSKHCSPYIHWTDYESGMFKIKDPHSVSIIWGESKGNRNMTYDKMSRSMR
QYYKSNLLKKTNHDKLNYCFNMDDNSVKKFIKRCSEGLPYIKIPSNLHQL
SNS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0042025host cell nucleus
GO:0005634nucleus
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000418Ets_dom
IPR011991WHTH_DNA-bd_dom
IPR013761SAM/pointed_sf
Vocabulary: molecular function
TermDefinition
GO:0043565sequence-specific DNA binding
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0000981RNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0003677DNA binding
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO:0000122negative regulation of transcription from RNA polymerase II promoter
GO:0006351transcription, DNA-templated
GO:0007275multicellular organism development
GO:0010454negative regulation of cell fate commitment
GO:0010455positive regulation of cell fate commitment
GO:0030154cell differentiation
GO:0043065positive regulation of apoptotic process
GO:0045944positive regulation of transcription from RNA polymerase II promoter
GO:0060480lung goblet cell differentiation
GO:0060576intestinal epithelial cell development