Mitogen-activated protein kinase

Overview
NameMitogen-activated protein kinase
Smed IDSMED30024295
Length (bp)1315
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Mitogen-activated protein kinase (SMED30024295) t-SNE clustered cells

Violin plots show distribution of expression levels for Mitogen-activated protein kinase (SMED30024295) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Mitogen-activated protein kinase (SMED30024295) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Mitogen-activated protein kinase (SMED30024295) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024295

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30024295h1SMcG0008951 dd_Smed_v4_1319_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30024295h1SMcG0008951 dd_Smed_v4_1319_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30024295h1SMcG0008951 dd_Smed_v4_1319_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30024295h1SMcG0008951 dd_Smed_v4_1319_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30024295h1SMcG0008951 dd_Smed_v4_1319_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30024295h1SMcG0008951 dd_Smed_v6_1319_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30024295h1SMcG0008951 dd_Smed_v4_1319_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Mitogen-activated protein kinase vs. Ensembl Human
Match: MAPK3 (mitogen-activated protein kinase 3 [Source:HGNC Symbol;Acc:HGNC:6877])

HSP 1 Score: 495.738 bits (1275), Expect = 7.313e-175
Identity = 226/344 (65.70%), Postives = 280/344 (81.40%), Query Frame = 3
Query:   48 EIIRGVEFDVGPRYGNFKFIGEGAYGQVVSAIDTKDNSNVAIKRTSPFEHQTYCQRTYREIKILMHFNHENIIDIRNLLTAKEMIEMKDLYIVQALMETDLHKLCKSQKLSLEHICYFLYQILRGLKYIHSANVIHRDLKPSNLLVNSNCDLKICDFGLSRVNDPEHDHKGILTEYVATRWYRAPEIMLNSKGYTKAIDIWSVGCILAEMLNGKPIFPGKHYVEQLTLIITVLGYPCEEDKAWIVNEKARHFVEKFVTKMKTPWKQLYPNADEQCITMLEGLLTFNPGKRLTVEQALAMPYLNQYYEPTDEPVASTPFTFEHELDDLPIEKLREMIWERVKYFR 1079
            E+++G  FDVGPRY   ++IGEGAYG V SA D    + VAIK+ SPFEHQTYCQRT REI+IL+ F HEN+I IR++L A  +  M+D+YIVQ LMETDL+KL KSQ+LS +HICYFLYQILRGLKYIHSANV+HRDLKPSNLL+N+ CDLKICDFGL+R+ DPEHDH G LTEYVATRWYRAPEIMLNSKGYTK+IDIWSVGCILAEML+ +PIFPGKHY++QL  I+ +LG P +ED   I+N KAR++++   +K K  W +L+P +D + + +L+ +LTFNP KR+TVE+ALA PYL QYY+PTDEPVA  PFTF  ELDDLP E+L+E+I++    F+
Sbjct:   29 EMVKGQPFDVGPRYTQLQYIGEGAYGMVSSAYDHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRASTLEAMRDVYIVQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSDSKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFAMELDDLPKERLKELIFQETARFQ 372          
BLAST of Mitogen-activated protein kinase vs. Ensembl Human
Match: MAPK1 (mitogen-activated protein kinase 1 [Source:HGNC Symbol;Acc:HGNC:6871])

HSP 1 Score: 494.197 bits (1271), Expect = 1.333e-174
Identity = 230/344 (66.86%), Postives = 278/344 (80.81%), Query Frame = 3
Query:   48 EIIRGVEFDVGPRYGNFKFIGEGAYGQVVSAIDTKDNSNVAIKRTSPFEHQTYCQRTYREIKILMHFNHENIIDIRNLLTAKEMIEMKDLYIVQALMETDLHKLCKSQKLSLEHICYFLYQILRGLKYIHSANVIHRDLKPSNLLVNSNCDLKICDFGLSRVNDPEHDHKGILTEYVATRWYRAPEIMLNSKGYTKAIDIWSVGCILAEMLNGKPIFPGKHYVEQLTLIITVLGYPCEEDKAWIVNEKARHFVEKFVTKMKTPWKQLYPNADEQCITMLEGLLTFNPGKRLTVEQALAMPYLNQYYEPTDEPVASTPFTFEHELDDLPIEKLREMIWERVKYFR 1079
            E++RG  FDVGPRY N  +IGEGAYG V SA D  +   VAIK+ SPFEHQTYCQRT REIKIL+ F HENII I +++ A  + +MKD+YIVQ LMETDL+KL K+Q LS +HICYFLYQILRGLKYIHSANV+HRDLKPSNLL+N+ CDLKICDFGL+RV DP+HDH G LTEYVATRWYRAPEIMLNSKGYTK+IDIWSVGCILAEML+ +PIFPGKHY++QL  I+ +LG P +ED   I+N KAR+++     K K PW +L+PNAD + + +L+ +LTFNP KR+ VEQALA PYL QYY+P+DEP+A  PF F+ ELDDLP EKL+E+I+E    F+
Sbjct:   12 EMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQ 355          
BLAST of Mitogen-activated protein kinase vs. Ensembl Human
Match: MAPK1 (mitogen-activated protein kinase 1 [Source:HGNC Symbol;Acc:HGNC:6871])

HSP 1 Score: 494.197 bits (1271), Expect = 1.333e-174
Identity = 230/344 (66.86%), Postives = 278/344 (80.81%), Query Frame = 3
Query:   48 EIIRGVEFDVGPRYGNFKFIGEGAYGQVVSAIDTKDNSNVAIKRTSPFEHQTYCQRTYREIKILMHFNHENIIDIRNLLTAKEMIEMKDLYIVQALMETDLHKLCKSQKLSLEHICYFLYQILRGLKYIHSANVIHRDLKPSNLLVNSNCDLKICDFGLSRVNDPEHDHKGILTEYVATRWYRAPEIMLNSKGYTKAIDIWSVGCILAEMLNGKPIFPGKHYVEQLTLIITVLGYPCEEDKAWIVNEKARHFVEKFVTKMKTPWKQLYPNADEQCITMLEGLLTFNPGKRLTVEQALAMPYLNQYYEPTDEPVASTPFTFEHELDDLPIEKLREMIWERVKYFR 1079
            E++RG  FDVGPRY N  +IGEGAYG V SA D  +   VAIK+ SPFEHQTYCQRT REIKIL+ F HENII I +++ A  + +MKD+YIVQ LMETDL+KL K+Q LS +HICYFLYQILRGLKYIHSANV+HRDLKPSNLL+N+ CDLKICDFGL+RV DP+HDH G LTEYVATRWYRAPEIMLNSKGYTK+IDIWSVGCILAEML+ +PIFPGKHY++QL  I+ +LG P +ED   I+N KAR+++     K K PW +L+PNAD + + +L+ +LTFNP KR+ VEQALA PYL QYY+P+DEP+A  PF F+ ELDDLP EKL+E+I+E    F+
Sbjct:   12 EMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQ 355          
BLAST of Mitogen-activated protein kinase vs. Ensembl Human
Match: MAPK3 (mitogen-activated protein kinase 3 [Source:HGNC Symbol;Acc:HGNC:6877])

HSP 1 Score: 457.988 bits (1177), Expect = 1.994e-160
Identity = 210/317 (66.25%), Postives = 259/317 (81.70%), Query Frame = 3
Query:   48 EIIRGVEFDVGPRYGNFKFIGEGAYGQVVSAIDTKDNSNVAIKRTSPFEHQTYCQRTYREIKILMHFNHENIIDIRNLLTAKEMIEMKDLYIVQALMETDLHKLCKSQKLSLEHICYFLYQILRGLKYIHSANVIHRDLKPSNLLVNSNCDLKICDFGLSRVNDPEHDHKGILTEYVATRWYRAPEIMLNSKGYTKAIDIWSVGCILAEMLNGKPIFPGKHYVEQLTLIITVLGYPCEEDKAWIVNEKARHFVEKFVTKMKTPWKQLYPNADEQCITMLEGLLTFNPGKRLTVEQALAMPYLNQYYEPTDEPVASTP 998
            E+++G  FDVGPRY   ++IGEGAYG V SA D    + VAIK+ SPFEHQTYCQRT REI+IL+ F HEN+I IR++L A  +  M+D+YIVQ LMETDL+KL KSQ+LS +HICYFLYQILRGLKYIHSANV+HRDLKPSNLL+N+ CDLKICDFGL+R+ DPEHDH G LTEYVATRWYRAPEIMLNSKGYTK+IDIWSVGCILAEML+ +PIFPGKHY++QL  I+ +LG P +ED   I+N KAR++++   +K K  W +L+P +D + + +L+ +LTFNP KR+TVE+ALA PYL QYY+PTDE V  +P
Sbjct:   29 EMVKGQPFDVGPRYTQLQYIGEGAYGMVSSAYDHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRASTLEAMRDVYIVQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSDSKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDE-VGQSP 344          
BLAST of Mitogen-activated protein kinase vs. Ensembl Human
Match: MAPK3 (mitogen-activated protein kinase 3 [Source:HGNC Symbol;Acc:HGNC:6877])

HSP 1 Score: 436.032 bits (1120), Expect = 3.917e-152
Identity = 210/344 (61.05%), Postives = 252/344 (73.26%), Query Frame = 3
Query:   48 EIIRGVEFDVGPRYGNFKFIGEGAYGQVVSAIDTKDNSNVAIKRTSPFEHQTYCQRTYREIKILMHFNHENIIDIRNLLTAKEMIEMKDLYIVQALMETDLHKLCKSQKLSLEHICYFLYQILRGLKYIHSANVIHRDLKPSNLLVNSNCDLKICDFGLSRVNDPEHDHKGILTEYVATRWYRAPEIMLNSKGYTKAIDIWSVGCILAEMLNGKPIFPGKHYVEQLTLIITVLGYPCEEDKAWIVNEKARHFVEKFVTKMKTPWKQLYPNADEQCITMLEGLLTFNPGKRLTVEQALAMPYLNQYYEPTDEPVASTPFTFEHELDDLPIEKLREMIWERVKYFR 1079
            E+++G  FDVGPRY   ++IGEGAYG V SA D    + VAIK+ SPFEHQTYCQRT REI+IL+ F HEN+I IR++L A  +  M+D+YIVQ LMETDL+KL KSQ+LS +HICYFLYQILRGLKYIHSANV+HRDLKPSNLL+N+ CDLKICDFGL+R+ DPEHDH G LTEYVATRWYRAPEIMLNSKGYTK+IDIWSVGCILAEML+ +PIFPGKHY++QL  I+                                             + +L+ +LTFNP KR+TVE+ALA PYL QYY+PTDEPVA  PFTF  ELDDLP E+L+E+I++    F+
Sbjct:   29 EMVKGQPFDVGPRYTQLQYIGEGAYGMVSSAYDHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRASTLEAMRDVYIVQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHIL--------------------------------------------ALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFAMELDDLPKERLKELIFQETARFQ 328          
BLAST of Mitogen-activated protein kinase vs. Ensembl Celegans
Match: mpk-1 (Mitogen-activated protein kinase mpk-1 [Source:UniProtKB/Swiss-Prot;Acc:P39745])

HSP 1 Score: 463.766 bits (1192), Expect = 8.495e-163
Identity = 222/349 (63.61%), Postives = 274/349 (78.51%), Query Frame = 3
Query:   48 EIIRGVEFDVGPRYGNFKFIGEGAYGQVVSAIDTKDNSNVAIKRTSPFEHQTYCQRTYREIKILMHFNHENIIDIRNLLTAKEMIEMKDLYIVQALMETDLHKLCKSQKLSLEHICYFLYQILRGLKYIHSANVIHRDLKPSNLLVNSNCDLKICDFGLSRVNDPEHDHKGILTEYVATRWYRAPEIMLNSKGYTKAIDIWSVGCILAEMLNGKPIFPGKHYVEQLTLIITVLGYPCEEDKAWIVNEKARHFVEKFVTKMKTPWKQLYPNADEQCITMLEGLLTFNPGKRLTVEQALAMPYLNQYYEPTDEPVASTPFTFEHELDDLPIEKLREMIWERVK-YFRQIEG 1091
            E + G  F+V PRY N  +IGEGAYG V SA+DT     VAIK+ SPFEHQT+CQRT REIKIL  F HENII+I+ ++ ++ +  +KD+YIVQ LMETDL+KL K+QKLS +H+CYFLYQILRGLKYIHSANV+HRDLKPSNLL+N+ CDLKICDFGL+RV DP+ DH G LTEYVATRWYRAPEIMLNSKGYTK+ID+WSVGCILAEML+ +P+FPGKHY++QL LI+ V+G P   D   I+N+KAR ++     K K PW +LYP AD + + +L+ +LTFNP  R+ +EQALA PYL QYY+P DEPV   PFT E E DDLP EKL+E+IWE  + + R++E 
Sbjct:   15 EEVHGQLFEVAPRYVNLSYIGEGAYGMVASALDTITRDRVAIKKISPFEHQTFCQRTLREIKILNRFKHENIINIQEIIRSETVDSLKDIYIVQCLMETDLYKLLKTQKLSNDHVCYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVTDPQTDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDVWSVGCILAEMLSNRPLFPGKHYLDQLNLILAVVGSPSNADLQCIINDKARSYLISLPHKPKQPWARLYPGADPRALDLLDKMLTFNPHNRIDIEQALAHPYLEQYYDPGDEPVCEEPFTLEMEFDDLPKEKLKELIWEEAEAHHRRMEA 363          
BLAST of Mitogen-activated protein kinase vs. Ensembl Celegans
Match: mpk-1 (Mitogen-activated protein kinase mpk-1 [Source:UniProtKB/Swiss-Prot;Acc:P39745])

HSP 1 Score: 464.151 bits (1193), Expect = 6.227e-162
Identity = 222/349 (63.61%), Postives = 274/349 (78.51%), Query Frame = 3
Query:   48 EIIRGVEFDVGPRYGNFKFIGEGAYGQVVSAIDTKDNSNVAIKRTSPFEHQTYCQRTYREIKILMHFNHENIIDIRNLLTAKEMIEMKDLYIVQALMETDLHKLCKSQKLSLEHICYFLYQILRGLKYIHSANVIHRDLKPSNLLVNSNCDLKICDFGLSRVNDPEHDHKGILTEYVATRWYRAPEIMLNSKGYTKAIDIWSVGCILAEMLNGKPIFPGKHYVEQLTLIITVLGYPCEEDKAWIVNEKARHFVEKFVTKMKTPWKQLYPNADEQCITMLEGLLTFNPGKRLTVEQALAMPYLNQYYEPTDEPVASTPFTFEHELDDLPIEKLREMIWERVK-YFRQIEG 1091
            E + G  F+V PRY N  +IGEGAYG V SA+DT     VAIK+ SPFEHQT+CQRT REIKIL  F HENII+I+ ++ ++ +  +KD+YIVQ LMETDL+KL K+QKLS +H+CYFLYQILRGLKYIHSANV+HRDLKPSNLL+N+ CDLKICDFGL+RV DP+ DH G LTEYVATRWYRAPEIMLNSKGYTK+ID+WSVGCILAEML+ +P+FPGKHY++QL LI+ V+G P   D   I+N+KAR ++     K K PW +LYP AD + + +L+ +LTFNP  R+ +EQALA PYL QYY+P DEPV   PFT E E DDLP EKL+E+IWE  + + R++E 
Sbjct:   83 EEVHGQLFEVAPRYVNLSYIGEGAYGMVASALDTITRDRVAIKKISPFEHQTFCQRTLREIKILNRFKHENIINIQEIIRSETVDSLKDIYIVQCLMETDLYKLLKTQKLSNDHVCYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVTDPQTDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDVWSVGCILAEMLSNRPLFPGKHYLDQLNLILAVVGSPSNADLQCIINDKARSYLISLPHKPKQPWARLYPGADPRALDLLDKMLTFNPHNRIDIEQALAHPYLEQYYDPGDEPVCEEPFTLEMEFDDLPKEKLKELIWEEAEAHHRRMEA 431          
BLAST of Mitogen-activated protein kinase vs. Ensembl Celegans
Match: pmk-1 (Mitogen-activated protein kinase pmk-1 [Source:UniProtKB/Swiss-Prot;Acc:Q17446])

HSP 1 Score: 293.893 bits (751), Expect = 4.301e-96
Identity = 152/338 (44.97%), Postives = 223/338 (65.98%), Query Frame = 3
Query:   87 YGNFKFIGEGAYGQVVSAIDTKDNSNVAIKR-TSPFEHQTYCQRTYREIKILMHFNHENIIDIRNLLTAKEMI-EMKDLYIVQALMETDLHKLCKSQKLSLEHICYFLYQILRGLKYIHSANVIHRDLKPSNLLVNSNCDLKICDFGLSRVNDPEHDHKGILTEYVATRWYRAPEIMLNSKGYTKAIDIWSVGCILAEMLNGKPIFPGKHYVEQLTLIITVLGYPCEEDKAWIVNEKARHFVEKFVTKMKTPWKQLYPNADEQCITMLEGLLTFNPGKRLTVEQALAMPYLNQYYEPTDEPVASTPFTFEHELDD----LPIEKLREMIWERVKYFRQ 1082
            Y N   IG GAYG V +A  T+  + VAIK+   PF+   + +RTYRE+++L    HENIID+ ++ T  E + +++D+Y V  LM  DL  + K Q+L+ +HI + +YQILRGLKYIHSA++IHRDLKPSN+ VN +C+LKI DFGL+R  D E      +T YVATRWYRAPEIMLN   YT+ +D+WSVGCILAE++ GK +FPG  +++QLT I++V G P EE    I +E+AR+++       +  +K+L+  A  Q I +LE +L  +P +R T ++A+   YL  Y++ TDEP+A      E +L+D      I++ +++IWE +  F++
Sbjct:   35 YINLTPIGTGAYGTVCAAECTRSGTRVAIKKFNRPFQSIIHARRTYRELRLLRCMCHENIIDLLDVFTPNENVNDIEDVYFVSMLMGADLSNILKIQRLNDDHIQFLVYQILRGLKYIHSADIIHRDLKPSNIAVNEDCELKILDFGLARQTDSE------MTGYVATRWYRAPEIMLNWMHYTQTVDVWSVGCILAELITGKTLFPGSDHIDQLTRIMSVTGTPDEEFLKKISSEEARNYIRNLPKMTRRDFKRLFAQATPQAIDLLEKMLHLDPDRRPTAKEAMEHEYLAAYHDETDEPIAE-----EMDLNDDVRADTIDEWKKIIWEEISDFQK 361          
BLAST of Mitogen-activated protein kinase vs. Ensembl Celegans
Match: pmk-2 (Mitogen-activated protein kinase pmk-2 [Source:UniProtKB/Swiss-Prot;Acc:Q8MXI4])

HSP 1 Score: 274.633 bits (701), Expect = 2.524e-88
Identity = 143/334 (42.81%), Postives = 214/334 (64.07%), Query Frame = 3
Query:   87 YGNFKFIGEGAYGQVVSAIDTKDNSNVAIKRT-SPFEHQTYCQRTYREIKILMHFNHENIIDIRNLLTAK-EMIEMKDLYIVQALMETDLHKLCKSQKLSLEHICYFLYQILRGLKYIHSANVIHRDLKPSNLLVNSNCDLKICDFGLSRVNDPEHDHKGILTEYVATRWYRAPEIMLNSKGYTKAIDIWSVGCILAEMLNGKPIFPGKHYVEQLTLIITVLGYPCEEDKAWIVNEKARHFVEKFVTKMKTPWKQLYPNADEQCITMLEGLLTFNPGKRLTVEQALAMPYLNQYYEPTDEPVASTPFTFE-HELDDLPIEKLREMIWERVKYFR 1079
            Y + K +GEGAYG V +A        VAIK+   PF+   + +RTYRE+K+L    H+N++++ ++ T   +   + ++Y V  LM +DL  + K Q+L+ E I   +YQ+LRGLKYIHSA +IHRDLKPSN+ VN  C++KI DFGL+R  D E      +T YVATRWYRAPEIMLN   YT+ +D+WSVGCILAE+++G+P+FPG  +++QLT I++V+G P EE  + I +E+AR++++     ++  +  L+P A    + +LE +L  +P +R++V  AL   YL +Y  P DEPVA    T +  E     +   RE+IW  ++ F+
Sbjct:   49 YNSLKPLGEGAYGVVCTAEYEPTGDRVAIKKFFRPFQSTIHAKRTYRELKLLRTLQHDNVLEMIDVFTPDPDASSLNNVYFVSVLMGSDLQNIMKIQRLTDEQIQLLIYQVLRGLKYIHSAGIIHRDLKPSNIAVNERCEVKILDFGLARAQDAE------MTGYVATRWYRAPEIMLNWMHYTQTVDVWSVGCILAELVSGRPLFPGDDHIDQLTKIMSVVGTPKEEFWSKIQSEEARNYIKNRSPIIRQDFVTLFPMASPYALELLEMMLILDPDRRISVSSALRHDYLREYSVPNDEPVAMDTVTIDPAEERATTLSDWRELIWNEIRLFQ 376          
BLAST of Mitogen-activated protein kinase vs. Ensembl Celegans
Match: pmk-2 (Mitogen-activated protein kinase pmk-2 [Source:UniProtKB/Swiss-Prot;Acc:Q8MXI4])

HSP 1 Score: 269.626 bits (688), Expect = 2.782e-86
Identity = 143/339 (42.18%), Postives = 216/339 (63.72%), Query Frame = 3
Query:   87 YGNFKFIGEGAYGQVVSAIDTKDNSNVAIKRT-SPFEHQTYCQRTYREIKILMHFNHENIIDIRNLLTAK-EMIEMKDLYIVQALMETDLHKLCKSQKLSLEHICYFLYQILRGLKYIHSANVIHRDLKPSNLLVNSNCDLKICDFGLSRVNDPEHDHKGILTEYVATRWYRAPEIMLNSKGYTKAIDIWSVGCILAEMLNGKPIFPGKHYVEQLTLIITVLGYPCEEDKAWIVNEKARHFVEKFVTKMKTPWKQLYPNADEQCITMLEGLLTFNPGKRLTVEQALAMPYLNQYYEPTDEPVA-----STPFTFE-HELDDLPIEKLREMIWERVKYFR 1079
            Y + K +GEGAYG V +A        VAIK+   PF+   + +RTYRE+K+L    H+N++++ ++ T   +   + ++Y V  LM +DL  + K Q+L+ E I   +YQ+LRGLKYIHSA +IHRDLKPSN+ VN  C++KI DFGL+R  D E      +T YVATRWYRAPEIMLN   YT+ +D+WSVGCILAE+++G+P+FPG  +++QLT I++V+G P EE  + I +E+AR++++     ++  +  L+P A    + +LE +L  +P +R++V  AL   YL +Y  P DEPVA     ++  T +  E     +   RE+IW  ++ F+
Sbjct:   49 YNSLKPLGEGAYGVVCTAEYEPTGDRVAIKKFFRPFQSTIHAKRTYRELKLLRTLQHDNVLEMIDVFTPDPDASSLNNVYFVSVLMGSDLQNIMKIQRLTDEQIQLLIYQVLRGLKYIHSAGIIHRDLKPSNIAVNERCEVKILDFGLARAQDAE------MTGYVATRWYRAPEIMLNWMHYTQTVDVWSVGCILAELVSGRPLFPGDDHIDQLTKIMSVVGTPKEEFWSKIQSEEARNYIKNRSPIIRQDFVTLFPMASPYALELLEMMLILDPDRRISVSSALRHDYLREYSVPNDEPVAMDTVINSIVTIDPAEERATTLSDWRELIWNEIRLFQ 381          
BLAST of Mitogen-activated protein kinase vs. Ensembl Fly
Match: rl (gene:FBgn0003256 transcript:FBtr0113703)

HSP 1 Score: 484.182 bits (1245), Expect = 1.026e-170
Identity = 227/349 (65.04%), Postives = 273/349 (78.22%), Query Frame = 3
Query:   36 KSSKEIIRGVEFDVGPRYGNFKFIGEGAYGQVVSAIDTKDNSNVAIKRTSPFEHQTYCQRTYREIKILMHFNHENIIDIRNLLTAKEMIEMKDLYIVQALMETDLHKLCKSQKLSLEHICYFLYQILRGLKYIHSANVIHRDLKPSNLLVNSNCDLKICDFGLSRVNDPEHDHKGILTEYVATRWYRAPEIMLNSKGYTKAIDIWSVGCILAEMLNGKPIFPGKHYVEQLTLIITVLGYPCEEDKAWIVNEKARHFVEKFVTKMKTPWKQLYPNADEQCITMLEGLLTFNPGKRLTVEQALAMPYLNQYYEPTDEPVASTPFTFEHELDDLPIEKLREMIWERVKYFRQ 1082
            +S+ E+IRG  F+VGPRY    +IGEGAYG VVSA DT  N  VAIK+ SPFEHQTYCQRT REI IL  F HENIIDIR++L    + +M+D+YIVQ LMETDL+KL K+Q+LS +HICYFLYQILRGLKYIHSANV+HRDLKPSNLL+N  CDLKICDFGL+R+ DPEHDH G LTEYVATRWYRAPEIMLNSKGYTK+IDIWSVGCILAEML+ +PIFPGKHY++QL  I+ VLG P  +D   I+NEKAR+++E    K   PW +L+PNAD   + +L  +LTFNP KR+ VE+ALA PYL QYY+P DEPVA  PF    E DD+  + L+ +I+E    F++
Sbjct:   21 QSNAEVIRGQIFEVGPRYIKLAYIGEGAYGMVVSADDTLTNQRVAIKKISPFEHQTYCQRTLREITILTRFKHENIIDIRDILRVDSIDQMRDVYIVQCLMETDLYKLLKTQRLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNKTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGVLGSPSRDDLECIINEKARNYLESLPFKPNVPWAKLFPNADALALDLLGKMLTFNPHKRIPVEEALAHPYLEQYYDPGDEPVAEVPFRINMENDDISRDALKSLIFEETLKFKE 369          
BLAST of Mitogen-activated protein kinase vs. Ensembl Fly
Match: rl (gene:FBgn0003256 transcript:FBtr0113702)

HSP 1 Score: 484.182 bits (1245), Expect = 1.026e-170
Identity = 227/349 (65.04%), Postives = 273/349 (78.22%), Query Frame = 3
Query:   36 KSSKEIIRGVEFDVGPRYGNFKFIGEGAYGQVVSAIDTKDNSNVAIKRTSPFEHQTYCQRTYREIKILMHFNHENIIDIRNLLTAKEMIEMKDLYIVQALMETDLHKLCKSQKLSLEHICYFLYQILRGLKYIHSANVIHRDLKPSNLLVNSNCDLKICDFGLSRVNDPEHDHKGILTEYVATRWYRAPEIMLNSKGYTKAIDIWSVGCILAEMLNGKPIFPGKHYVEQLTLIITVLGYPCEEDKAWIVNEKARHFVEKFVTKMKTPWKQLYPNADEQCITMLEGLLTFNPGKRLTVEQALAMPYLNQYYEPTDEPVASTPFTFEHELDDLPIEKLREMIWERVKYFRQ 1082
            +S+ E+IRG  F+VGPRY    +IGEGAYG VVSA DT  N  VAIK+ SPFEHQTYCQRT REI IL  F HENIIDIR++L    + +M+D+YIVQ LMETDL+KL K+Q+LS +HICYFLYQILRGLKYIHSANV+HRDLKPSNLL+N  CDLKICDFGL+R+ DPEHDH G LTEYVATRWYRAPEIMLNSKGYTK+IDIWSVGCILAEML+ +PIFPGKHY++QL  I+ VLG P  +D   I+NEKAR+++E    K   PW +L+PNAD   + +L  +LTFNP KR+ VE+ALA PYL QYY+P DEPVA  PF    E DD+  + L+ +I+E    F++
Sbjct:   21 QSNAEVIRGQIFEVGPRYIKLAYIGEGAYGMVVSADDTLTNQRVAIKKISPFEHQTYCQRTLREITILTRFKHENIIDIRDILRVDSIDQMRDVYIVQCLMETDLYKLLKTQRLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNKTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGVLGSPSRDDLECIINEKARNYLESLPFKPNVPWAKLFPNADALALDLLGKMLTFNPHKRIPVEEALAHPYLEQYYDPGDEPVAEVPFRINMENDDISRDALKSLIFEETLKFKE 369          
BLAST of Mitogen-activated protein kinase vs. Ensembl Fly
Match: rl (gene:FBgn0003256 transcript:FBtr0345337)

HSP 1 Score: 484.182 bits (1245), Expect = 1.026e-170
Identity = 227/349 (65.04%), Postives = 273/349 (78.22%), Query Frame = 3
Query:   36 KSSKEIIRGVEFDVGPRYGNFKFIGEGAYGQVVSAIDTKDNSNVAIKRTSPFEHQTYCQRTYREIKILMHFNHENIIDIRNLLTAKEMIEMKDLYIVQALMETDLHKLCKSQKLSLEHICYFLYQILRGLKYIHSANVIHRDLKPSNLLVNSNCDLKICDFGLSRVNDPEHDHKGILTEYVATRWYRAPEIMLNSKGYTKAIDIWSVGCILAEMLNGKPIFPGKHYVEQLTLIITVLGYPCEEDKAWIVNEKARHFVEKFVTKMKTPWKQLYPNADEQCITMLEGLLTFNPGKRLTVEQALAMPYLNQYYEPTDEPVASTPFTFEHELDDLPIEKLREMIWERVKYFRQ 1082
            +S+ E+IRG  F+VGPRY    +IGEGAYG VVSA DT  N  VAIK+ SPFEHQTYCQRT REI IL  F HENIIDIR++L    + +M+D+YIVQ LMETDL+KL K+Q+LS +HICYFLYQILRGLKYIHSANV+HRDLKPSNLL+N  CDLKICDFGL+R+ DPEHDH G LTEYVATRWYRAPEIMLNSKGYTK+IDIWSVGCILAEML+ +PIFPGKHY++QL  I+ VLG P  +D   I+NEKAR+++E    K   PW +L+PNAD   + +L  +LTFNP KR+ VE+ALA PYL QYY+P DEPVA  PF    E DD+  + L+ +I+E    F++
Sbjct:   21 QSNAEVIRGQIFEVGPRYIKLAYIGEGAYGMVVSADDTLTNQRVAIKKISPFEHQTYCQRTLREITILTRFKHENIIDIRDILRVDSIDQMRDVYIVQCLMETDLYKLLKTQRLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNKTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGVLGSPSRDDLECIINEKARNYLESLPFKPNVPWAKLFPNADALALDLLGKMLTFNPHKRIPVEEALAHPYLEQYYDPGDEPVAEVPFRINMENDDISRDALKSLIFEETLKFKE 369          
BLAST of Mitogen-activated protein kinase vs. Ensembl Fly
Match: rl (gene:FBgn0003256 transcript:FBtr0113700)

HSP 1 Score: 484.182 bits (1245), Expect = 1.026e-170
Identity = 227/349 (65.04%), Postives = 273/349 (78.22%), Query Frame = 3
Query:   36 KSSKEIIRGVEFDVGPRYGNFKFIGEGAYGQVVSAIDTKDNSNVAIKRTSPFEHQTYCQRTYREIKILMHFNHENIIDIRNLLTAKEMIEMKDLYIVQALMETDLHKLCKSQKLSLEHICYFLYQILRGLKYIHSANVIHRDLKPSNLLVNSNCDLKICDFGLSRVNDPEHDHKGILTEYVATRWYRAPEIMLNSKGYTKAIDIWSVGCILAEMLNGKPIFPGKHYVEQLTLIITVLGYPCEEDKAWIVNEKARHFVEKFVTKMKTPWKQLYPNADEQCITMLEGLLTFNPGKRLTVEQALAMPYLNQYYEPTDEPVASTPFTFEHELDDLPIEKLREMIWERVKYFRQ 1082
            +S+ E+IRG  F+VGPRY    +IGEGAYG VVSA DT  N  VAIK+ SPFEHQTYCQRT REI IL  F HENIIDIR++L    + +M+D+YIVQ LMETDL+KL K+Q+LS +HICYFLYQILRGLKYIHSANV+HRDLKPSNLL+N  CDLKICDFGL+R+ DPEHDH G LTEYVATRWYRAPEIMLNSKGYTK+IDIWSVGCILAEML+ +PIFPGKHY++QL  I+ VLG P  +D   I+NEKAR+++E    K   PW +L+PNAD   + +L  +LTFNP KR+ VE+ALA PYL QYY+P DEPVA  PF    E DD+  + L+ +I+E    F++
Sbjct:   21 QSNAEVIRGQIFEVGPRYIKLAYIGEGAYGMVVSADDTLTNQRVAIKKISPFEHQTYCQRTLREITILTRFKHENIIDIRDILRVDSIDQMRDVYIVQCLMETDLYKLLKTQRLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNKTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGVLGSPSRDDLECIINEKARNYLESLPFKPNVPWAKLFPNADALALDLLGKMLTFNPHKRIPVEEALAHPYLEQYYDPGDEPVAEVPFRINMENDDISRDALKSLIFEETLKFKE 369          
BLAST of Mitogen-activated protein kinase vs. Ensembl Fly
Match: rl (gene:FBgn0003256 transcript:FBtr0329919)

HSP 1 Score: 441.425 bits (1134), Expect = 1.292e-154
Identity = 207/318 (65.09%), Postives = 249/318 (78.30%), Query Frame = 3
Query:  129 VVSAIDTKDNSNVAIKRTSPFEHQTYCQRTYREIKILMHFNHENIIDIRNLLTAKEMIEMKDLYIVQALMETDLHKLCKSQKLSLEHICYFLYQILRGLKYIHSANVIHRDLKPSNLLVNSNCDLKICDFGLSRVNDPEHDHKGILTEYVATRWYRAPEIMLNSKGYTKAIDIWSVGCILAEMLNGKPIFPGKHYVEQLTLIITVLGYPCEEDKAWIVNEKARHFVEKFVTKMKTPWKQLYPNADEQCITMLEGLLTFNPGKRLTVEQALAMPYLNQYYEPTDEPVASTPFTFEHELDDLPIEKLREMIWERVKYFRQ 1082
            + SA DT  N  VAIK+ SPFEHQTYCQRT REI IL  F HENIIDIR++L    + +M+D+YIVQ LMETDL+KL K+Q+LS +HICYFLYQILRGLKYIHSANV+HRDLKPSNLL+N  CDLKICDFGL+R+ DPEHDH G LTEYVATRWYRAPEIMLNSKGYTK+IDIWSVGCILAEML+ +PIFPGKHY++QL  I+ VLG P  +D   I+NEKAR+++E    K   PW +L+PNAD   + +L  +LTFNP KR+ VE+ALA PYL QYY+P DEPVA  PF    E DD+  + L+ +I+E    F++
Sbjct:    7 IRSADDTLTNQRVAIKKISPFEHQTYCQRTLREITILTRFKHENIIDIRDILRVDSIDQMRDVYIVQCLMETDLYKLLKTQRLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNKTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGVLGSPSRDDLECIINEKARNYLESLPFKPNVPWAKLFPNADALALDLLGKMLTFNPHKRIPVEEALAHPYLEQYYDPGDEPVAEVPFRINMENDDISRDALKSLIFEETLKFKE 324          
BLAST of Mitogen-activated protein kinase vs. Ensembl Zebrafish
Match: mapk3 (mitogen-activated protein kinase 3 [Source:ZFIN;Acc:ZDB-GENE-040121-1])

HSP 1 Score: 496.508 bits (1277), Expect = 3.474e-175
Identity = 230/350 (65.71%), Postives = 282/350 (80.57%), Query Frame = 3
Query:   30 ANKSSKEIIRGVEFDVGPRYGNFKFIGEGAYGQVVSAIDTKDNSNVAIKRTSPFEHQTYCQRTYREIKILMHFNHENIIDIRNLLTAKEMIEMKDLYIVQALMETDLHKLCKSQKLSLEHICYFLYQILRGLKYIHSANVIHRDLKPSNLLVNSNCDLKICDFGLSRVNDPEHDHKGILTEYVATRWYRAPEIMLNSKGYTKAIDIWSVGCILAEMLNGKPIFPGKHYVEQLTLIITVLGYPCEEDKAWIVNEKARHFVEKFVTKMKTPWKQLYPNADEQCITMLEGLLTFNPGKRLTVEQALAMPYLNQYYEPTDEPVASTPFTFEHELDDLPIEKLREMIWERVKYFR 1079
             +K   E ++G  FDVGPRY + ++IGEGAYG V SA D  +   VAIK+ SPFEHQTYCQRT REIKIL+ F+HENII I ++L A+ +  M+D+YIVQ LMETDL+KL K+Q+LS +HICYFLYQILRGLKYIHSANV+HRDLKPSNLL+N+ CDLKICDFGL+R+ DPEHDH G LTEYVATRWYRAPEIMLNSKGYTK+IDIWSVGCILAEML+ +PIFPGKHY++QL  I+ VLG P ++D   I+N KAR++++    K K PW +L+P AD + + +L+ +LTFNP KR+ VEQALA PYL QYY+P+DEPVA  PFTF  ELDDLP EKL+E+I+E    F+
Sbjct:   37 GSKPGLESVKGQNFDVGPRYTDLQYIGEGAYGMVCSAFDNVNKIRVAIKKISPFEHQTYCQRTLREIKILLRFHHENIIGINDILRARHIDYMRDVYIVQDLMETDLYKLLKTQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGVLGSPSQDDLNCIINMKARNYLQSLPQKPKIPWNKLFPKADNKALDLLDRMLTFNPLKRINVEQALAHPYLEQYYDPSDEPVAEEPFTFNMELDDLPKEKLKELIFEETARFQ 386          
BLAST of Mitogen-activated protein kinase vs. Ensembl Zebrafish
Match: mapk1 (mitogen-activated protein kinase 1 [Source:ZFIN;Acc:ZDB-GENE-030722-2])

HSP 1 Score: 493.812 bits (1270), Expect = 1.348e-174
Identity = 229/347 (65.99%), Postives = 277/347 (79.83%), Query Frame = 3
Query:   39 SSKEIIRGVEFDVGPRYGNFKFIGEGAYGQVVSAIDTKDNSNVAIKRTSPFEHQTYCQRTYREIKILMHFNHENIIDIRNLLTAKEMIEMKDLYIVQALMETDLHKLCKSQKLSLEHICYFLYQILRGLKYIHSANVIHRDLKPSNLLVNSNCDLKICDFGLSRVNDPEHDHKGILTEYVATRWYRAPEIMLNSKGYTKAIDIWSVGCILAEMLNGKPIFPGKHYVEQLTLIITVLGYPCEEDKAWIVNEKARHFVEKFVTKMKTPWKQLYPNADEQCITMLEGLLTFNPGKRLTVEQALAMPYLNQYYEPTDEPVASTPFTFEHELDDLPIEKLREMIWERVKYFR 1079
            S  E++RG  FDVGPRY N  +IGEGAYG V SA D  +   VAIK+ SPFEHQTYCQRT REIKIL+ F HENII I +++    + +MKD+YIVQ LMETDL+KL K+Q LS +HICYFLYQILRGLKYIHSANV+HRDLKPSNLL+N+ CDLKICDFGL+RV DP+HDH G LTEYVATRWYRAPEIMLNSKGYTK+IDIWSVGCILAEML+ +PIFPGKHY++QL  I+ +LG P +ED   I+N KAR+++     + K PW +L+PNAD + + +L+ +LTFNP KR+ VE+ALA PYL QYY+PTDEPVA  PF F+ ELDDLP E L+E+I+E    F+
Sbjct:   18 SGAEMVRGQAFDVGPRYSNLSYIGEGAYGMVCSAYDRDNKVRVAIKKISPFEHQTYCQRTLREIKILLRFKHENIIGINDIIRTPTIDQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINIKARNYLLSLPLRSKVPWNRLFPNADPKALDLLDKMLTFNPHKRIEVEEALAHPYLEQYYDPTDEPVAEAPFKFDMELDDLPKETLKELIFEETARFQ 364          
BLAST of Mitogen-activated protein kinase vs. Ensembl Zebrafish
Match: mapk1 (mitogen-activated protein kinase 1 [Source:ZFIN;Acc:ZDB-GENE-030722-2])

HSP 1 Score: 493.812 bits (1270), Expect = 1.348e-174
Identity = 229/347 (65.99%), Postives = 277/347 (79.83%), Query Frame = 3
Query:   39 SSKEIIRGVEFDVGPRYGNFKFIGEGAYGQVVSAIDTKDNSNVAIKRTSPFEHQTYCQRTYREIKILMHFNHENIIDIRNLLTAKEMIEMKDLYIVQALMETDLHKLCKSQKLSLEHICYFLYQILRGLKYIHSANVIHRDLKPSNLLVNSNCDLKICDFGLSRVNDPEHDHKGILTEYVATRWYRAPEIMLNSKGYTKAIDIWSVGCILAEMLNGKPIFPGKHYVEQLTLIITVLGYPCEEDKAWIVNEKARHFVEKFVTKMKTPWKQLYPNADEQCITMLEGLLTFNPGKRLTVEQALAMPYLNQYYEPTDEPVASTPFTFEHELDDLPIEKLREMIWERVKYFR 1079
            S  E++RG  FDVGPRY N  +IGEGAYG V SA D  +   VAIK+ SPFEHQTYCQRT REIKIL+ F HENII I +++    + +MKD+YIVQ LMETDL+KL K+Q LS +HICYFLYQILRGLKYIHSANV+HRDLKPSNLL+N+ CDLKICDFGL+RV DP+HDH G LTEYVATRWYRAPEIMLNSKGYTK+IDIWSVGCILAEML+ +PIFPGKHY++QL  I+ +LG P +ED   I+N KAR+++     + K PW +L+PNAD + + +L+ +LTFNP KR+ VE+ALA PYL QYY+PTDEPVA  PF F+ ELDDLP E L+E+I+E    F+
Sbjct:   18 SGAEMVRGQAFDVGPRYSNLSYIGEGAYGMVCSAYDRDNKVRVAIKKISPFEHQTYCQRTLREIKILLRFKHENIIGINDIIRTPTIDQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINIKARNYLLSLPLRSKVPWNRLFPNADPKALDLLDKMLTFNPHKRIEVEEALAHPYLEQYYDPTDEPVAEAPFKFDMELDDLPKETLKELIFEETARFQ 364          
BLAST of Mitogen-activated protein kinase vs. Ensembl Zebrafish
Match: mapk1 (mitogen-activated protein kinase 1 [Source:ZFIN;Acc:ZDB-GENE-030722-2])

HSP 1 Score: 493.812 bits (1270), Expect = 1.348e-174
Identity = 229/347 (65.99%), Postives = 277/347 (79.83%), Query Frame = 3
Query:   39 SSKEIIRGVEFDVGPRYGNFKFIGEGAYGQVVSAIDTKDNSNVAIKRTSPFEHQTYCQRTYREIKILMHFNHENIIDIRNLLTAKEMIEMKDLYIVQALMETDLHKLCKSQKLSLEHICYFLYQILRGLKYIHSANVIHRDLKPSNLLVNSNCDLKICDFGLSRVNDPEHDHKGILTEYVATRWYRAPEIMLNSKGYTKAIDIWSVGCILAEMLNGKPIFPGKHYVEQLTLIITVLGYPCEEDKAWIVNEKARHFVEKFVTKMKTPWKQLYPNADEQCITMLEGLLTFNPGKRLTVEQALAMPYLNQYYEPTDEPVASTPFTFEHELDDLPIEKLREMIWERVKYFR 1079
            S  E++RG  FDVGPRY N  +IGEGAYG V SA D  +   VAIK+ SPFEHQTYCQRT REIKIL+ F HENII I +++    + +MKD+YIVQ LMETDL+KL K+Q LS +HICYFLYQILRGLKYIHSANV+HRDLKPSNLL+N+ CDLKICDFGL+RV DP+HDH G LTEYVATRWYRAPEIMLNSKGYTK+IDIWSVGCILAEML+ +PIFPGKHY++QL  I+ +LG P +ED   I+N KAR+++     + K PW +L+PNAD + + +L+ +LTFNP KR+ VE+ALA PYL QYY+PTDEPVA  PF F+ ELDDLP E L+E+I+E    F+
Sbjct:   18 SGAEMVRGQAFDVGPRYSNLSYIGEGAYGMVCSAYDRDNKVRVAIKKISPFEHQTYCQRTLREIKILLRFKHENIIGINDIIRTPTIDQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINIKARNYLLSLPLRSKVPWNRLFPNADPKALDLLDKMLTFNPHKRIEVEEALAHPYLEQYYDPTDEPVAEAPFKFDMELDDLPKETLKELIFEETARFQ 364          
BLAST of Mitogen-activated protein kinase vs. Ensembl Zebrafish
Match: mapk7 (mitogen-activated protein kinase 7 [Source:ZFIN;Acc:ZDB-GENE-050320-10])

HSP 1 Score: 319.316 bits (817), Expect = 2.413e-100
Identity = 165/343 (48.10%), Postives = 223/343 (65.01%), Query Frame = 3
Query:   63 VEFDVGPRYGNFKFIGEGAYGQVVSAIDTKDNSNVAIKR-TSPFEHQTYCQRTYREIKILMHFNHENIIDIRNLLT-AKEMIEMKDLYIVQALMETDLHKLCKS-QKLSLEHICYFLYQILRGLKYIHSANVIHRDLKPSNLLVNSNCDLKICDFGLSRVNDP--EHDHKGILTEYVATRWYRAPEIMLNSKGYTKAIDIWSVGCILAEMLNGKPIFPGKHYVEQLTLIITVLGYPCEEDKAWIVNEKARHFVEKFVTKMKTPWKQLYPNADEQCITMLEGLLTFNPGKRLTVEQALAMPYLNQYYEPTDEPVASTPFTFEHELDDLPIEKLREMIWERVKYF 1076
            V+F+VG  Y   + IG GAYG V SA    +   VAIK+  + FE  T  +RT RE+KIL HF H+NII I+++L         K +Y+V  LME+DLH++  S Q L+ EH  YFLYQ+LRGLKYIHSANVIHRDLKPSNLLVN NC+LKI DFG++R        + +  +TEYVATRWYRAPE+ML+   Y+ AID+WSVGCI  EML  + +FPGK+YV QL LI++VLG P E     I +++ R +V    +K   P   LYP A+   + +L  +L F+P +R++  QAL  PYL++Y++P DEPV    F FE +   +  E+++E I   ++ F
Sbjct:   72 VKFEVGDEYDIIETIGTGAYGVVSSARRRDNGQQVAIKKIPNAFEVVTNAKRTLRELKILKHFKHDNIIAIKDILQPVVPHSAFKSVYVVLDLMESDLHQIIHSRQPLTPEHTRYFLYQLLRGLKYIHSANVIHRDLKPSNLLVNENCELKIGDFGMARGLSAVYSEESRSFMTEYVATRWYRAPELMLSLHHYSLAIDLWSVGCIFGEMLGRRQMFPGKNYVHQLQLILSVLGTPPESIVGSIGSDRVRSYVRSLPSKAPEPLAALYPQAEPSALNLLAAMLRFDPRERISACQALEHPYLSKYHDPDDEPVCVPAFNFEFDRQPMGKEQIKEAILTEIQDF 414          
BLAST of Mitogen-activated protein kinase vs. Ensembl Xenopus
Match: cdknx (cyclin-dependent kinase inhibitor xic1 [Source:Xenbase;Acc:XB-GENE-1032978])

HSP 1 Score: 493.041 bits (1268), Expect = 3.464e-174
Identity = 230/346 (66.47%), Postives = 277/346 (80.06%), Query Frame = 3
Query:   48 EIIRGVEFDVGPRYGNFKFIGEGAYGQVVSAIDTKDNSNVAIKRTSPFEHQTYCQRTYREIKILMHFNHENIIDIRNLLTAKEMIEMKDLYIVQALMETDLHKLCKSQKLSLEHICYFLYQILRGLKYIHSANVIHRDLKPSNLLVNSNCDLKICDFGLSRVNDPEHDHKGILTEYVATRWYRAPEIMLNSKGYTKAIDIWSVGCILAEMLNGKPIFPGKHYVEQLTLIITVLGYPCEEDKAWIVNEKARHFVEKFVTKMKTPWKQLYPNADEQCITMLEGLLTFNPGKRLTVEQALAMPYLNQYYEPTDEPVASTPFTFEHELDDLPIEKLREMIWERVKYFRQI 1085
            E++RG  FDVGPRY N  +IGEGAYG V SA D  +   VAIK+ SPFEHQTYCQRT REIKIL+ F HENII I +++ A  + +MKD+YIVQ LMETDL+KL K+Q LS +HICYFLYQILRGLKYIHSANV+HRDLKPSNLL+N+ CDLKICDFGL+RV DP+HDH G LTEYVATRWYRAPEIMLNSKGYTK+IDIWSVGCILAEML+ +PIFPGKHY++QL  I+ +LG P +ED   I+N KAR+++     K K PW +L+PNAD + + +L+ +LTFNP KR+ VE ALA PYL QYY+P+DEPVA  PF FE ELDDLP E L+E+I+E    F+ +
Sbjct:   15 EMVRGQAFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFKHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADPKALDLLDKMLTFNPHKRIEVEAALAHPYLEQYYDPSDEPVAEAPFKFEMELDDLPKETLKELIFEETARFQTL 360          
BLAST of Mitogen-activated protein kinase vs. Ensembl Xenopus
Match: cdknx (cyclin-dependent kinase inhibitor xic1 [Source:Xenbase;Acc:XB-GENE-1032978])

HSP 1 Score: 493.041 bits (1268), Expect = 4.760e-174
Identity = 230/344 (66.86%), Postives = 276/344 (80.23%), Query Frame = 3
Query:   48 EIIRGVEFDVGPRYGNFKFIGEGAYGQVVSAIDTKDNSNVAIKRTSPFEHQTYCQRTYREIKILMHFNHENIIDIRNLLTAKEMIEMKDLYIVQALMETDLHKLCKSQKLSLEHICYFLYQILRGLKYIHSANVIHRDLKPSNLLVNSNCDLKICDFGLSRVNDPEHDHKGILTEYVATRWYRAPEIMLNSKGYTKAIDIWSVGCILAEMLNGKPIFPGKHYVEQLTLIITVLGYPCEEDKAWIVNEKARHFVEKFVTKMKTPWKQLYPNADEQCITMLEGLLTFNPGKRLTVEQALAMPYLNQYYEPTDEPVASTPFTFEHELDDLPIEKLREMIWERVKYFR 1079
            E++RG  FDVGPRY N  +IGEGAYG V SA D  +   VAIK+ SPFEHQTYCQRT REIKIL+ F HENII I +++ A  + +MKD+YIVQ LMETDL+KL K+Q LS +HICYFLYQILRGLKYIHSANV+HRDLKPSNLL+N+ CDLKICDFGL+RV DP+HDH G LTEYVATRWYRAPEIMLNSKGYTK+IDIWSVGCILAEML+ +PIFPGKHY++QL  I+ +LG P +ED   I+N KAR+++     K K PW +L+PNAD + + +L+ +LTFNP KR+ VE ALA PYL QYY+P+DEPVA  PF FE ELDDLP E L+E+I+E    F+
Sbjct:   23 EMVRGQAFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFKHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADPKALDLLDKMLTFNPHKRIEVEAALAHPYLEQYYDPSDEPVAEAPFKFEMELDDLPKETLKELIFEETARFQ 366          
BLAST of Mitogen-activated protein kinase vs. Ensembl Xenopus
Match: cdknx (cyclin-dependent kinase inhibitor xic1 [Source:Xenbase;Acc:XB-GENE-1032978])

HSP 1 Score: 492.656 bits (1267), Expect = 4.794e-174
Identity = 230/344 (66.86%), Postives = 276/344 (80.23%), Query Frame = 3
Query:   48 EIIRGVEFDVGPRYGNFKFIGEGAYGQVVSAIDTKDNSNVAIKRTSPFEHQTYCQRTYREIKILMHFNHENIIDIRNLLTAKEMIEMKDLYIVQALMETDLHKLCKSQKLSLEHICYFLYQILRGLKYIHSANVIHRDLKPSNLLVNSNCDLKICDFGLSRVNDPEHDHKGILTEYVATRWYRAPEIMLNSKGYTKAIDIWSVGCILAEMLNGKPIFPGKHYVEQLTLIITVLGYPCEEDKAWIVNEKARHFVEKFVTKMKTPWKQLYPNADEQCITMLEGLLTFNPGKRLTVEQALAMPYLNQYYEPTDEPVASTPFTFEHELDDLPIEKLREMIWERVKYFR 1079
            E++RG  FDVGPRY N  +IGEGAYG V SA D  +   VAIK+ SPFEHQTYCQRT REIKIL+ F HENII I +++ A  + +MKD+YIVQ LMETDL+KL K+Q LS +HICYFLYQILRGLKYIHSANV+HRDLKPSNLL+N+ CDLKICDFGL+RV DP+HDH G LTEYVATRWYRAPEIMLNSKGYTK+IDIWSVGCILAEML+ +PIFPGKHY++QL  I+ +LG P +ED   I+N KAR+++     K K PW +L+PNAD + + +L+ +LTFNP KR+ VE ALA PYL QYY+P+DEPVA  PF FE ELDDLP E L+E+I+E    F+
Sbjct:   15 EMVRGQAFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFKHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADPKALDLLDKMLTFNPHKRIEVEAALAHPYLEQYYDPSDEPVAEAPFKFEMELDDLPKETLKELIFEETARFQ 358          
BLAST of Mitogen-activated protein kinase vs. Ensembl Xenopus
Match: cdknx (cyclin-dependent kinase inhibitor xic1 [Source:Xenbase;Acc:XB-GENE-1032978])

HSP 1 Score: 492.271 bits (1266), Expect = 8.305e-174
Identity = 230/344 (66.86%), Postives = 276/344 (80.23%), Query Frame = 3
Query:   48 EIIRGVEFDVGPRYGNFKFIGEGAYGQVVSAIDTKDNSNVAIKRTSPFEHQTYCQRTYREIKILMHFNHENIIDIRNLLTAKEMIEMKDLYIVQALMETDLHKLCKSQKLSLEHICYFLYQILRGLKYIHSANVIHRDLKPSNLLVNSNCDLKICDFGLSRVNDPEHDHKGILTEYVATRWYRAPEIMLNSKGYTKAIDIWSVGCILAEMLNGKPIFPGKHYVEQLTLIITVLGYPCEEDKAWIVNEKARHFVEKFVTKMKTPWKQLYPNADEQCITMLEGLLTFNPGKRLTVEQALAMPYLNQYYEPTDEPVASTPFTFEHELDDLPIEKLREMIWERVKYFR 1079
            E++RG  FDVGPRY N  +IGEGAYG V SA D  +   VAIK+ SPFEHQTYCQRT REIKIL+ F HENII I +++ A  + +MKD+YIVQ LMETDL+KL K+Q LS +HICYFLYQILRGLKYIHSANV+HRDLKPSNLL+N+ CDLKICDFGL+RV DP+HDH G LTEYVATRWYRAPEIMLNSKGYTK+IDIWSVGCILAEML+ +PIFPGKHY++QL  I+ +LG P +ED   I+N KAR+++     K K PW +L+PNAD + + +L+ +LTFNP KR+ VE ALA PYL QYY+P+DEPVA  PF FE ELDDLP E L+E+I+E    F+
Sbjct:   19 EMVRGQAFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFKHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADPKALDLLDKMLTFNPHKRIEVEAALAHPYLEQYYDPSDEPVAEAPFKFEMELDDLPKETLKELIFEETARFQ 362          
BLAST of Mitogen-activated protein kinase vs. Ensembl Xenopus
Match: pde6a (phosphodiesterase 6A [Source:Xenbase;Acc:XB-GENE-988755])

HSP 1 Score: 306.22 bits (783), Expect = 7.652e-101
Identity = 155/338 (45.86%), Postives = 222/338 (65.68%), Query Frame = 3
Query:   69 FDVGPRYGNFKFIGEGAYGQVVSAIDTKDNSNVAIKRTS-PFEHQTYCQRTYREIKILMHFNHENIIDIRNLLT-AKEMIEMKDLYIVQALMETDLHKLCKSQKLSLEHICYFLYQILRGLKYIHSANVIHRDLKPSNLLVNSNCDLKICDFGLSRVNDPEHDHKGILTEYVATRWYRAPEIMLNSKGYTKAIDIWSVGCILAEMLNGKPIFPGKHYVEQLTLIITVLGYPCEEDKAWIVNEKARHFVEKFVTKMKTPWKQLYPNADEQCITMLEGLLTFNPGKRLTVEQALAMPYLNQYYEPTDEPVASTPFTFEHELDDLPIEKLREMIWERVKYF 1076
            ++V  RY N   +G GAYG V SA DT+    VA+K+ S PF+   + +RTYRE+++L H  HEN+I + ++ T AK   E  D+Y+V  LM  DL+ + K QKL+ +H+ + +YQILRGLKYIHSA +IHRDLKPSNL VN +C+LKI DFGL+R  D E      +T YVATRWYRAPEIMLN   Y + +DIWSVGCI+AE+L G+ +FPG  +++QL LI+ ++G P  E    I +E AR++++      K  ++ ++  A+ Q + +LE +L  +  KR+T  +ALA PY  QY++P DEP+A  P+    E  +L IE+ + + +E V  F
Sbjct:   19 WEVPDRYQNLTPVGSGAYGSVCSAFDTRTELRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPAKSFEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSAGIIHRDLKPSNLAVNEDCELKILDFGLARHTDEE------MTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPEPELLQKISSEAARNYIQSLPYMPKMNFEDVFLGANPQAVDLLEKMLVLDTDKRITAAEALAHPYFAQYHDPDDEPIAE-PYDQSFESRELDIEEWKRLTYEEVICF 349          
BLAST of Mitogen-activated protein kinase vs. Ensembl Mouse
Match: Mapk1 (mitogen-activated protein kinase 1 [Source:MGI Symbol;Acc:MGI:1346858])

HSP 1 Score: 494.582 bits (1272), Expect = 5.810e-175
Identity = 230/344 (66.86%), Postives = 278/344 (80.81%), Query Frame = 3
Query:   48 EIIRGVEFDVGPRYGNFKFIGEGAYGQVVSAIDTKDNSNVAIKRTSPFEHQTYCQRTYREIKILMHFNHENIIDIRNLLTAKEMIEMKDLYIVQALMETDLHKLCKSQKLSLEHICYFLYQILRGLKYIHSANVIHRDLKPSNLLVNSNCDLKICDFGLSRVNDPEHDHKGILTEYVATRWYRAPEIMLNSKGYTKAIDIWSVGCILAEMLNGKPIFPGKHYVEQLTLIITVLGYPCEEDKAWIVNEKARHFVEKFVTKMKTPWKQLYPNADEQCITMLEGLLTFNPGKRLTVEQALAMPYLNQYYEPTDEPVASTPFTFEHELDDLPIEKLREMIWERVKYFR 1079
            E++RG  FDVGPRY N  +IGEGAYG V SA D  +   VAIK+ SPFEHQTYCQRT REIKIL+ F HENII I +++ A  + +MKD+YIVQ LMETDL+KL K+Q LS +HICYFLYQILRGLKYIHSANV+HRDLKPSNLL+N+ CDLKICDFGL+RV DP+HDH G LTEYVATRWYRAPEIMLNSKGYTK+IDIWSVGCILAEML+ +PIFPGKHY++QL  I+ +LG P +ED   I+N KAR+++     K K PW +L+PNAD + + +L+ +LTFNP KR+ VEQALA PYL QYY+P+DEP+A  PF F+ ELDDLP EKL+E+I+E    F+
Sbjct:   10 EMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQ 353          
BLAST of Mitogen-activated protein kinase vs. Ensembl Mouse
Match: Mapk1 (mitogen-activated protein kinase 1 [Source:MGI Symbol;Acc:MGI:1346858])

HSP 1 Score: 494.582 bits (1272), Expect = 5.810e-175
Identity = 230/344 (66.86%), Postives = 278/344 (80.81%), Query Frame = 3
Query:   48 EIIRGVEFDVGPRYGNFKFIGEGAYGQVVSAIDTKDNSNVAIKRTSPFEHQTYCQRTYREIKILMHFNHENIIDIRNLLTAKEMIEMKDLYIVQALMETDLHKLCKSQKLSLEHICYFLYQILRGLKYIHSANVIHRDLKPSNLLVNSNCDLKICDFGLSRVNDPEHDHKGILTEYVATRWYRAPEIMLNSKGYTKAIDIWSVGCILAEMLNGKPIFPGKHYVEQLTLIITVLGYPCEEDKAWIVNEKARHFVEKFVTKMKTPWKQLYPNADEQCITMLEGLLTFNPGKRLTVEQALAMPYLNQYYEPTDEPVASTPFTFEHELDDLPIEKLREMIWERVKYFR 1079
            E++RG  FDVGPRY N  +IGEGAYG V SA D  +   VAIK+ SPFEHQTYCQRT REIKIL+ F HENII I +++ A  + +MKD+YIVQ LMETDL+KL K+Q LS +HICYFLYQILRGLKYIHSANV+HRDLKPSNLL+N+ CDLKICDFGL+RV DP+HDH G LTEYVATRWYRAPEIMLNSKGYTK+IDIWSVGCILAEML+ +PIFPGKHY++QL  I+ +LG P +ED   I+N KAR+++     K K PW +L+PNAD + + +L+ +LTFNP KR+ VEQALA PYL QYY+P+DEP+A  PF F+ ELDDLP EKL+E+I+E    F+
Sbjct:   10 EMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQ 353          
BLAST of Mitogen-activated protein kinase vs. Ensembl Mouse
Match: Mapk1 (mitogen-activated protein kinase 1 [Source:MGI Symbol;Acc:MGI:1346858])

HSP 1 Score: 494.582 bits (1272), Expect = 5.810e-175
Identity = 230/344 (66.86%), Postives = 278/344 (80.81%), Query Frame = 3
Query:   48 EIIRGVEFDVGPRYGNFKFIGEGAYGQVVSAIDTKDNSNVAIKRTSPFEHQTYCQRTYREIKILMHFNHENIIDIRNLLTAKEMIEMKDLYIVQALMETDLHKLCKSQKLSLEHICYFLYQILRGLKYIHSANVIHRDLKPSNLLVNSNCDLKICDFGLSRVNDPEHDHKGILTEYVATRWYRAPEIMLNSKGYTKAIDIWSVGCILAEMLNGKPIFPGKHYVEQLTLIITVLGYPCEEDKAWIVNEKARHFVEKFVTKMKTPWKQLYPNADEQCITMLEGLLTFNPGKRLTVEQALAMPYLNQYYEPTDEPVASTPFTFEHELDDLPIEKLREMIWERVKYFR 1079
            E++RG  FDVGPRY N  +IGEGAYG V SA D  +   VAIK+ SPFEHQTYCQRT REIKIL+ F HENII I +++ A  + +MKD+YIVQ LMETDL+KL K+Q LS +HICYFLYQILRGLKYIHSANV+HRDLKPSNLL+N+ CDLKICDFGL+RV DP+HDH G LTEYVATRWYRAPEIMLNSKGYTK+IDIWSVGCILAEML+ +PIFPGKHY++QL  I+ +LG P +ED   I+N KAR+++     K K PW +L+PNAD + + +L+ +LTFNP KR+ VEQALA PYL QYY+P+DEP+A  PF F+ ELDDLP EKL+E+I+E    F+
Sbjct:   10 EMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQ 353          
BLAST of Mitogen-activated protein kinase vs. Ensembl Mouse
Match: Mapk3 (mitogen-activated protein kinase 3 [Source:MGI Symbol;Acc:MGI:1346859])

HSP 1 Score: 492.656 bits (1267), Expect = 7.650e-174
Identity = 225/341 (65.98%), Postives = 278/341 (81.52%), Query Frame = 3
Query:   57 RGVEFDVGPRYGNFKFIGEGAYGQVVSAIDTKDNSNVAIKRTSPFEHQTYCQRTYREIKILMHFNHENIIDIRNLLTAKEMIEMKDLYIVQALMETDLHKLCKSQKLSLEHICYFLYQILRGLKYIHSANVIHRDLKPSNLLVNSNCDLKICDFGLSRVNDPEHDHKGILTEYVATRWYRAPEIMLNSKGYTKAIDIWSVGCILAEMLNGKPIFPGKHYVEQLTLIITVLGYPCEEDKAWIVNEKARHFVEKFVTKMKTPWKQLYPNADEQCITMLEGLLTFNPGKRLTVEQALAMPYLNQYYEPTDEPVASTPFTFEHELDDLPIEKLREMIWERVKYFR 1079
            +G  FDVGPRY   ++IGEGAYG V SA D    + VAIK+ SPFEHQTYCQRT REI+IL+ F HEN+I IR++L A  +  M+D+YIVQ LMETDL+KL KSQ+LS +HICYFLYQILRGLKYIHSANV+HRDLKPSNLL+N+ CDLKICDFGL+R+ DPEHDH G LTEYVATRWYRAPEIMLNSKGYTK+IDIWSVGCILAEML+ +PIFPGKHY++QL  I+ +LG P +ED   I+N KAR++++   +K K  W +L+P +D + + +L+ +LTFNP KR+TVE+ALA PYL QYY+PTDEPVA  PFTF+ ELDDLP E+L+E+I++    F+
Sbjct:   33 KGQPFDVGPRYTQLQYIGEGAYGMVSSAYDHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRAPTLEAMRDVYIVQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSDSKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFDMELDDLPKERLKELIFQETARFQ 373          
BLAST of Mitogen-activated protein kinase vs. Ensembl Mouse
Match: Mapk3 (mitogen-activated protein kinase 3 [Source:MGI Symbol;Acc:MGI:1346859])

HSP 1 Score: 454.521 bits (1168), Expect = 8.780e-159
Identity = 209/314 (66.56%), Postives = 257/314 (81.85%), Query Frame = 3
Query:   57 RGVEFDVGPRYGNFKFIGEGAYGQVVSAIDTKDNSNVAIKRTSPFEHQTYCQRTYREIKILMHFNHENIIDIRNLLTAKEMIEMKDLYIVQALMETDLHKLCKSQKLSLEHICYFLYQILRGLKYIHSANVIHRDLKPSNLLVNSNCDLKICDFGLSRVNDPEHDHKGILTEYVATRWYRAPEIMLNSKGYTKAIDIWSVGCILAEMLNGKPIFPGKHYVEQLTLIITVLGYPCEEDKAWIVNEKARHFVEKFVTKMKTPWKQLYPNADEQCITMLEGLLTFNPGKRLTVEQALAMPYLNQYYEPTDEPVASTP 998
            +G  FDVGPRY   ++IGEGAYG V SA D    + VAIK+ SPFEHQTYCQRT REI+IL+ F HEN+I IR++L A  +  M+D+YIVQ LMETDL+KL KSQ+LS +HICYFLYQILRGLKYIHSANV+HRDLKPSNLL+N+ CDLKICDFGL+R+ DPEHDH G LTEYVATRWYRAPEIMLNSKGYTK+IDIWSVGCILAEML+ +PIFPGKHY++QL  I+ +LG P +ED   I+N KAR++++   +K K  W +L+P +D + + +L+ +LTFNP KR+TVE+ALA PYL QYY+PTDE V+ +P
Sbjct:   33 KGQPFDVGPRYTQLQYIGEGAYGMVSSAYDHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRAPTLEAMRDVYIVQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSDSKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDE-VSRSP 345          
BLAST of Mitogen-activated protein kinase vs. UniProt/SwissProt
Match: sp|P27361|MK03_HUMAN (Mitogen-activated protein kinase 3 OS=Homo sapiens OX=9606 GN=MAPK3 PE=1 SV=4)

HSP 1 Score: 495.738 bits (1275), Expect = 3.512e-174
Identity = 226/344 (65.70%), Postives = 280/344 (81.40%), Query Frame = 3
Query:   48 EIIRGVEFDVGPRYGNFKFIGEGAYGQVVSAIDTKDNSNVAIKRTSPFEHQTYCQRTYREIKILMHFNHENIIDIRNLLTAKEMIEMKDLYIVQALMETDLHKLCKSQKLSLEHICYFLYQILRGLKYIHSANVIHRDLKPSNLLVNSNCDLKICDFGLSRVNDPEHDHKGILTEYVATRWYRAPEIMLNSKGYTKAIDIWSVGCILAEMLNGKPIFPGKHYVEQLTLIITVLGYPCEEDKAWIVNEKARHFVEKFVTKMKTPWKQLYPNADEQCITMLEGLLTFNPGKRLTVEQALAMPYLNQYYEPTDEPVASTPFTFEHELDDLPIEKLREMIWERVKYFR 1079
            E+++G  FDVGPRY   ++IGEGAYG V SA D    + VAIK+ SPFEHQTYCQRT REI+IL+ F HEN+I IR++L A  +  M+D+YIVQ LMETDL+KL KSQ+LS +HICYFLYQILRGLKYIHSANV+HRDLKPSNLL+N+ CDLKICDFGL+R+ DPEHDH G LTEYVATRWYRAPEIMLNSKGYTK+IDIWSVGCILAEML+ +PIFPGKHY++QL  I+ +LG P +ED   I+N KAR++++   +K K  W +L+P +D + + +L+ +LTFNP KR+TVE+ALA PYL QYY+PTDEPVA  PFTF  ELDDLP E+L+E+I++    F+
Sbjct:   29 EMVKGQPFDVGPRYTQLQYIGEGAYGMVSSAYDHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRASTLEAMRDVYIVQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSDSKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFAMELDDLPKERLKELIFQETARFQ 372          
BLAST of Mitogen-activated protein kinase vs. UniProt/SwissProt
Match: sp|P46196|MK01_BOVIN (Mitogen-activated protein kinase 1 OS=Bos taurus OX=9913 GN=MAPK1 PE=2 SV=3)

HSP 1 Score: 494.582 bits (1272), Expect = 3.872e-174
Identity = 231/344 (67.15%), Postives = 278/344 (80.81%), Query Frame = 3
Query:   48 EIIRGVEFDVGPRYGNFKFIGEGAYGQVVSAIDTKDNSNVAIKRTSPFEHQTYCQRTYREIKILMHFNHENIIDIRNLLTAKEMIEMKDLYIVQALMETDLHKLCKSQKLSLEHICYFLYQILRGLKYIHSANVIHRDLKPSNLLVNSNCDLKICDFGLSRVNDPEHDHKGILTEYVATRWYRAPEIMLNSKGYTKAIDIWSVGCILAEMLNGKPIFPGKHYVEQLTLIITVLGYPCEEDKAWIVNEKARHFVEKFVTKMKTPWKQLYPNADEQCITMLEGLLTFNPGKRLTVEQALAMPYLNQYYEPTDEPVASTPFTFEHELDDLPIEKLREMIWERVKYFR 1079
            E++RG  FDVGPRY N  +IGEGAYG V SA D  +   VAIK+ SPFEHQTYCQRT REIKIL+ F HENII I +++ A  + +MKD+YIVQ LMETDL+KL K+Q LS +HICYFLYQILRGLKYIHSANV+HRDLKPSNLL+N+ CDLKICDFGL+RV DP+HDH G LTEYVATRWYRAPEIMLNSKGYTK+IDIWSVGCILAEML+ +PIFPGKHY++QL  I+ +LG P +ED   I+N KAR+++     K K PW +L+PNAD + + +L+ +LTFNP KR+ VEQALA PYL QYY+P+DEPVA  PF F+ ELDDLP EKL+E+I+E    F+
Sbjct:   12 EMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPVAEAPFKFDMELDDLPKEKLKELIFEETARFQ 355          
BLAST of Mitogen-activated protein kinase vs. UniProt/SwissProt
Match: sp|P63086|MK01_RAT (Mitogen-activated protein kinase 1 OS=Rattus norvegicus OX=10116 GN=Mapk1 PE=1 SV=3)

HSP 1 Score: 494.582 bits (1272), Expect = 4.064e-174
Identity = 230/344 (66.86%), Postives = 278/344 (80.81%), Query Frame = 3
Query:   48 EIIRGVEFDVGPRYGNFKFIGEGAYGQVVSAIDTKDNSNVAIKRTSPFEHQTYCQRTYREIKILMHFNHENIIDIRNLLTAKEMIEMKDLYIVQALMETDLHKLCKSQKLSLEHICYFLYQILRGLKYIHSANVIHRDLKPSNLLVNSNCDLKICDFGLSRVNDPEHDHKGILTEYVATRWYRAPEIMLNSKGYTKAIDIWSVGCILAEMLNGKPIFPGKHYVEQLTLIITVLGYPCEEDKAWIVNEKARHFVEKFVTKMKTPWKQLYPNADEQCITMLEGLLTFNPGKRLTVEQALAMPYLNQYYEPTDEPVASTPFTFEHELDDLPIEKLREMIWERVKYFR 1079
            E++RG  FDVGPRY N  +IGEGAYG V SA D  +   VAIK+ SPFEHQTYCQRT REIKIL+ F HENII I +++ A  + +MKD+YIVQ LMETDL+KL K+Q LS +HICYFLYQILRGLKYIHSANV+HRDLKPSNLL+N+ CDLKICDFGL+RV DP+HDH G LTEYVATRWYRAPEIMLNSKGYTK+IDIWSVGCILAEML+ +PIFPGKHY++QL  I+ +LG P +ED   I+N KAR+++     K K PW +L+PNAD + + +L+ +LTFNP KR+ VEQALA PYL QYY+P+DEP+A  PF F+ ELDDLP EKL+E+I+E    F+
Sbjct:   10 EMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQ 353          
BLAST of Mitogen-activated protein kinase vs. UniProt/SwissProt
Match: sp|P63085|MK01_MOUSE (Mitogen-activated protein kinase 1 OS=Mus musculus OX=10090 GN=Mapk1 PE=1 SV=3)

HSP 1 Score: 494.582 bits (1272), Expect = 4.064e-174
Identity = 230/344 (66.86%), Postives = 278/344 (80.81%), Query Frame = 3
Query:   48 EIIRGVEFDVGPRYGNFKFIGEGAYGQVVSAIDTKDNSNVAIKRTSPFEHQTYCQRTYREIKILMHFNHENIIDIRNLLTAKEMIEMKDLYIVQALMETDLHKLCKSQKLSLEHICYFLYQILRGLKYIHSANVIHRDLKPSNLLVNSNCDLKICDFGLSRVNDPEHDHKGILTEYVATRWYRAPEIMLNSKGYTKAIDIWSVGCILAEMLNGKPIFPGKHYVEQLTLIITVLGYPCEEDKAWIVNEKARHFVEKFVTKMKTPWKQLYPNADEQCITMLEGLLTFNPGKRLTVEQALAMPYLNQYYEPTDEPVASTPFTFEHELDDLPIEKLREMIWERVKYFR 1079
            E++RG  FDVGPRY N  +IGEGAYG V SA D  +   VAIK+ SPFEHQTYCQRT REIKIL+ F HENII I +++ A  + +MKD+YIVQ LMETDL+KL K+Q LS +HICYFLYQILRGLKYIHSANV+HRDLKPSNLL+N+ CDLKICDFGL+RV DP+HDH G LTEYVATRWYRAPEIMLNSKGYTK+IDIWSVGCILAEML+ +PIFPGKHY++QL  I+ +LG P +ED   I+N KAR+++     K K PW +L+PNAD + + +L+ +LTFNP KR+ VEQALA PYL QYY+P+DEP+A  PF F+ ELDDLP EKL+E+I+E    F+
Sbjct:   10 EMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQ 353          
BLAST of Mitogen-activated protein kinase vs. UniProt/SwissProt
Match: sp|P28482|MK01_HUMAN (Mitogen-activated protein kinase 1 OS=Homo sapiens OX=9606 GN=MAPK1 PE=1 SV=3)

HSP 1 Score: 494.197 bits (1271), Expect = 6.401e-174
Identity = 230/344 (66.86%), Postives = 278/344 (80.81%), Query Frame = 3
Query:   48 EIIRGVEFDVGPRYGNFKFIGEGAYGQVVSAIDTKDNSNVAIKRTSPFEHQTYCQRTYREIKILMHFNHENIIDIRNLLTAKEMIEMKDLYIVQALMETDLHKLCKSQKLSLEHICYFLYQILRGLKYIHSANVIHRDLKPSNLLVNSNCDLKICDFGLSRVNDPEHDHKGILTEYVATRWYRAPEIMLNSKGYTKAIDIWSVGCILAEMLNGKPIFPGKHYVEQLTLIITVLGYPCEEDKAWIVNEKARHFVEKFVTKMKTPWKQLYPNADEQCITMLEGLLTFNPGKRLTVEQALAMPYLNQYYEPTDEPVASTPFTFEHELDDLPIEKLREMIWERVKYFR 1079
            E++RG  FDVGPRY N  +IGEGAYG V SA D  +   VAIK+ SPFEHQTYCQRT REIKIL+ F HENII I +++ A  + +MKD+YIVQ LMETDL+KL K+Q LS +HICYFLYQILRGLKYIHSANV+HRDLKPSNLL+N+ CDLKICDFGL+RV DP+HDH G LTEYVATRWYRAPEIMLNSKGYTK+IDIWSVGCILAEML+ +PIFPGKHY++QL  I+ +LG P +ED   I+N KAR+++     K K PW +L+PNAD + + +L+ +LTFNP KR+ VEQALA PYL QYY+P+DEP+A  PF F+ ELDDLP EKL+E+I+E    F+
Sbjct:   12 EMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQ 355          
BLAST of Mitogen-activated protein kinase vs. TrEMBL
Match: A0A075AJ20 (Mitogen-activated protein kinase OS=Opisthorchis viverrini OX=6198 GN=T265_01309 PE=3 SV=1)

HSP 1 Score: 532.332 bits (1370), Expect = 0.000e+0
Identity = 245/351 (69.80%), Postives = 291/351 (82.91%), Query Frame = 3
Query:   33 NKSSKEIIRGVEFDVGPRYGNFKFIGEGAYGQVVSAIDTKDNSNVAIKRTSPFEHQTYCQRTYREIKILMHFNHENIIDIRNLL-TAKEMIEMKDLYIVQALMETDLHKLCKSQKLSLEHICYFLYQILRGLKYIHSANVIHRDLKPSNLLVNSNCDLKICDFGLSRVNDPEHDHKGILTEYVATRWYRAPEIMLNSKGYTKAIDIWSVGCILAEMLNGKPIFPGKHYVEQLTLIITVLGYPCEEDKAWIVNEKARHFVEKFVTKMKTPWKQLYPNADEQCITMLEGLLTFNPGKRLTVEQALAMPYLNQYYEPTDEPVASTPFTFEHELDDLPIEKLREMIWERVKYFRQ 1082
            +K   E I+G +F+V PRY N  FIGEGAYG VV+A+DT+    VAIK+TSPFEHQT+CQRTYRE+KIL+ F+HENIIDI+NLL     + EMKD+YIVQ LM+TDL+KL KSQ++S EHICYFLYQ+LRGLKYIHSANV+HRDLKPSNLL+N++CDLKICDFGL+RVNDPEHDHKG+LTEYVATRWYRAPEIMLNSKGYTK+IDIWSVGCI  EM + +P+FPGKHYV+QLTLI+ VLGYP  ED+AWIVN  AR FVE+F      PWK +YP AD + I +LE LL FNP  R+TVE+ALA PYL  YY+PTDEPVA  PF+FE ELDDLPI +L+EMI++ V  F +
Sbjct:   60 SKMPAETIKGQQFEVSPRYTNLHFIGEGAYGMVVAALDTQRQEKVAIKKTSPFEHQTFCQRTYRELKILLRFSHENIIDIKNLLLVGSSLEEMKDVYIVQTLMDTDLYKLLKSQRISKEHICYFLYQVLRGLKYIHSANVLHRDLKPSNLLINASCDLKICDFGLARVNDPEHDHKGLLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCIFGEMFSCRPLFPGKHYVDQLTLILGVLGYPKREDQAWIVNSNARRFVERFKNSSGKPWKDVYPMADAKAIDLLERLLAFNPATRITVEEALAHPYLECYYDPTDEPVAERPFSFEAELDDLPIAQLKEMIYQEVSQFSE 410          
BLAST of Mitogen-activated protein kinase vs. TrEMBL
Match: A0A4S2M0F3 (Mitogen-activated protein kinase OS=Opisthorchis felineus OX=147828 GN=CRM22_004946 PE=3 SV=1)

HSP 1 Score: 531.176 bits (1367), Expect = 0.000e+0
Identity = 244/346 (70.52%), Postives = 289/346 (83.53%), Query Frame = 3
Query:   48 EIIRGVEFDVGPRYGNFKFIGEGAYGQVVSAIDTKDNSNVAIKRTSPFEHQTYCQRTYREIKILMHFNHENIIDIRNLL-TAKEMIEMKDLYIVQALMETDLHKLCKSQKLSLEHICYFLYQILRGLKYIHSANVIHRDLKPSNLLVNSNCDLKICDFGLSRVNDPEHDHKGILTEYVATRWYRAPEIMLNSKGYTKAIDIWSVGCILAEMLNGKPIFPGKHYVEQLTLIITVLGYPCEEDKAWIVNEKARHFVEKFVTKMKTPWKQLYPNADEQCITMLEGLLTFNPGKRLTVEQALAMPYLNQYYEPTDEPVASTPFTFEHELDDLPIEKLREMIWERVKYFRQ 1082
            E I+G +F+V PRY N  FIGEGAYG VV+A+DT+    VAIK+TSPFEHQT+CQRTYRE+KIL+ F+HENIIDI+NLL     + EMKD+YIVQ LM+TDL+KL KSQ++S EHICYFLYQ+LRGLKYIHSANV+HRDLKPSNLL+N++CDLKICDFGL+RVNDPEHDHKG+LTEYVATRWYRAPEIMLNSKGYTK+IDIWSVGCI  EM + +P+FPGKHYV+QLTLI+ VLGYP  ED+AWIVN  AR FVE+F      PWK +YP AD + I +LE LL FNP  R+TVE+ALA PYL  YY+PTDEPVA  PF+FE ELDDLPI +L+EMI++ V  F +
Sbjct:    4 ETIKGQQFEVSPRYTNLHFIGEGAYGMVVAALDTQRQEKVAIKKTSPFEHQTFCQRTYRELKILLRFSHENIIDIKNLLLVGSSLEEMKDVYIVQTLMDTDLYKLLKSQRISKEHICYFLYQVLRGLKYIHSANVLHRDLKPSNLLINASCDLKICDFGLARVNDPEHDHKGLLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCIFGEMFSCRPLFPGKHYVDQLTLILGVLGYPKREDQAWIVNSNARRFVERFKNSSGKPWKDVYPMADAKAIDLLERLLAFNPATRITVEEALAHPYLECYYDPTDEPVAERPFSFEAELDDLPIAQLKEMIYQEVSQFSE 349          
BLAST of Mitogen-activated protein kinase vs. TrEMBL
Match: A0A419Q8I2 (Mitogen-activated protein kinase OS=Clonorchis sinensis OX=79923 GN=MAPK3 PE=3 SV=1)

HSP 1 Score: 527.324 bits (1357), Expect = 0.000e+0
Identity = 241/341 (70.67%), Postives = 286/341 (83.87%), Query Frame = 3
Query:   63 VEFDVGPRYGNFKFIGEGAYGQVVSAIDTKDNSNVAIKRTSPFEHQTYCQRTYREIKILMHFNHENIIDIRNLL-TAKEMIEMKDLYIVQALMETDLHKLCKSQKLSLEHICYFLYQILRGLKYIHSANVIHRDLKPSNLLVNSNCDLKICDFGLSRVNDPEHDHKGILTEYVATRWYRAPEIMLNSKGYTKAIDIWSVGCILAEMLNGKPIFPGKHYVEQLTLIITVLGYPCEEDKAWIVNEKARHFVEKFVTKMKTPWKQLYPNADEQCITMLEGLLTFNPGKRLTVEQALAMPYLNQYYEPTDEPVASTPFTFEHELDDLPIEKLREMIWERVKYFRQ 1082
            ++F+V PRY N  FIGEGAYG VV+A+DT+    VAIK+TSPFEHQT+CQRTYRE+KIL+ F+HENIIDI+NLL     + EMKD+YIVQ LM+TDL+KL KSQ++S EHICYFLYQ+LRGLKYIHSANV+HRDLKPSNLL+N++CDLKICDFGL+RVNDPEHDHKG+LTEYVATRWYRAPEIMLNSKGYTK+IDIWSVGCI  EM + +P+FPGKHYV+QLTLI+ VLGYP  ED+AWIVN  AR FVE+F      PWK +YP AD + I +LE LL FNP  R+TVE+ALA PYL  YY+PTDEPVA  PF+FE ELDDLPI +L+EMI++ V  F +
Sbjct:  200 IQFEVSPRYTNLHFIGEGAYGMVVAALDTQRQEKVAIKKTSPFEHQTFCQRTYRELKILLRFSHENIIDIKNLLLVGSSLEEMKDVYIVQTLMDTDLYKLLKSQRISKEHICYFLYQVLRGLKYIHSANVLHRDLKPSNLLINASCDLKICDFGLARVNDPEHDHKGLLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCIFGEMFSCRPLFPGKHYVDQLTLILGVLGYPKREDQAWIVNSNARRFVERFKNSSGKPWKDVYPMADAKAIDLLERLLAFNPATRITVEEALAHPYLECYYDPTDEPVAERPFSFEAELDDLPIAQLKEMIYQEVNQFSE 540          
BLAST of Mitogen-activated protein kinase vs. TrEMBL
Match: K9LM34 (Mitogen-activated protein kinase OS=Penaeus vannamei OX=6689 PE=2 SV=1)

HSP 1 Score: 514.227 bits (1323), Expect = 2.948e-179
Identity = 239/348 (68.68%), Postives = 285/348 (81.90%), Query Frame = 3
Query:   39 SSKEIIRGVEFDVGPRYGNFKFIGEGAYGQVVSAIDTKDNSNVAIKRTSPFEHQTYCQRTYREIKILMHFNHENIIDIRNLLTAKEMIEMKDLYIVQALMETDLHKLCKSQKLSLEHICYFLYQILRGLKYIHSANVIHRDLKPSNLLVNSNCDLKICDFGLSRVNDPEHDHKGILTEYVATRWYRAPEIMLNSKGYTKAIDIWSVGCILAEMLNGKPIFPGKHYVEQLTLIITVLGYPCEEDKAWIVNEKARHFVEKFVTKMKTPWKQLYPNADEQCITMLEGLLTFNPGKRLTVEQALAMPYLNQYYEPTDEPVASTPFTFEHELDDLPIEKLREMIWERVKYFRQ 1082
            +  EI+R   F+VGPRY N  +IGEGAYG VVSA D    + VAIK+ SPFEHQTYCQRT REIKIL  F HEN+IDIR+++ A+ + +MKD+YIVQ LMETDL+KL KSQKLS +HICYFLYQILRGLKYIHSANV+HRDLKPSNLL+N+ CDLKICDFGL+RV DPEHDH G LTEYVATRWYRAPEIMLNSKGYTK+IDIWSVGCILAEML+ +P+FPGKHY++QL  I+ +LG PC+ED   I+NEKAR +++    K K PW +LYPNAD + + +L+ +LTFNP KR+TVE+ALA PYL QYY+P DEPVA  PF FE ELDDLP EKL+E+I+E    F+Q
Sbjct:    7 AEGEIVRCQLFEVGPRYFNLAYIGEGAYGMVVSANDNVTKTKVAIKKISPFEHQTYCQRTLREIKILTRFKHENVIDIRDIIRAQSIDQMKDVYIVQCLMETDLYKLLKSQKLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPLFPGKHYLDQLNHILGILGSPCQEDLDCIINEKARSYLQSLPNKPKVPWTKLYPNADPKALDLLDKMLTFNPHKRITVEEALAHPYLEQYYDPADEPVAEEPFKFEMELDDLPKEKLKELIFEETVLFKQ 354          
BLAST of Mitogen-activated protein kinase vs. TrEMBL
Match: G8Z9H6 (Mitogen-activated protein kinase OS=Penaeus monodon OX=6687 PE=2 SV=1)

HSP 1 Score: 514.227 bits (1323), Expect = 2.948e-179
Identity = 239/348 (68.68%), Postives = 285/348 (81.90%), Query Frame = 3
Query:   39 SSKEIIRGVEFDVGPRYGNFKFIGEGAYGQVVSAIDTKDNSNVAIKRTSPFEHQTYCQRTYREIKILMHFNHENIIDIRNLLTAKEMIEMKDLYIVQALMETDLHKLCKSQKLSLEHICYFLYQILRGLKYIHSANVIHRDLKPSNLLVNSNCDLKICDFGLSRVNDPEHDHKGILTEYVATRWYRAPEIMLNSKGYTKAIDIWSVGCILAEMLNGKPIFPGKHYVEQLTLIITVLGYPCEEDKAWIVNEKARHFVEKFVTKMKTPWKQLYPNADEQCITMLEGLLTFNPGKRLTVEQALAMPYLNQYYEPTDEPVASTPFTFEHELDDLPIEKLREMIWERVKYFRQ 1082
            +  EI+R   F+VGPRY N  +IGEGAYG VVSA D    + VAIK+ SPFEHQTYCQRT REIKIL  F HEN+IDIR+++ A+ + +MKD+YIVQ LMETDL+KL KSQKLS +HICYFLYQILRGLKYIHSANV+HRDLKPSNLL+N+ CDLKICDFGL+RV DPEHDH G LTEYVATRWYRAPEIMLNSKGYTK+IDIWSVGCILAEML+ +P+FPGKHY++QL  I+ +LG PC+ED   I+NEKAR +++    K K PW +LYPNAD + + +L+ +LTFNP KR+TVE+ALA PYL QYY+P DEPVA  PF FE ELDDLP EKL+E+I+E    F+Q
Sbjct:    7 AEGEIVRCQLFEVGPRYFNLAYIGEGAYGMVVSANDNVTKTKVAIKKISPFEHQTYCQRTLREIKILTRFKHENVIDIRDIIRAQSIDQMKDVYIVQCLMETDLYKLLKSQKLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPLFPGKHYLDQLNHILGILGSPCQEDLDCIINEKARSYLQSLPNKPKVPWTKLYPNADPKALDLLDKMLTFNPHKRITVEEALAHPYLEQYYDPADEPVAEEPFKFEMELDDLPKEKLKELIFEETVLFKQ 354          
BLAST of Mitogen-activated protein kinase vs. Ensembl Cavefish
Match: mapk3 (mitogen-activated protein kinase 1 [Source:NCBI gene;Acc:103041389])

HSP 1 Score: 496.893 bits (1278), Expect = 1.562e-175
Identity = 230/350 (65.71%), Postives = 282/350 (80.57%), Query Frame = 3
Query:   30 ANKSSKEIIRGVEFDVGPRYGNFKFIGEGAYGQVVSAIDTKDNSNVAIKRTSPFEHQTYCQRTYREIKILMHFNHENIIDIRNLLTAKEMIEMKDLYIVQALMETDLHKLCKSQKLSLEHICYFLYQILRGLKYIHSANVIHRDLKPSNLLVNSNCDLKICDFGLSRVNDPEHDHKGILTEYVATRWYRAPEIMLNSKGYTKAIDIWSVGCILAEMLNGKPIFPGKHYVEQLTLIITVLGYPCEEDKAWIVNEKARHFVEKFVTKMKTPWKQLYPNADEQCITMLEGLLTFNPGKRLTVEQALAMPYLNQYYEPTDEPVASTPFTFEHELDDLPIEKLREMIWERVKYFR 1079
             +K   E ++G  FDVGPRY + ++IGEGAYG V SA D  +   VAIK+ SPFEHQTYCQRT REIKIL+ F HENII I ++L A+ +  M+D+YIVQ LMETDL+KL K+Q+LS +HICYFLYQILRGLKYIHSANV+HRDLKPSNLL+N+ CDLKICDFGL+R+ DPEHDH G LTEYVATRWYRAPEIMLNSKGYTK+IDIWSVGCILAEML+ +PIFPGKHY++QL  I+ +LG P ++D   I+N KAR++++    K K PW +L+P AD + + +L+ +LTFNP KR+TVE+ALA PYL QYY+PTDEPVA  PFTF  ELDDLP EKL+E+I+E    F+
Sbjct:   37 GSKPGLESVKGQNFDVGPRYTDLQYIGEGAYGMVCSAFDNVNKIRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDILRARRIDYMRDVYIVQDLMETDLYKLLKTQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQDDLNCIINMKARNYLQSLPQKPKIPWNKLFPKADNKALDLLDRMLTFNPIKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFNMELDDLPKEKLKELIFEETARFQ 386          
BLAST of Mitogen-activated protein kinase vs. Ensembl Cavefish
Match: mapk1 (mitogen-activated protein kinase 1 [Source:NCBI gene;Acc:103047585])

HSP 1 Score: 494.967 bits (1273), Expect = 5.466e-175
Identity = 229/344 (66.57%), Postives = 277/344 (80.52%), Query Frame = 3
Query:   48 EIIRGVEFDVGPRYGNFKFIGEGAYGQVVSAIDTKDNSNVAIKRTSPFEHQTYCQRTYREIKILMHFNHENIIDIRNLLTAKEMIEMKDLYIVQALMETDLHKLCKSQKLSLEHICYFLYQILRGLKYIHSANVIHRDLKPSNLLVNSNCDLKICDFGLSRVNDPEHDHKGILTEYVATRWYRAPEIMLNSKGYTKAIDIWSVGCILAEMLNGKPIFPGKHYVEQLTLIITVLGYPCEEDKAWIVNEKARHFVEKFVTKMKTPWKQLYPNADEQCITMLEGLLTFNPGKRLTVEQALAMPYLNQYYEPTDEPVASTPFTFEHELDDLPIEKLREMIWERVKYFR 1079
            E++RG  FDVGPRY N  +IGEGAYG V SA D  +   VAIK+ SPFEHQTYCQRT REIKIL+ F HENII I +++ A  + +MKD+YIVQ LMETDL+KL K+Q LS +HICYFLYQILRGLKYIHSANV+HRDLKPSNLL+N+ CDLKICDFGL+RV DP+HDH G LTEYVATRWYRAPEIMLNSKGYTK+IDIWSVGCILAEML+ +PIFPGKHY++QL  I+ +LG P +ED   I+N KAR+++     + K PW +L+PNAD + + +L+ +LTFNP KR+ VE+ALA PYL QYY+PTDEPVA  PF F+ ELDDLP E L+E+I+E    F+
Sbjct:   23 ELVRGQAFDVGPRYTNLSYIGEGAYGMVCSAYDRDNKVRVAIKKISPFEHQTYCQRTLREIKILLRFKHENIISINDIIRAPSIDQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINIKARNYLLSLPLRCKVPWNRLFPNADPKALDLLDKMLTFNPHKRIEVEEALAHPYLEQYYDPTDEPVAEAPFKFDMELDDLPKETLKELIFEETARFQ 366          
BLAST of Mitogen-activated protein kinase vs. Ensembl Cavefish
Match: mapk1 (mitogen-activated protein kinase 1 [Source:NCBI gene;Acc:103047585])

HSP 1 Score: 456.833 bits (1174), Expect = 2.465e-159
Identity = 211/311 (67.85%), Postives = 254/311 (81.67%), Query Frame = 3
Query:   48 EIIRGVEFDVGPRYGNFKFIGEGAYGQVVSAIDTKDNSNVAIKRTSPFEHQTYCQRTYREIKILMHFNHENIIDIRNLLTAKEMIEMKDLYIVQALMETDLHKLCKSQKLSLEHICYFLYQILRGLKYIHSANVIHRDLKPSNLLVNSNCDLKICDFGLSRVNDPEHDHKGILTEYVATRWYRAPEIMLNSKGYTKAIDIWSVGCILAEMLNGKPIFPGKHYVEQLTLIITVLGYPCEEDKAWIVNEKARHFVEKFVTKMKTPWKQLYPNADEQCITMLEGLLTFNPGKRLTVEQALAMPYLNQYYEPTDE 980
            E++RG  FDVGPRY N  +IGEGAYG V SA D  +   VAIK+ SPFEHQTYCQRT REIKIL+ F HENII I +++ A  + +MKD+YIVQ LMETDL+KL K+Q LS +HICYFLYQILRGLKYIHSANV+HRDLKPSNLL+N+ CDLKICDFGL+RV DP+HDH G LTEYVATRWYRAPEIMLNSKGYTK+IDIWSVGCILAEML+ +PIFPGKHY++QL  I+ +LG P +ED   I+N KAR+++     + K PW +L+PNAD + + +L+ +LTFNP KR+ VE+ALA PYL QYY+PTDE
Sbjct:   23 ELVRGQAFDVGPRYTNLSYIGEGAYGMVCSAYDRDNKVRVAIKKISPFEHQTYCQRTLREIKILLRFKHENIISINDIIRAPSIDQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINIKARNYLLSLPLRCKVPWNRLFPNADPKALDLLDKMLTFNPHKRIEVEEALAHPYLEQYYDPTDE 333          
BLAST of Mitogen-activated protein kinase vs. Ensembl Cavefish
Match: mapk1 (mitogen-activated protein kinase 1 [Source:NCBI gene;Acc:103047585])

HSP 1 Score: 435.261 bits (1118), Expect = 3.812e-152
Identity = 211/344 (61.34%), Postives = 249/344 (72.38%), Query Frame = 3
Query:   48 EIIRGVEFDVGPRYGNFKFIGEGAYGQVVSAIDTKDNSNVAIKRTSPFEHQTYCQRTYREIKILMHFNHENIIDIRNLLTAKEMIEMKDLYIVQALMETDLHKLCKSQKLSLEHICYFLYQILRGLKYIHSANVIHRDLKPSNLLVNSNCDLKICDFGLSRVNDPEHDHKGILTEYVATRWYRAPEIMLNSKGYTKAIDIWSVGCILAEMLNGKPIFPGKHYVEQLTLIITVLGYPCEEDKAWIVNEKARHFVEKFVTKMKTPWKQLYPNADEQCITMLEGLLTFNPGKRLTVEQALAMPYLNQYYEPTDEPVASTPFTFEHELDDLPIEKLREMIWERVKYFR 1079
            E++RG  FDVGPRY N  +IGEGAYG V SA D  +   VAIK+ SPFEHQTYCQRT REIKIL+ F HENII I +++ A  + +MKD+YIVQ LMETDL+KL K+Q LS +HICYFLYQILRGLKYIHSANV+HRDLKPSNLL+N+ CDLKICDFGL+RV DP+HDH G LTEYVATRWYRAPEIMLNSKGYTK+IDIWSVGCILAEML+ +PIFPGKHY++QL  I+                                             + +L+ +LTFNP KR+ VE+ALA PYL QYY+PTDEPVA  PF F+ ELDDLP E L+E+I+E    F+
Sbjct:   23 ELVRGQAFDVGPRYTNLSYIGEGAYGMVCSAYDRDNKVRVAIKKISPFEHQTYCQRTLREIKILLRFKHENIISINDIIRAPSIDQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHIL--------------------------------------------ALDLLDKMLTFNPHKRIEVEEALAHPYLEQYYDPTDEPVAEAPFKFDMELDDLPKETLKELIFEETARFQ 322          
BLAST of Mitogen-activated protein kinase vs. Ensembl Cavefish
Match: mapk7 (mitogen-activated protein kinase 7 [Source:NCBI gene;Acc:103030026])

HSP 1 Score: 318.931 bits (816), Expect = 3.121e-98
Identity = 171/345 (49.57%), Postives = 228/345 (66.09%), Query Frame = 3
Query:   63 VEFDVGPRYGNFKFIGEGAYGQVVSAIDTKDNSNVAIKR-TSPFEHQTYCQRTYREIKILMHFNHENIIDIRNLL-TAKEMIEMKDLYIVQALMETDLHKLCKS-QKLSLEHICYFLYQILRGLKYIHSANVIHRDLKPSNLLVNSNCDLKICDFGLSRVNDPEH--DHKGILTEYVATRWYRAPEIMLNSKGYTKAIDIWSVGCILAEMLNGKPIFPGKHYVEQLTLIITVLGYPCEEDKAWIVNEKARHFVEKFVTKMKTPWKQLYPNADEQCITMLEGLLTFNPGKRLTVEQALAMPYLNQYYEPTDEPVASTPFTFEHELDDLPIEKLREMIWERVKYFRQ 1082
            V+F+VG  Y   + IG GAYG V SA    +   VAIK+  + FE  T  +RT RE+KIL HF H+NII I+++L  A      K +Y+V  LME+DLH++  S Q L+ EH  YFLYQ+LRGLKYIHSANVIHRDLKPSNLLVN NC+LKI DFG++R     H  + +  +TEYVATRWYRAPE+ML+   Y+ AID+WSVGCI AEML  K +FPGKHYV QL LI++VLG P E     I  ++ R FV+   ++   P  +LYP A+   + +L  +L F+P +R++V QAL  PYL++Y++  DEPV    F FE +   +  E+++E I   ++ F Q
Sbjct:   76 VKFEVGEEYDIIETIGTGAYGVVSSARRRDNGQQVAIKKIPNAFEVVTNAKRTLRELKILKHFKHDNIIAIKDILQPAVPHSAFKSVYVVLDLMESDLHQIIHSRQPLTPEHTRYFLYQLLRGLKYIHSANVIHRDLKPSNLLVNENCELKIGDFGMARGLSAAHPDESRSFMTEYVATRWYRAPELMLSLHHYSLAIDLWSVGCIFAEMLGRKQLFPGKHYVHQLQLILSVLGTPPESIIRAIGADRVRSFVQSLPSRAAVPLSRLYPQAEPAALDLLAAMLRFDPRERISVCQALDHPYLSKYHDSDDEPVCVPAFDFEFDRQPMGREQIKEAILTEIQDFHQ 420          
BLAST of Mitogen-activated protein kinase vs. Ensembl Sea Lamprey
Match: mapk1 (mitogen-activated protein kinase 1 [Source:ZFIN;Acc:ZDB-GENE-030722-2])

HSP 1 Score: 492.656 bits (1267), Expect = 8.128e-175
Identity = 226/344 (65.70%), Postives = 278/344 (80.81%), Query Frame = 3
Query:   48 EIIRGVEFDVGPRYGNFKFIGEGAYGQVVSAIDTKDNSNVAIKRTSPFEHQTYCQRTYREIKILMHFNHENIIDIRNLLTAKEMIEMKDLYIVQALMETDLHKLCKSQKLSLEHICYFLYQILRGLKYIHSANVIHRDLKPSNLLVNSNCDLKICDFGLSRVNDPEHDHKGILTEYVATRWYRAPEIMLNSKGYTKAIDIWSVGCILAEMLNGKPIFPGKHYVEQLTLIITVLGYPCEEDKAWIVNEKARHFVEKFVTKMKTPWKQLYPNADEQCITMLEGLLTFNPGKRLTVEQALAMPYLNQYYEPTDEPVASTPFTFEHELDDLPIEKLREMIWERVKYFR 1079
            E+++G  FDVGPRY +  +IGEGAYG V +A D      VAIK+ SPFEHQTYCQRT REIKIL+ F HENII I ++L A  + +MKD+YIVQ LMETDL+KL K Q+LS +HICYFLYQILRGLKYIHSANV+HRDLKPSNLL+N+ CDLKICDFGL+RV DP+HDH G LTEYVATRWYRAPEIMLNSKGYTK+IDIWSVGCILAEML+ +P+FPGKHY++QL  I+ +LG P +ED   I+N KAR++++    K K PW +L+P AD + + +L+ +LTFNP +R+TVE+ALA PYL QYY+P+DEPVA  PF F+ ELDDLP E+L+EMI+E    F+
Sbjct:   23 EVVKGQVFDVGPRYTSLSYIGEGAYGMVCAAFDNVKLVRVAIKKISPFEHQTYCQRTLREIKILLRFKHENIIGINDILRASTIDQMKDVYIVQDLMETDLYKLLKGQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPLFPGKHYLDQLNHILGILGSPSQEDLDCIINMKARNYLQSLPPKAKVPWNRLFPKADSKALDLLDKMLTFNPHRRITVEEALAHPYLEQYYDPSDEPVAEEPFRFDMELDDLPKERLKEMIFEETARFQ 366          
BLAST of Mitogen-activated protein kinase vs. Ensembl Sea Lamprey
Match: mapk14a (mitogen-activated protein kinase 14a [Source:NCBI gene;Acc:65237])

HSP 1 Score: 285.804 bits (730), Expect = 1.026e-93
Identity = 147/342 (42.98%), Postives = 215/342 (62.87%), Query Frame = 3
Query:   69 FDVGPRYGNFKFIGEGAYGQVVSAIDTKDNSNVAIKRTS-PFEHQTYCQRTYREIKILMHFNHENIIDIRNLLTAKEMIE-MKDLYIVQALMETDLHKLCKSQKLSLEHICYFLYQILRGLKYIHSANVIHRDLKPSNLLVNSNCDLKICDFGLSRVNDPEHDHKGILTEYVATRWYRAPEIMLNSKGYTKAIDIWSVGCILAEMLNGKPIFPGKHY----VEQLTLIITVLGYPCEEDKAWIVNEKARHFVEKFVTKMKTPWKQLYPNADEQCITMLEGLLTFNPGKRLTVEQALAMPYLNQYYEPTDEPVASTPFTFEHELDDLPIEKLREMIWERVKYF 1076
            ++V  RY N   +G GAYG V S++DTK    VA+K+ S PF+   + +RTYRE+++L H  HEN+I + ++ T    +E   DLY+V  LM  DL+ + K QKL+ +H+ + +YQILRGLKYIHSA +IHRDLKPSNL VN +C+LKI DFGL+R  D E      +T YVATRWYRAPEIMLN   Y + +DIWSVGCI+AE+L G+ +FPG       + QL  I+ + G P +     + +++AR++++      K  +K ++  A+   + +LE +L  +  +R+T  +AL   Y  QY++P DEP A  P+    E  + P+E+ R + +E V  F
Sbjct:   19 WEVPRRYVNLTSVGSGAYGSVCSSLDTKTGMKVAVKKLSRPFQSVIHAKRTYRELRLLKHMKHENVIGLMDVFTPNSSLEEFDDLYLVTDLMGADLNNIVKCQKLTDDHVQFLVYQILRGLKYIHSAGIIHRDLKPSNLAVNEDCELKILDFGLARHADDE------MTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDRILSDINQLVKILQLTGTPPQYLIDRMQSKEARNYIQSLPYTQKRDFKDVFLGANPLVVDLLERMLVLDTDQRITAAEALVHQYFAQYHDPDDEPEAE-PYDQSFENQEFPVEEWRRLTYEEVISF 353          
BLAST of Mitogen-activated protein kinase vs. Ensembl Sea Lamprey
Match: mapk12a (mitogen-activated protein kinase 12a [Source:NCBI gene;Acc:30681])

HSP 1 Score: 266.929 bits (681), Expect = 2.710e-86
Identity = 138/337 (40.95%), Postives = 208/337 (61.72%), Query Frame = 3
Query:   27 MANKSSKEIIRGVE-----FDVGPRYGNFKFIGEGAYGQVVSAIDTKDNSNVAIKRT-SPFEHQTYCQRTYREIKILMHFNHENIIDIRNLLTAKEMI-EMKDLYIVQALMETDLHKLCKSQKLSLEHICYFLYQILRGLKYIHSANVIHRDLKPSNLLVNSNCDLKICDFGLSRVNDPEHDHKGILTEYVATRWYRAPEIMLNSKGYTKAIDIWSVGCILAEMLNGKPIFPGKHYVEQLTLIITVLGYPCEEDKAWIVNEKARHFVEKFVTKMKTPWKQLYPNADEQCITMLEGLLTFNPGKRLTVEQALAMPYLNQYYEPTDEPVASTPF--TFE 1010
            MA+ SS++    +E     ++V  RY     +G GAYG V S++D    S VA+K+   PF+ + + +R YRE+++L H  HEN+I + ++ T  + + + +D Y+V   M TDL K+ K  K S + + Y +YQIL+GLKYIHS+ +IHRDLKP NL VN +C+LKI DFGL+R  D E      +T YV TRWYRAPE++LN   YT+ +DIWSVGCI+AEM+ GKP+FPG  +++QL LI+ + G P +     +   +A  +++      K     ++PNA+   I +LE +L  +P +R T  +AL  P+ ++  EP +E   + P+  TFE
Sbjct:    2 MAHASSRKGFYRIEINKMVWEVPKRYSQLFAVGSGAYGTVCSSMDLVTGSKVAVKKLYRPFQSRVFAKRAYRELRLLKHMKHENVIGLVDVFTPNDTLDQFQDFYLVMPFMGTDLSKIMKHGKQSDDKVQYLIYQILKGLKYIHSSGIIHRDLKPGNLAVNEDCELKILDFGLARHADQE------MTGYVVTRWYRAPEVILNWMHYTQTVDIWSVGCIMAEMITGKPLFPGNDHMDQLMLILKLTGTPPQYLVDRMDENEAAKYIKTLPKMEKRRISTVFPNANPIAIDLLEKMLALDPEQRPTASEALQHPFFSETREPLEE-TEAEPYDQTFE 331          
BLAST of Mitogen-activated protein kinase vs. Ensembl Sea Lamprey
Match: MAPK6 (mitogen-activated protein kinase 6 [Source:HGNC Symbol;Acc:HGNC:6879])

HSP 1 Score: 264.618 bits (675), Expect = 3.873e-83
Identity = 148/338 (43.79%), Postives = 208/338 (61.54%), Query Frame = 3
Query:   69 FDVGPRYGNFKFIGEGAYGQVVSAIDTKDNSNVAIKR---TSPFEHQTYCQRTYREIKILMHFNHENIIDIRNLLT--------------AKEMIEMKDLYIVQALMETDLHK-LCKSQKLSLEHICYFLYQILRGLKYIHSANVIHRDLKPSNLLVNSN-CDLKICDFGLSRVNDPEHDHKGILTEYVATRWYRAPEIMLNSKGYTKAIDIWSVGCILAEMLNGKPIFPGKHYVEQLTLIITVLGYPCEEDKAWIVNEKARHFVEKFVTKMKTPWKQLYPNADEQCITMLEGLLTFNPGKRLTVEQALAMPYLNQYYEPTDEPVASTPFTFEHELDD 1025
            F++GPRY + K +G G  G V SA+D+  +  VAIK+   + P       +   REIKI+   +H+NI+ +  +L                  + E++ +YIVQ  +ETDL + L +   LS EH   F+YQ+LRGLKYIHSANV+HRDLKP+NL +N+    LKI DFGL+R+ DP + HKG L+E + T+WYR+P ++L+   YTKAID+W+ GCI AEML+GK +F G H +EQ+ LI+  +    +ED   ++N     FV+K   +   P   L PN  ++ +  L+ +LTFNP  RLT EQALA PY++ Y  P DEPVA  PF  E E+DD
Sbjct:   14 FELGPRYVDLKPLGFGGNGLVFSAVDSDCDKRVAIKKLVLSGPHS----LKHALREIKIIRRLDHDNIVRVFEVLGPAGQRLPLGQAGIGTSALAELECVYIVQDYLETDLARVLEQGSALSEEHARLFMYQLLRGLKYIHSANVLHRDLKPANLFINTEELLLKIGDFGLARILDPHYSHKGYLSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCIFAEMLSGKTLFAGAHELEQMQLILQTIPVMRDEDHQELLNVIPV-FVDKERREPPKPLALLLPNVSKEALDFLQQILTFNPMDRLTAEQALAHPYMSLYAFPQDEPVARQPFHIEDEIDD 346          
BLAST of Mitogen-activated protein kinase vs. Ensembl Sea Lamprey
Match: mapk15 (mitogen-activated protein kinase 15 [Source:ZFIN;Acc:ZDB-GENE-050522-307])

HSP 1 Score: 253.062 bits (645), Expect = 4.832e-79
Identity = 144/332 (43.37%), Postives = 196/332 (59.04%), Query Frame = 3
Query:   84 RYGNFKFIGEGAYGQVVSAIDTKDNSNVAIKRT-SPFEHQTYCQ-RTYREIKILMHF-NHENIIDIRNLLTAKEMIEMKDLYIVQALMETDLHKLC-KSQKLSLEHICYFLYQILRGLKYIHSANVIHRDLKPSNLLVNSNCDLKICDFGLSRVNDPEHDHKG--ILTEYVATRWYRAPEIMLNSKGYTKAIDIWSVGCILAEMLNGKPIFPGKHYVEQLTLIITVLGYPCEEDKAWIVNEKARHFVEKFVTKMKTPWKQLYPNADEQCITMLEGLLTFNPGKRLTVEQALAMPYLNQYYEPTDEPVASTPFTFEHELDDLPIEKLREMIWE 1061
            +Y   K +G+G  G V   +D K+   VAIK+    F +QT  Q RT+REI  L  F +H NII++RN+L A      KD+Y+V   M+TDLH +  K   L   H  Y  YQ+L+  KYIHS NVIHRD KPSN+L++  C +K+CDFGL+R      D  G   LTEYVATRWYRAPEI+L S  YTK +D+WSVGCI+ EML GK IFPG   + Q+  I++V+  P +ED   I +E     +EK + + +   + L PNA    + +L+ LL FNP KRLT E+AL  PY+ Q++ P  E           +   L + + R  ++E
Sbjct:   12 KYDIKKRLGKGELGIVWKGVDRKNGDVVAIKKIFDAFRNQTDAQQRTFREIIFLQEFGDHPNIINLRNVLRADND---KDIYLVFDFMDTDLHAVIRKGNILKDVHKAYITYQLLKATKYIHSGNVIHRDQKPSNVLLDGECFVKLCDFGLARSLKQIRDEPGDPALTEYVATRWYRAPEILLASPRYTKGVDMWSVGCIVGEMLLGKAIFPGTSTLNQIERIMSVIPQPSKEDVLAIKSEYGGSVLEK-MGRQRQSLESLLPNAPPNALDLLKRLLVFNPEKRLTAEEALGHPYVAQFHNPQTELAVDYDVVPVDDDTRLSVAEYRNKLYE 339          
BLAST of Mitogen-activated protein kinase vs. Ensembl Yeast
Match: FUS3 (Mitogen-activated serine/threonine protein kinase involved in mating; phosphoactivated by Ste7p; substrates include Ste12p, Far1p, Bni1p, Sst2p; inhibits invasive growth during mating by phosphorylating Tec1p, promoting its; inhibits recruitment of Ste5p, Cdc42p-mediated asymmetry and mating morphogenesis [Source:SGD;Acc:S000000112])

HSP 1 Score: 314.309 bits (804), Expect = 4.204e-105
Identity = 153/335 (45.67%), Postives = 215/335 (64.18%), Query Frame = 3
Query:  102 FIGEGAYGQVVSAIDTKDNSNVAIKRTSPFEHQTYCQRTYREIKILMHFNHENIIDIRNLLTAKEMIEMKDLYIVQALMETDLHKLCKSQKLSLEHICYFLYQILRGLKYIHSANVIHRDLKPSNLLVNSNCDLKICDFGLSRVND--------PEHDHKGILTEYVATRWYRAPEIMLNSKGYTKAIDIWSVGCILAEMLNGKPIFPGKHYVEQLTLIITVLGYP-CEEDKAWIVNEKARHFVEKFVTKMKTPWKQLYPNADEQCITMLEGLLTFNPGKRLTVEQALAMPYLNQYYEPTD----EPVASTPFTFEHELDDLPIEKLREMIWERV 1067
             +GEGAYG V SA        VAIK+  PF+   +  RT REIKIL HF HENII I N+          ++YI+Q LM+TDLH++  +Q LS +HI YF+YQ LR +K +H +NVIHRDLKPSNLL+NSNCDLK+CDFGL+R+ D        P     G +TEYVATRWYRAPE+ML S  Y++A+D+WS GCILAE+   +PIFPG+ Y  QL LI  ++G P  + D   I + +AR +++        P ++++P  + + I +L+ +L F+P KR+T ++AL  PYL  Y++P D    EP+  + F F+H  + L  + L+++IW  +
Sbjct:   18 LLGEGAYGVVCSATHKPTGEIVAIKKIEPFDKPLFALRTLREIKILKHFKHENIITIFNIQRPDSFENFNEVYIIQELMQTDLHRVISTQMLSDDHIQYFIYQTLRAVKVLHGSNVIHRDLKPSNLLINSNCDLKVCDFGLARIIDESAADNSEPTGQQSG-MTEYVATRWYRAPEVMLTSAKYSRAMDVWSCGCILAELFLRRPIFPGRDYRHQLLLIFGIIGTPHSDNDLRCIESPRAREYIKSLPMYPAAPLEKMFPRVNPKGIDLLQRMLVFDPAKRITAKEALEHPYLQTYHDPNDEPEGEPIPPSFFEFDHYKEALTTKDLKKLIWNEI 351          
BLAST of Mitogen-activated protein kinase vs. Ensembl Yeast
Match: HOG1 (Mitogen-activated protein kinase involved in osmoregulation; controls global reallocation of RNAPII during osmotic shock; mediates recruitment/activation of RNAPII at Hot1p-dependent promoters; binds calmodulin; stimulates antisense transcription to activate CDC28; defines novel S-phase checkpoint with Mrc1p that prevent replication/transcription conflicts; nuclear form represses pseudohyphal growth; autophosphorylates; protein abundance increases under DNA replication stress [Source:SGD;Acc:S000004103])

HSP 1 Score: 315.079 bits (806), Expect = 2.273e-104
Identity = 157/356 (44.10%), Postives = 224/356 (62.92%), Query Frame = 3
Query:   39 SSKEIIR----GVEFDVGPRYGNFKFIGEGAYGQVVSAIDTKDNSNVAIKR-TSPFEHQTYCQRTYREIKILMHFNHENIIDIRNLLTAKEMIEMKDLYIVQALMETDLHKLCKSQKLSLEHICYFLYQILRGLKYIHSANVIHRDLKPSNLLVNSNCDLKICDFGLSRVNDPEHDHKGILTEYVATRWYRAPEIMLNSKGYTKAIDIWSVGCILAEMLNGKPIFPGKHYVEQLTLIITVLGYPCEEDKAWIVNEKARHFVEKFVTKMKTPWKQLYPNADEQCITMLEGLLTFNPGKRLTVEQALAMPYLNQYYEPTDEPVASTPFTFEHELDDLPIEKLREMIWERVKYFRQIEG 1091
            +++E IR    G  F++  RY +   +G GA+G V SA DT  +  VAIK+   PF      +RTYRE+K+L H  HEN+I ++++  +     ++D+Y V  L  TDLH+L +++ L  + + YFLYQILRGLKY+HSA VIHRDLKPSN+L+N NCDLKICDFGL+R+ DP+      +T YV+TR+YRAPEIML  + Y   +DIWS GCI AEM+ GKP+FPGK +V Q ++I  +LG P ++    I +E    FV     +   P+ + +   +   + +LE +L F+P KR+T   ALA PY   Y++PTDEPVA   F +     DLP++  R M++  +  F +I G
Sbjct:    3 TNEEFIRTQIFGTVFEITNRYNDLNPVGMGAFGLVCSATDTLTSQPVAIKKIMKPFSTAVLAKRTYRELKLLKHLRHENLICLQDIFLSP----LEDIYFVTELQGTDLHRLLQTRPLEKQFVQYFLYQILRGLKYVHSAGVIHRDLKPSNILINENCDLKICDFGLARIQDPQ------MTGYVSTRYYRAPEIMLTWQKYDVEVDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPKDVINTICSENTLKFVTSLPHRDPIPFSERFKTVEPDAVDLLEKMLVFDPKKRITAADALAHPYSAPYHDPTDEPVADAKFDWHFNDADLPVDTWRVMMYSEILDFHKIGG 348          
BLAST of Mitogen-activated protein kinase vs. Ensembl Yeast
Match: KSS1 (Mitogen-activated protein kinase (MAPK); involved in signal transduction pathways that control filamentous growth and pheromone response; regulates septum assembly, and may directly phosphorylate Bni4p; the KSS1 gene is nonfunctional in S288C strains and functional in W303 strains [Source:SGD;Acc:S000003272])

HSP 1 Score: 311.612 bits (797), Expect = 6.021e-104
Identity = 166/364 (45.60%), Postives = 229/364 (62.91%), Query Frame = 3
Query:   51 IIRGVEFDVGPRYGNFKFIGEGAYGQVVSAIDTKDNSNVAIKRTSPFEHQTYCQRTYREIKILMHFN-HENIIDIRNLLTAKEMIEMKDLYIVQALMETDLHKLCKSQK-----LSLEHICYFLYQILRGLKYIHSANVIHRDLKPSNLLVNSNCDLKICDFGLSRVNDPEHDHK----GILTEYVATRWYRAPEIMLNSKGYTKAIDIWSVGCILAEMLNGKPIFPGKHYVEQLTLIITVLGYPCEEDKAWIVNEKARHFVEKFVTKMKTPWKQLYPNAD--EQCITMLEGLLTFNPGKRLTVEQALAMPYLNQYYEPTDEPVASTPFTFEHE---LDD----------LPIEKLREMIWERV 1067
            + R + FD+  +Y     IGEGAYG V SAI       VAIK+  PF  + +  RT REIK+L +F+ HENII I + +    + ++  +Y+V+ LMETDL K+  +Q      LS +H+ YF YQILR LK IHSA VIHRD+KPSNLL+NSNCDLK+CDFGL+R      D +    G +TEYVATRWYRAPEIML  + YT A+DIWS GCILAEM++GKP+FPG+ Y  QL LI+ VLG P  ED   I +++A+ ++     +   PW+ ++   D     I +L+ +L FNP KR++  +AL  PYL  Y++P+DEP    P   + E   LD+          +PIE L++M+++ +
Sbjct:    1 MARTITFDIPSQYKLVDLIGEGAYGTVCSAIHKPSGIKVAIKKIQPFSKKLFVTRTIREIKLLRYFHEHENIISILDKVRPVSIDKLNAVYLVEELMETDLQKVINNQNSGFSTLSDDHVQYFTYQILRALKSIHSAQVIHRDIKPSNLLLNSNCDLKVCDFGLARCLASSSDSRETLVGFMTEYVATRWYRAPEIMLTFQEYTTAMDIWSCGCILAEMVSGKPLFPGRDYHHQLWLILEVLGTPSFEDFNQIKSKRAKEYIANLPMRPPLPWETVWSKTDLNPDMIDLLDKMLQFNPDKRISAAEALRHPYLAMYHDPSDEP-EYPPLNLDDEFWKLDNKIMRPEEEEEVPIEMLKDMLYDEL 363          
BLAST of Mitogen-activated protein kinase vs. Ensembl Yeast
Match: SLT2 (Serine/threonine MAP kinase; coordinates expression of all 19S regulatory particle assembly-chaperones (RACs) to control proteasome abundance; involved in regulating maintenance of cell wall integrity, cell cycle progression, nuclear mRNA retention in heat shock, septum assembly; required for mitophagy, pexophagy; affects recruitment of mitochondria to phagophore assembly site; plays role in adaptive response of cells to cold; regulated by the PKC1-mediated signaling pathway [Source:SGD;Acc:S000001072])

HSP 1 Score: 304.679 bits (779), Expect = 1.288e-99
Identity = 169/361 (46.81%), Postives = 237/361 (65.65%), Query Frame = 3
Query:   27 MANKSSKEIIR--GVEFDVGPRYGNFKFIGEGAYGQVVSA--IDTKDNSNVAIKR-TSPFEHQTYCQRTYREIKILMHF-NHENIIDIRNL-LTAKEMIEMKDLYIVQALMETDLHKLCKS-QKLSLEHICYFLYQILRGLKYIHSANVIHRDLKPSNLLVNSNCDLKICDFGLSR-VNDPEHDHKGILTEYVATRWYRAPEIMLNSKGYTKAIDIWSVGCILAEMLNGKPIFPGKHYVEQLTLIITVLGYPCEEDKAWIVNEKARHFVEKFVTKMKTPWKQLYPNADEQCITMLEGLLTFNPGKRLTVEQALAMPYLNQYYEPTDEPVASTPFTFEHE-LDDLPIEKLREMIWERVKYFR 1079
            MA+K  +   +    +F V  R+   K IG GAYG V SA   +  +++ VAIK+ T+ F     C+R+ RE+K+L HF  H+NI  + ++ +       +  LY+ + LME D+H++ KS Q L+  H   F YQIL GLKYIHSA+V+HRDLKP NLLVN++C LKICDFGL+R  ++   ++   LTEYVATRWYRAPEIML+ +GYTKAID+WS GCILAE L GKPIF GK YV QL  I+ VLG P +E    I ++  + ++ +     K P+  LYPNA+ Q + +LE +L F+P KR+TV++AL  PYL+ +++P DEPV S  F F  E ++D+  E L++M+ + V+ FR
Sbjct:    1 MADKIERHTFKVFNQDFSVDKRFQLIKEIGHGAYGIVCSARFAEAAEDTTVAIKKVTNVFSKTLLCKRSLRELKLLRHFRGHKNITCLYDMDIVFYPDGSINGLYLYEELMECDMHQIIKSGQPLTDAHYQSFTYQILCGLKYIHSADVLHRDLKPGNLLVNADCQLKICDFGLARGYSENPVENSQFLTEYVATRWYRAPEIMLSYQGYTKAIDVWSAGCILAEFLGGKPIFKGKDYVNQLNQILQVLGTPPDETLRRIGSKNVQDYIHQLGFIPKVPFVNLYPNANSQALDLLEQMLAFDPQKRITVDEALEHPYLSIWHDPADEPVCSEKFEFSFESVNDM--EDLKQMVIQEVQDFR 359          
BLAST of Mitogen-activated protein kinase vs. Ensembl Yeast
Match: SMK1 (Middle sporulation-specific mitogen-activated protein kinase (MAPK); required for production of the outer spore wall layers; negatively regulates activity of the glucan synthase subunit Gsc2p [Source:SGD;Acc:S000006258])

HSP 1 Score: 238.81 bits (608), Expect = 2.142e-75
Identity = 148/355 (41.69%), Postives = 209/355 (58.87%), Query Frame = 3
Query:   87 YGNFKFIGEGAYGQVVSAIDTKDNS---NVAIKRTSP-FEHQTYCQRTYREIKILMHF-NHENIIDIRNLLTAKEMIEMKDLYIVQALMETDLHKLCKSQ-KLSLEHICYFLYQILRGLKYIHSANVIHRDLKPSNLLVNSNCDLKICDFGLSRVNDPEHDHKGI----------LTEYVATRWYRAPEIMLNSKGYTKAIDIWSVGCILAEMLNGKPIFPGKHYVEQLTLIITVLGYPCEE-------DKAWIVNEKARHFVEKFVTKMKTPWKQLYPNADEQCITMLEGLLTFNPGKRLTVEQALAMPYLNQYYEPTDEPVA-STPFTFEHELDDLPIEKLREMIWERVKYFR 1079
            Y   +F+G+GAYG V S +  K  S    +A+K+ S  F  +   +R  RE+K +  F  H+NI+++ +L           LY  Q L++ DL K+  S  +LS  HI YFLYQIL GLKYIHSA+VIHRDLKP N+L   N  LKICDFGL+R       H G           +T YVATRWYRAPE++L+++ Y+K++DIW+VGCILAE    KP+F G+  + Q+  II VLG P ++        KAW + + + + V K     K PW  ++P A  + I ++E LL ++   RL VEQA++ P+LN+  +P DEPV    PF F +E +   + KLR+ + E VK F+
Sbjct:   38 YEIIQFLGKGAYGTVCS-VKFKGRSPAARIAVKKISNIFNKEILLKRAIRELKFMNFFKGHKNIVNLIDLEIVTSS-PYDGLYCYQELIDYDLAKVIHSSVQLSEFHIKYFLYQILCGLKYIHSADVIHRDLKPGNILCTLNGCLKICDFGLAR-----GIHAGFFKCHSTVQPHITNYVATRWYRAPELLLSNQPYSKSVDIWAVGCILAEFYARKPVFMGRDSMHQIFEIIKVLGTPDKDILIKFGTIKAWNLGKNSNNPVYK-----KIPWSNIFPFASHEAINLIESLLHWDSTHRLNVEQAISHPFLNEVRKPDDEPVCLQGPFDFTYESELNSMSKLRDYLVEEVKNFK 380          
BLAST of Mitogen-activated protein kinase vs. Ensembl Nematostella
Match: EDO37435 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFQ0])

HSP 1 Score: 488.419 bits (1256), Expect = 2.684e-173
Identity = 225/340 (66.18%), Postives = 271/340 (79.71%), Query Frame = 3
Query:   27 MANKSSKEIIRGVEFDVGPRYGNFKFIGEGAYGQVVSAIDTKDNSNVAIKRTSPFEHQTYCQRTYREIKILMHFNHENIIDIRNLLTAKEMIEMKDLYIVQALMETDLHKLCKSQKLSLEHICYFLYQILRGLKYIHSANVIHRDLKPSNLLVNSNCDLKICDFGLSRVNDPEHDHKGILTEYVATRWYRAPEIMLNSKGYTKAIDIWSVGCILAEMLNGKPIFPGKHYVEQLTLIITVLGYPCEEDKAWIVNEKARHFVEKFVTKMKTPWKQLYPNADEQCITMLEGLLTFNPGKRLTVEQALAMPYLNQYYEPTDEPVASTPFTFEHELDDLPIEKLR 1046
            MA  +  E++RG  FDV PRY N  +IGEGAYG VV+ +D      +AIK+ SPFEHQTYCQRT REIKIL  F HENII I +++ A    +MKD+YIVQ LMETD++KL K+Q+LS +HICYFLYQILRGLKYIHSANV+HRDLKPSNLL+N+ CDLKICDFGL+R+ DP+HDH G LTEYVATRWYRAPEIMLNSKGY+KAIDIWSVGCILAEML  +P+FPGKHY++QL LI+ VLG P  +D   I NEKAR +++    K KTP+ +L+ NAD + + ++E LL FNP KR+TVE+ALA PYL QYY+P DEPVA TPF F+ ELDDLP EKL+
Sbjct:    1 MAASTGPEVVRGQVFDVAPRYTNLNYIGEGAYGMVVAGVDNTTGERIAIKKISPFEHQTYCQRTLREIKILSRFKHENIIGILDIIRAPRAEDMKDIYIVQPLMETDMYKLLKTQRLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARIADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYSKAIDIWSVGCILAEMLANRPLFPGKHYLDQLNLILNVLGSPIADDLLCIKNEKARSYLQSLPYKPKTPFIKLFSNADAKALDLIENLLAFNPNKRITVEEALAHPYLEQYYDPADEPVAETPFKFQMELDDLPKEKLK 340          
BLAST of Mitogen-activated protein kinase vs. Ensembl Nematostella
Match: EDO40573 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6R5])

HSP 1 Score: 312.383 bits (799), Expect = 2.211e-103
Identity = 158/344 (45.93%), Postives = 230/344 (66.86%), Query Frame = 3
Query:   63 VEFDVGPRYGNFKFIGEGAYGQVVSAIDTKDNSNVAIKRTS-PFEHQTYCQRTYREIKILMHFNHENIIDIRNLLTAK-EMIEMKDLYIVQALMETDLHKLCKS-QKLSLEHICYFLYQILRGLKYIHSANVIHRDLKPSNLLVNSNCDLKICDFGLSR-VNDPEHDHKGILTEYVATRWYRAPEIMLNSKGYTKAIDIWSVGCILAEMLNGKPIFPGKHYVEQLTLIITVLGYPCEEDKAWIVNEKARHFVEKFVTKMKTPWKQLYPNADEQCITMLEGLLTFNPGKRLTVEQALAMPYLNQYYEPTDEPVASTPFTFEHELDDLPIEKLREMIWERVKYFRQ 1082
            ++F V  RY   + IG GAYG V SA+DT+  + VA+K+ S  F+  T  +RT+RE+KIL HF H+NII IR++L     + E  D+Y+V  LME+DLH++  + Q L+ EH+ YFLYQILRGLKYIHSA V+HRDLKPSNLLVN N +LKI DFG++R +     + K  +TEYVATRWYRAPE+ML+   Y++AID+WSVGCILAEM+  +P+FPG +Y+ QL +I++V G P +     +  E+ + ++ +   K   P+++ +P A  + I +L  +L  +P +R+TVE AL  P+L +Y+   DEP   +P  F+ +   +  E L+E I   +K F++
Sbjct:   15 IKFVVDARYKLIETIGNGAYGVVCSAMDTRTGAKVAVKKISRAFDVLTTARRTHRELKILRHFKHDNIICIRDILKPPVNLDEFDDVYVVLDLMESDLHRIIHTDQPLTTEHVRYFLYQILRGLKYIHSAKVLHRDLKPSNLLVNENAELKIGDFGMARGLCSSPLEQKRFMTEYVATRWYRAPELMLSLNEYSEAIDMWSVGCILAEMIGRRPLFPGANYLNQLQMILSVTGTPSQNFIERMGAERVKTYLNQLPHKDPVPFEKFFPKAHPEAINLLSQMLQLDPKERITVENALQHPFLKEYHSEEDEPTCYSPLDFKFDTVLMTKEALKEAIVNEIKDFQK 358          
BLAST of Mitogen-activated protein kinase vs. Ensembl Nematostella
Match: EDO46881 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNM4])

HSP 1 Score: 295.434 bits (755), Expect = 4.346e-97
Identity = 157/356 (44.10%), Postives = 229/356 (64.33%), Query Frame = 3
Query:   48 EIIRGVEFDVGPRYGNFKFIGEGAYGQVVSAIDTK-DNSN------VAIKRTS-PFEHQTYCQRTYREIKILMHFNHENIIDIRNLLTAKEMIE-MKDLYIVQALMETDLHKLCKSQKLSLEHICYFLYQILRGLKYIHSANVIHRDLKPSNLLVNSNCDLKICDFGLSRVNDPEHDHKGILTEYVATRWYRAPEIMLNSKGYTKAIDIWSVGCILAEMLNGKPIFPGKHYVEQLTLIITVLGYPCEEDKAWIVNEKARHFVEKFVTKMKTPWKQLYPNADEQCITMLEGLLTFNPGKRLTVEQALAMPYLNQYYEPTDEPVASTPFTFEHELD--DLPIEKLREMIWERVKYFRQ 1082
            E++  V ++V  +Y     IG GAYGQV S+  T+ D +N      VAIK+ S PF+   + +RTYRE+K+L H  HEN+I + ++ T     E  +D+Y+V  LM +DL+ + + QKLS EH+ + +YQILRGLKYIHSA VIHRDLKPSN+ VN +C+LKI DFGL+R+ D E      +T YVATRWYRAPEIMLN   Y + +DIWSVGCI+AE+L  K +FPG  +++QLT I+ ++G P ++    I +E AR+++ +     KTP+ + +  A+   + +LE +L  +   R+T  +AL+ PYL  Y +P DEP  S   TF+   D  +L IE  R ++++ +  F+Q
Sbjct:   12 ELVNTV-YEVPRKYQELSPIGTGAYGQVCSSTITEPDPTNPDGPNTVAIKKLSRPFQSTMHAKRTYRELKLLRHMRHENVISLLDVFTTASAFEHFQDVYMVTELMGSDLNGILRFQKLSDEHVQFLVYQILRGLKYIHSAGVIHRDLKPSNIAVNEDCELKILDFGLARMTDAE------MTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTSKTLFPGNDHIDQLTKIMQLVGKPSDDFLQKIDSESARNYIAQMPDYRKTPFDEYFVGANPLAVDLLEKMLNLDTDHRITAVEALSHPYLASYADPNDEPTCS---TFDDSFDEKELSIEGWRALVYQEILDFQQ 357          
BLAST of Mitogen-activated protein kinase vs. Ensembl Nematostella
Match: EDO45693 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RS71])

HSP 1 Score: 268.47 bits (685), Expect = 4.052e-87
Identity = 145/346 (41.91%), Postives = 208/346 (60.12%), Query Frame = 3
Query:   27 MANKSSKEIIRGVEFDVGPRYGNFKFIGEGAYGQVVSAIDTKDNSNVAIKRTSPFEHQTYCQRTYREIKILMHFNHENIIDIRNLLT----------AKEMIEMKDLYIVQALMETDLHKLCKS-QKLSLEHICYFLYQILRGLKYIHSANVIHRDLKPSNLLVNSNC-DLKICDFGLSRVNDPEHDHKGILTEYVATRWYRAPEIMLNSKGYTKAIDIWSVGCILAEMLNGKPIFPGKHYVEQLTLIITVLGYPCEEDKAWIVNEKARHFVEKFVTKMKTPWKQLYPNADEQCITMLEGLLTFNPGKRLTVEQALAMPYLNQYYEPTDEPVASTPFTFEHELDDL 1028
            M+++ S+E +R       P + N K IG G  G V S ID+K +  VA+KR +  + Q+ C+ T R+I++  +  HENI+ + N++           A+   +   +Y+VQ +MET+LH + +S   L  ++   FLYQ+LRGLKYIHSANV+HRD+KPSNLLV+S    LKI DFG +RV DPE DH G LT   +T WY+APE+ LNS GY+ AIDIW  GC+ AEML GKP+F G+H +EQL LI+  +    +       + KA +F +  +   K P    + + D + + +L+ +L F+P  R+T E AL  PYL  Y  P DEP++  P   E E+DD 
Sbjct:    1 MSDEGSQEFLR-------PYFTNLKLIGTGGSGAVYSGIDSKTDRRVALKRVN-IQDQSSCRTTLRQIEVQRNLEHENIVKLLNIVDCEGKSIHNGDAENFKDTDYVYLVQEVMETNLHTILQSNSSLGQDYSKLFLYQLLRGLKYIHSANVLHRDIKPSNLLVDSETLMLKIGDFGQTRVVDPEFDHDGYLTHSPSTLWYKAPELFLNSTGYSNAIDIWGAGCVFAEMLLGKPLFEGRHDIEQLQLILDTIPVDSKGLNNLEFDMKA-NFDKMLLDGPKEPLYSKFQDLDPKALDLLKQMLRFSPESRITAEDALTHPYLGLYSFPEDEPISLAPLHIEDEVDDF 337          
BLAST of Mitogen-activated protein kinase vs. Ensembl Nematostella
Match: EDO39421 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SA30])

HSP 1 Score: 241.506 bits (615), Expect = 6.371e-77
Identity = 133/314 (42.36%), Postives = 190/314 (60.51%), Query Frame = 3
Query:   63 VEFDVGPRYGNFKFIGEGAYGQVVSAIDTKDNSNVAIKRT-SPFEHQTYCQRTYREIKILMHF-NHENIIDIRNLLTAKEMIEMKDLYIVQALMETDLHKLCKSQKLSLE-HICYFLYQILRGLKYIHSANVIHRDLKPSNLLVNSNCDLKICDFGLSRV--NDPEHDHKGILTEYVATRW-YRAPEIMLNSKGYTKAIDIWSVGCILAEMLNGKPIFPGKHYVEQLTLIITVLGYPCEEDKAWIVNEKARHFVEKFVTKMKTPWKQLYPNADEQCITMLEGLLTFNPGKRLTVEQALAMPYLNQYYEPTDEPV 986
            ++  +  +Y   K +G+GAYG V  AID +    VA+K+    F +QT  QRT+REI  L  F +HEN++ + N++ A      KD+Y+V   M+TDLH + K   +  + H  Y +YQ+L+  K+IHS NVIHRDLKPSNLL++S C  KICDFGL+R   N  +      LT+YVATR   RAPEI+L S  YTK +D+WS+GCIL E+L GKP+FPG   + Q+  I+T +  P  +D   I +  +   +++   K K     +   A    I +L  LL FNP KRLT E+AL+ PY+ +++ P +EP 
Sbjct:    5 IDSHITKKYEIKKRLGKGAYGIVWKAIDRRTGEVVAVKKIFDAFRNQTDAQRTFREICFLQEFGDHENVVKLMNVIKADND---KDIYLVFEYMDTDLHNVIKRGNILKDIHKRYIMYQLLKATKFIHSGNVIHRDLKPSNLLLDSECFAKICDFGLARSVSNITQEAGDPSLTDYVATRGILRAPEILLASPRYTKGVDMWSIGCILGELLLGKPLFPGSSTLNQIEKIMTSIAPPSRQDVDSIKSHYSTSVLDRMACKPKRSLADVLNTAPSDAIDLLNKLLQFNPDKRLTAEEALSHPYVARFHNPEEEPA 315          
BLAST of Mitogen-activated protein kinase vs. Ensembl Medaka
Match: mapk3 (mitogen-activated protein kinase 1 [Source:NCBI gene;Acc:101159747])

HSP 1 Score: 498.434 bits (1282), Expect = 4.195e-176
Identity = 232/349 (66.48%), Postives = 277/349 (79.37%), Query Frame = 3
Query:   30 ANKSSKEIIRGVEFDVGPRYGNFKFIGEGAYGQVVSAIDTKDNSNVAIKRTSPFEHQTYCQRTYREIKILMHFNHENIIDIRNLLTAKEMIEMKDLYIVQALMETDLHKLCKSQKLSLEHICYFLYQILRGLKYIHSANVIHRDLKPSNLLVNSNCDLKICDFGLSRVNDPEHDHKGILTEYVATRWYRAPEIMLNSKGYTKAIDIWSVGCILAEMLNGKPIFPGKHYVEQLTLIITVLGYPCEEDKAWIVNEKARHFVEKFVTKMKTPWKQLYPNADEQCITMLEGLLTFNPGKRLTVEQALAMPYLNQYYEPTDEPVASTPFTFEHELDDLPIEKLREMIWERVKYF 1076
             +K   E +RG  FDVGPRY N  +IGEGAYG V SA+D   N  VAIK+ SPFEHQTYCQRT REIKIL+ FNHENII I ++L A+ +  M+D+YIVQ LMETDL+KL KSQ+LS +H+CYFLYQILRGLKYIHSANV+HRDLKPSNLL+N+ CDLKICDFGL+R+ DPEHDH G LTEYVATRWYRAPEIMLNSKGY+K+IDIWSVGCILAEML+ KPIFPGKHY++QL  I+ VLG P +ED   I+N KAR++++    K K P ++L+  AD + + +L  +LTFNP KR++VE ALA PYL QYY+P DEPVA  PFTF  ELDDLP E L+EMI+E    F
Sbjct:   34 GSKPCSESVRGQNFDVGPRYTNLSYIGEGAYGMVCSALDNLTNQRVAIKKISPFEHQTYCQRTLREIKILLRFNHENIIGINDILRARHIDNMRDVYIVQTLMETDLYKLLKSQRLSNDHVCYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYSKSIDIWSVGCILAEMLSNKPIFPGKHYLDQLNHILGVLGSPSQEDLNSIINVKARNYLQSLPEKPKVPLEKLFVKADPKALDLLGRMLTFNPVKRISVEDALAHPYLEQYYDPNDEPVAEEPFTFSMELDDLPKETLKEMIYEETARF 382          
BLAST of Mitogen-activated protein kinase vs. Ensembl Medaka
Match: mapk1 (mitogen-activated protein kinase 1 [Source:NCBI gene;Acc:101162905])

HSP 1 Score: 493.812 bits (1270), Expect = 1.368e-174
Identity = 230/344 (66.86%), Postives = 276/344 (80.23%), Query Frame = 3
Query:   48 EIIRGVEFDVGPRYGNFKFIGEGAYGQVVSAIDTKDNSNVAIKRTSPFEHQTYCQRTYREIKILMHFNHENIIDIRNLLTAKEMIEMKDLYIVQALMETDLHKLCKSQKLSLEHICYFLYQILRGLKYIHSANVIHRDLKPSNLLVNSNCDLKICDFGLSRVNDPEHDHKGILTEYVATRWYRAPEIMLNSKGYTKAIDIWSVGCILAEMLNGKPIFPGKHYVEQLTLIITVLGYPCEEDKAWIVNEKARHFVEKFVTKMKTPWKQLYPNADEQCITMLEGLLTFNPGKRLTVEQALAMPYLNQYYEPTDEPVASTPFTFEHELDDLPIEKLREMIWERVKYFR 1079
            E++RG  FDVGPRY N  +IGEGAYG V SA D  +   VAIK+ SPFEHQTYCQRT REIKIL+ F HENII I +++ A  + +MKD+YIVQ LMETDL+KL K+Q LS +HICYFLYQILRGLKYIHSANV+HRDLKPSNLL+N+ CDLKICDFGL+RV DP+HDH G LTEYVATRWYRAPEIMLNSKGYTK+IDIWSVGCILAEML+ +PIFPGKHY++QL  I+ +LG P +ED   I+N KAR+++     + K PW +L+PNAD + + +L+ +LTFNP KR+ VEQALA PYL QYY+PTDEPVA  PF F+ ELDDLP E L+E I+E    F+
Sbjct:   21 ELVRGQAFDVGPRYSNLSYIGEGAYGMVCSAYDRDNKIRVAIKKISPFEHQTYCQRTLREIKILLRFKHENIIGINDIIRAPSIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINIKARNYLLSLPLRCKVPWNRLFPNADPKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPTDEPVAEAPFKFDMELDDLPKETLKEYIFEETARFQ 364          
BLAST of Mitogen-activated protein kinase vs. Ensembl Medaka
Match: mapk7 (mitogen-activated protein kinase 7 [Source:NCBI gene;Acc:101157651])

HSP 1 Score: 324.324 bits (830), Expect = 1.257e-100
Identity = 168/343 (48.98%), Postives = 227/343 (66.18%), Query Frame = 3
Query:   63 VEFDVGPRYGNFKFIGEGAYGQVVSAIDTKDNSNVAIKRTS-PFEHQTYCQRTYREIKILMHFNHENIIDIRNLLTAK-EMIEMKDLYIVQALMETDLHKLCKS-QKLSLEHICYFLYQILRGLKYIHSANVIHRDLKPSNLLVNSNCDLKICDFGLSR--VNDPEHDHKGILTEYVATRWYRAPEIMLNSKGYTKAIDIWSVGCILAEMLNGKPIFPGKHYVEQLTLIITVLGYPCEEDKAWIVNEKARHFVEKFVTKMKTPWKQLYPNADEQCITMLEGLLTFNPGKRLTVEQALAMPYLNQYYEPTDEPVASTPFTFEHELDDLPIEKLREMIWERVKYF 1076
            V+FDVG  Y   + IG GAYG V SA    +   VAIK+ S  FE  T  +RT RE+KIL HF H+NII I+++L         K +Y+V  LME+DLH++  S Q L+ EH  YFLYQ+LRGLKY+HSANVIHRDLKPSNLLVN NC+LKI DFG++R   + PE  +   +TEYVATRWYRAPE++L+   Y+ AID+WSVGCI AEML  K +FPGKHYV QL LI++VLG P E   + I  E+ R +V+   ++   P  +LYP A+   + +L  +L F+P +R+ V +AL  PYL +Y++P DEP+    F FE +   +  E++++ I   ++ F
Sbjct:   57 VKFDVGEEYDIIETIGTGAYGVVSSARRRDNGQQVAIKKISNAFEVVTNAKRTLRELKILKHFKHDNIIAIKDILQPNLPHSAFKSVYVVLDLMESDLHQIIHSTQTLTPEHTRYFLYQLLRGLKYVHSANVIHRDLKPSNLLVNENCELKIGDFGMARGLSSHPEESYS-FMTEYVATRWYRAPELLLSLNHYSLAIDLWSVGCIFAEMLGRKQLFPGKHYVHQLQLILSVLGTPPEGLISAIRAERVRSYVQSLPSRTAVPLSKLYPQAEPDALDLLGAMLRFDPRQRIGVTEALEHPYLAKYHDPDDEPICVPAFDFEFDKIAMSKEQIKDAILMEIQDF 398          
BLAST of Mitogen-activated protein kinase vs. Ensembl Medaka
Match: mapk7 (mitogen-activated protein kinase 7 [Source:NCBI gene;Acc:101157651])

HSP 1 Score: 323.939 bits (829), Expect = 3.252e-100
Identity = 168/343 (48.98%), Postives = 227/343 (66.18%), Query Frame = 3
Query:   63 VEFDVGPRYGNFKFIGEGAYGQVVSAIDTKDNSNVAIKRTS-PFEHQTYCQRTYREIKILMHFNHENIIDIRNLLTAK-EMIEMKDLYIVQALMETDLHKLCKS-QKLSLEHICYFLYQILRGLKYIHSANVIHRDLKPSNLLVNSNCDLKICDFGLSR--VNDPEHDHKGILTEYVATRWYRAPEIMLNSKGYTKAIDIWSVGCILAEMLNGKPIFPGKHYVEQLTLIITVLGYPCEEDKAWIVNEKARHFVEKFVTKMKTPWKQLYPNADEQCITMLEGLLTFNPGKRLTVEQALAMPYLNQYYEPTDEPVASTPFTFEHELDDLPIEKLREMIWERVKYF 1076
            V+FDVG  Y   + IG GAYG V SA    +   VAIK+ S  FE  T  +RT RE+KIL HF H+NII I+++L         K +Y+V  LME+DLH++  S Q L+ EH  YFLYQ+LRGLKY+HSANVIHRDLKPSNLLVN NC+LKI DFG++R   + PE  +   +TEYVATRWYRAPE++L+   Y+ AID+WSVGCI AEML  K +FPGKHYV QL LI++VLG P E   + I  E+ R +V+   ++   P  +LYP A+   + +L  +L F+P +R+ V +AL  PYL +Y++P DEP+    F FE +   +  E++++ I   ++ F
Sbjct:  101 VKFDVGEEYDIIETIGTGAYGVVSSARRRDNGQQVAIKKISNAFEVVTNAKRTLRELKILKHFKHDNIIAIKDILQPNLPHSAFKSVYVVLDLMESDLHQIIHSTQTLTPEHTRYFLYQLLRGLKYVHSANVIHRDLKPSNLLVNENCELKIGDFGMARGLSSHPEESYS-FMTEYVATRWYRAPELLLSLNHYSLAIDLWSVGCIFAEMLGRKQLFPGKHYVHQLQLILSVLGTPPEGLISAIRAERVRSYVQSLPSRTAVPLSKLYPQAEPDALDLLGAMLRFDPRQRIGVTEALEHPYLAKYHDPDDEPICVPAFDFEFDKIAMSKEQIKDAILMEIQDF 442          
BLAST of Mitogen-activated protein kinase vs. Ensembl Medaka
Match: mapk14b (mitogen-activated protein kinase 14A [Source:NCBI gene;Acc:101162042])

HSP 1 Score: 297.745 bits (761), Expect = 1.184e-97
Identity = 152/338 (44.97%), Postives = 217/338 (64.20%), Query Frame = 3
Query:   69 FDVGPRYGNFKFIGEGAYGQVVSAIDTKDNSNVAIKRTS-PFEHQTYCQRTYREIKILMHFNHENIIDIRNLLT-AKEMIEMKDLYIVQALMETDLHKLCKSQKLSLEHICYFLYQILRGLKYIHSANVIHRDLKPSNLLVNSNCDLKICDFGLSRVNDPEHDHKGILTEYVATRWYRAPEIMLNSKGYTKAIDIWSVGCILAEMLNGKPIFPGKHYVEQLTLIITVLGYPCEEDKAWIVNEKARHFVEKFVTKMKTPWKQLYPNADEQCITMLEGLLTFNPGKRLTVEQALAMPYLNQYYEPTDEPVASTPFTFEHELDDLPIEKLREMIWERVKYF 1076
            ++V  RY N   +G GAYG V S+ D K    VA+K+ S PF+   + +RTYRE+++L H  HEN+I + ++ T A  + E  D+Y+V  LM  DL+ + K QKL+ +H+ + +YQILRGLKYIHSA ++HRDLKPSNL VN +C+LKI DFGL+R  D E      +T YVATRWYRAPEIMLN   Y   +DIWSVGCI+AE+L G+ +FPG  +++QL LI+ ++G P  E    I +E AR+++       K  +  ++  A+   + +LE +L  +  KR+T  +ALA PY  QY++P DEP A  P+    E  +L IE+ R +I++ V  F
Sbjct:   19 WEVPERYQNLSPVGSGAYGSVCSSYDVKTCLKVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPATSLDEFSDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSAGIVHRDLKPSNLAVNEDCELKILDFGLARHTDDE------MTGYVATRWYRAPEIMLNWMHYNMTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLIMMLVGTPGPELLMKISSEPARNYINSLPHMPKRNFADVFIGANPLAVDLLEKMLVLDTDKRITASEALAHPYFAQYHDPDDEPEAE-PYDQSFESRELEIEEWRSLIYDEVLSF 349          
BLAST of Mitogen-activated protein kinase vs. Planmine SMEST
Match: SMESG000032743.1 (SMESG000032743.1)

HSP 1 Score: 744.191 bits (1920), Expect = 0.000e+0
Identity = 355/355 (100.00%), Postives = 355/355 (100.00%), Query Frame = 3
Query:   27 MANKSSKEIIRGVEFDVGPRYGNFKFIGEGAYGQVVSAIDTKDNSNVAIKRTSPFEHQTYCQRTYREIKILMHFNHENIIDIRNLLTAKEMIEMKDLYIVQALMETDLHKLCKSQKLSLEHICYFLYQILRGLKYIHSANVIHRDLKPSNLLVNSNCDLKICDFGLSRVNDPEHDHKGILTEYVATRWYRAPEIMLNSKGYTKAIDIWSVGCILAEMLNGKPIFPGKHYVEQLTLIITVLGYPCEEDKAWIVNEKARHFVEKFVTKMKTPWKQLYPNADEQCITMLEGLLTFNPGKRLTVEQALAMPYLNQYYEPTDEPVASTPFTFEHELDDLPIEKLREMIWERVKYFRQIEG 1091
            MANKSSKEIIRGVEFDVGPRYGNFKFIGEGAYGQVVSAIDTKDNSNVAIKRTSPFEHQTYCQRTYREIKILMHFNHENIIDIRNLLTAKEMIEMKDLYIVQALMETDLHKLCKSQKLSLEHICYFLYQILRGLKYIHSANVIHRDLKPSNLLVNSNCDLKICDFGLSRVNDPEHDHKGILTEYVATRWYRAPEIMLNSKGYTKAIDIWSVGCILAEMLNGKPIFPGKHYVEQLTLIITVLGYPCEEDKAWIVNEKARHFVEKFVTKMKTPWKQLYPNADEQCITMLEGLLTFNPGKRLTVEQALAMPYLNQYYEPTDEPVASTPFTFEHELDDLPIEKLREMIWERVKYFRQIEG
Sbjct:    1 MANKSSKEIIRGVEFDVGPRYGNFKFIGEGAYGQVVSAIDTKDNSNVAIKRTSPFEHQTYCQRTYREIKILMHFNHENIIDIRNLLTAKEMIEMKDLYIVQALMETDLHKLCKSQKLSLEHICYFLYQILRGLKYIHSANVIHRDLKPSNLLVNSNCDLKICDFGLSRVNDPEHDHKGILTEYVATRWYRAPEIMLNSKGYTKAIDIWSVGCILAEMLNGKPIFPGKHYVEQLTLIITVLGYPCEEDKAWIVNEKARHFVEKFVTKMKTPWKQLYPNADEQCITMLEGLLTFNPGKRLTVEQALAMPYLNQYYEPTDEPVASTPFTFEHELDDLPIEKLREMIWERVKYFRQIEG 355          
BLAST of Mitogen-activated protein kinase vs. Planmine SMEST
Match: SMESG000012868.1 (SMESG000012868.1)

HSP 1 Score: 518.079 bits (1333), Expect = 0.000e+0
Identity = 241/351 (68.66%), Postives = 289/351 (82.34%), Query Frame = 3
Query:   27 MANKSSKEIIRGVEFDVGPRYGNFKFIGEGAYGQVVSAIDTKDNSNVAIKRTSPFEHQTYCQRTYREIKILMHFNHENIIDIRNLLTAKEMIE-MKDLYIVQALMETDLHKLCKSQKLSLEHICYFLYQILRGLKYIHSANVIHRDLKPSNLLVNSNCDLKICDFGLSRVNDPEHDHKGILTEYVATRWYRAPEIMLNSKGYTKAIDIWSVGCILAEMLNGKPIFPGKHYVEQLTLIITVLGYPCEEDKAWIVNEKARHFVEKFVTKMKTPWKQLYPNADEQCITMLEGLLTFNPGKRLTVEQALAMPYLNQYYEPTDEPVASTPFTFEHELDDLPIEKLREMIWERVKYF 1076
            MA  ++ +I R   F VG RY N +FIGEGAYG VVSA D   + +VAIKR SPFEHQT+CQRTYREIKIL+HF HEN+IDI+NLLT    IE +KD+YIVQ+LM+TD++KL K QKLS EHICYFLYQILRG+KYIHSANV+HRDLKPSNLLVNSNCDLKICDFGL+RVNDP  DH G+LTEYVATRWYRAPE+MLNSKGY+KA+D+WS+GCILAEML  KP+FPGKHYV+QL LI  VLG P  EDK+WIVNEKAR+FVEK +   K PW++L+PN++  C+ +L+ LL FNP KRLT ++AL  PYL QYYEPTDEP + +PF  EHELD+L +  L++MIWE+V  +
Sbjct:    1 MAEDATVQIFRNQPFYVGSRYTNLRFIGEGAYGIVVSATDNVTHEDVAIKRISPFEHQTFCQRTYREIKILLHFKHENVIDIKNLLTPASKIEDIKDIYIVQSLMDTDMYKLIKDQKLSNEHICYFLYQILRGVKYIHSANVLHRDLKPSNLLVNSNCDLKICDFGLARVNDPVQDHNGMLTEYVATRWYRAPEVMLNSKGYSKAMDMWSIGCILAEMLGCKPLFPGKHYVQQLKLIFDVLGSPDYEDKSWIVNEKARNFVEKLIDIPKRPWEELFPNSEPFCLDILDQLLAFNPSKRLTADKALQHPYLQQYYEPTDEPESDSPFNSEHELDNLSLNTLKQMIWEQVSSY 351          
BLAST of Mitogen-activated protein kinase vs. Planmine SMEST
Match: SMESG000001435.1 (SMESG000001435.1)

HSP 1 Score: 475.322 bits (1222), Expect = 4.911e-168
Identity = 224/323 (69.35%), Postives = 262/323 (81.11%), Query Frame = 3
Query:   48 EIIRGVEFDVGPRYGNFKFIGEGAYGQVVSAIDTKDNSNVAIKRTSPFEHQTYCQRTYREIKILMHFNHENIIDIRNLLTAKEMIEMKDLYIVQALMETDLHKLCKSQKLSLEHICYFLYQILRGLKYIHSANVIHRDLKPSNLLVNSNCDLKICDFGLSRVNDPEHDHKGILTEYVATRWYRAPEIMLNSKGYTKAIDIWSVGCILAEMLNGKPIFPGKHYVEQLTLIITVLGYPCEEDKAWIVNEKARHFVEKFVTKMKTPWKQLYPNADEQCITMLEGLLTFNPGKRLTVEQALAMPYLNQYYEPTDEPVASTPFTFEHE 1016
            E+I+G  F+V PRY +  +IGEGAYG V SA D      VAIK+ SPFE+QTYCQRT REIKIL  F HENIIDIR+++TA  + EMKD+YIVQ LMETDL KL K+Q+LS +H CYFLYQILRGLKYIHSANV+HRDLKPSNLL+N+ CDLKICDFGL+RV DPEHDH G+LTEYVATRWYRAPEIMLNSKGYTK+IDIWSVGCILAEMLN KP+FPGKHY++QL LI+ VLG P +ED   IVN KAR ++++   K K  WK LYPNAD+Q + ++E LLTFNP  R+ VE ALA PYL QYY+P DEPVA+ PFT + E
Sbjct:    6 EVIKGQAFEVKPRYIDLNYIGEGAYGMVASAYDNIKKEKVAIKKISPFEYQTYCQRTLREIKILTRFKHENIIDIRDIITANSINEMKDVYIVQCLMETDLFKLLKTQQLSNDHTCYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPEHDHTGLLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLNNKPLFPGKHYIDQLNLILGVLGSPNQEDLDSIVNLKARGYLQQLPYKPKVSWKSLYPNADDQALDLIEKLLTFNPVNRIGVEDALAHPYLKQYYDPADEPVAAKPFTNDLE 328          
BLAST of Mitogen-activated protein kinase vs. Planmine SMEST
Match: SMESG000075533.1 (SMESG000075533.1)

HSP 1 Score: 282.722 bits (722), Expect = 6.007e-92
Identity = 150/355 (42.25%), Postives = 217/355 (61.13%), Query Frame = 3
Query:   27 MANKSSKEIIRGVEFDVGPRYGNFKFIGEGAYGQVVSAIDTKDNSNVAIKRTS-PFEHQTYCQRTYREIKILMHFNHENIIDIRNLLTAKEMIE-MKDLYIVQALMETDLHKLCKSQKLSLEHICYFLYQILRGLKYIHSANVIHRDLKPSNLLVNSNCDLKICDFGLSRVNDPEHDHKGILTEYVATRWYRAPEIMLNSKGYTKAIDIWSVGCILAEMLNGKPIFPGKHYVEQLTLIITVLGYPCEEDKAWIVNEKARHFV-EKFVTKMKTPWKQLY--PNADEQCITMLEGLLTFNPGKRLTVEQALAMPYLNQYYEPTDEPVASTPFTFEHELDDLPIEKLREMIWERVKYF 1076
            MA +     I   ++ V  RY N   IG GAYG V +A D K    VAIK+ + PF    Y +RTYRE+KI+ H +HENI+ + +  T +   E   D+Y++  LM  DL+ + ++Q+L  EH+ + +YQILRGLKY+HS+ +IHRDLKPSN+ VN +C+LKI DFGL+R  D E      +T YVATRWYRAPEIML+   YT  +DIWSVGCI+AE+   KP+FPG  +++QL  I+ + G P +E    IV+E AR F+ EK  T  +  +   +     DE  I +L+ +L  +P +R++ + ALA PYL  Y++  DEP A           D+ +E  ++ +W+ ++ F
Sbjct:    1 MAAEFQLHNIAHSDWTVPTRYENLNPIGHGAYGSVCAAFDHKLQRQVAIKKLARPFHSPEYAKRTYRELKIIHHMDHENIVCLIDAYTPQSTRESFSDVYLITPLMGADLNAIIRTQELLNEHVQFLVYQILRGLKYMHSSEIIHRDLKPSNIAVNEDCELKILDFGLARQTDEE------MTGYVATRWYRAPEIMLSWMHYTNRVDIWSVGCIMAELFTRKPLFPGNDHIDQLKKIMELAGTPDKEFMNKIVSEDARAFIREKIQTSPRKDFNSFFWQYTKDENAIDLLDRMLVLDPDRRISAKDALAHPYLADYHDEHDEPTAPLFVDVMEGKTDVDLETWKDTVWDFIQNF 349          
BLAST of Mitogen-activated protein kinase vs. Planmine SMEST
Match: SMESG000075533.1 (SMESG000075533.1)

HSP 1 Score: 281.952 bits (720), Expect = 2.258e-91
Identity = 151/360 (41.94%), Postives = 220/360 (61.11%), Query Frame = 3
Query:   12 SYML*MANKSSKEIIRGVEFDVGPRYGNFKFIGEGAYGQVVSAIDTKDNSNVAIKRTS-PFEHQTYCQRTYREIKILMHFNHENIIDIRNLLTAKEMIE-MKDLYIVQALMETDLHKLCKSQKLSLEHICYFLYQILRGLKYIHSANVIHRDLKPSNLLVNSNCDLKICDFGLSRVNDPEHDHKGILTEYVATRWYRAPEIMLNSKGYTKAIDIWSVGCILAEMLNGKPIFPGKHYVEQLTLIITVLGYPCEEDKAWIVNEKARHFV-EKFVTKMKTPWKQLY--PNADEQCITMLEGLLTFNPGKRLTVEQALAMPYLNQYYEPTDEPVASTPFTFEHELDDLPIEKLREMIWERVKYF 1076
            S++  MA +     I   ++ V  RY N   IG GAYG V +A D K    VAIK+ + PF    Y +RTYRE+KI+ H +HENI+ + +  T +   E   D+Y++  LM  DL+ + ++Q+L  EH+ + +YQILRGLKY+HS+ +IHRDLKPSN+ VN +C+LKI DFGL+R  D E      +T YVATRWYRAPEIML+   YT  +DIWSVGCI+AE+   KP+FPG  +++QL  I+ + G P +E    IV+E AR F+ EK  T  +  +   +     DE  I +L+ +L  +P +R++ + ALA PYL  Y++  DEP A           D+ +E  ++ +W+ ++ F
Sbjct:   20 SHLDNMAAEFQLHNIAHSDWTVPTRYENLNPIGHGAYGSVCAAFDHKLQRQVAIKKLARPFHSPEYAKRTYRELKIIHHMDHENIVCLIDAYTPQSTRESFSDVYLITPLMGADLNAIIRTQELLNEHVQFLVYQILRGLKYMHSSEIIHRDLKPSNIAVNEDCELKILDFGLARQTDEE------MTGYVATRWYRAPEIMLSWMHYTNRVDIWSVGCIMAELFTRKPLFPGNDHIDQLKKIMELAGTPDKEFMNKIVSEDARAFIREKIQTSPRKDFNSFFWQYTKDENAIDLLDRMLVLDPDRRISAKDALAHPYLADYHDEHDEPTAPLFVDVMEGKTDVDLETWKDTVWDFIQNF 373          
The following BLAST results are available for this feature:
BLAST of Mitogen-activated protein kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MAPK37.313e-17565.70mitogen-activated protein kinase 3 [Source:HGNC Sy... [more]
MAPK11.333e-17466.86mitogen-activated protein kinase 1 [Source:HGNC Sy... [more]
MAPK11.333e-17466.86mitogen-activated protein kinase 1 [Source:HGNC Sy... [more]
MAPK31.994e-16066.25mitogen-activated protein kinase 3 [Source:HGNC Sy... [more]
MAPK33.917e-15261.05mitogen-activated protein kinase 3 [Source:HGNC Sy... [more]
back to top
BLAST of Mitogen-activated protein kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mpk-18.495e-16363.61Mitogen-activated protein kinase mpk-1 [Source:Un... [more]
mpk-16.227e-16263.61Mitogen-activated protein kinase mpk-1 [Source:Un... [more]
pmk-14.301e-9644.97Mitogen-activated protein kinase pmk-1 [Source:Un... [more]
pmk-22.524e-8842.81Mitogen-activated protein kinase pmk-2 [Source:Un... [more]
pmk-22.782e-8642.18Mitogen-activated protein kinase pmk-2 [Source:Un... [more]
back to top
BLAST of Mitogen-activated protein kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rl1.026e-17065.04gene:FBgn0003256 transcript:FBtr0113703[more]
rl1.026e-17065.04gene:FBgn0003256 transcript:FBtr0113702[more]
rl1.026e-17065.04gene:FBgn0003256 transcript:FBtr0345337[more]
rl1.026e-17065.04gene:FBgn0003256 transcript:FBtr0113700[more]
rl1.292e-15465.09gene:FBgn0003256 transcript:FBtr0329919[more]
back to top
BLAST of Mitogen-activated protein kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mapk33.474e-17565.71mitogen-activated protein kinase 3 [Source:ZFIN;Ac... [more]
mapk11.348e-17465.99mitogen-activated protein kinase 1 [Source:ZFIN;Ac... [more]
mapk11.348e-17465.99mitogen-activated protein kinase 1 [Source:ZFIN;Ac... [more]
mapk11.348e-17465.99mitogen-activated protein kinase 1 [Source:ZFIN;Ac... [more]
mapk72.413e-10048.10mitogen-activated protein kinase 7 [Source:ZFIN;Ac... [more]
back to top
BLAST of Mitogen-activated protein kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cdknx3.464e-17466.47cyclin-dependent kinase inhibitor xic1 [Source:Xen... [more]
cdknx4.760e-17466.86cyclin-dependent kinase inhibitor xic1 [Source:Xen... [more]
cdknx4.794e-17466.86cyclin-dependent kinase inhibitor xic1 [Source:Xen... [more]
cdknx8.305e-17466.86cyclin-dependent kinase inhibitor xic1 [Source:Xen... [more]
pde6a7.652e-10145.86phosphodiesterase 6A [Source:Xenbase;Acc:XB-GENE-9... [more]
back to top
BLAST of Mitogen-activated protein kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mapk15.810e-17566.86mitogen-activated protein kinase 1 [Source:MGI Sym... [more]
Mapk15.810e-17566.86mitogen-activated protein kinase 1 [Source:MGI Sym... [more]
Mapk15.810e-17566.86mitogen-activated protein kinase 1 [Source:MGI Sym... [more]
Mapk37.650e-17465.98mitogen-activated protein kinase 3 [Source:MGI Sym... [more]
Mapk38.780e-15966.56mitogen-activated protein kinase 3 [Source:MGI Sym... [more]
back to top
BLAST of Mitogen-activated protein kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P27361|MK03_HUMAN3.512e-17465.70Mitogen-activated protein kinase 3 OS=Homo sapiens... [more]
sp|P46196|MK01_BOVIN3.872e-17467.15Mitogen-activated protein kinase 1 OS=Bos taurus O... [more]
sp|P63086|MK01_RAT4.064e-17466.86Mitogen-activated protein kinase 1 OS=Rattus norve... [more]
sp|P63085|MK01_MOUSE4.064e-17466.86Mitogen-activated protein kinase 1 OS=Mus musculus... [more]
sp|P28482|MK01_HUMAN6.401e-17466.86Mitogen-activated protein kinase 1 OS=Homo sapiens... [more]
back to top
BLAST of Mitogen-activated protein kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A075AJ200.000e+069.80Mitogen-activated protein kinase OS=Opisthorchis v... [more]
A0A4S2M0F30.000e+070.52Mitogen-activated protein kinase OS=Opisthorchis f... [more]
A0A419Q8I20.000e+070.67Mitogen-activated protein kinase OS=Clonorchis sin... [more]
K9LM342.948e-17968.68Mitogen-activated protein kinase OS=Penaeus vannam... [more]
G8Z9H62.948e-17968.68Mitogen-activated protein kinase OS=Penaeus monodo... [more]
back to top
BLAST of Mitogen-activated protein kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mapk31.562e-17565.71mitogen-activated protein kinase 1 [Source:NCBI ge... [more]
mapk15.466e-17566.57mitogen-activated protein kinase 1 [Source:NCBI ge... [more]
mapk12.465e-15967.85mitogen-activated protein kinase 1 [Source:NCBI ge... [more]
mapk13.812e-15261.34mitogen-activated protein kinase 1 [Source:NCBI ge... [more]
mapk73.121e-9849.57mitogen-activated protein kinase 7 [Source:NCBI ge... [more]
back to top
BLAST of Mitogen-activated protein kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mapk18.128e-17565.70mitogen-activated protein kinase 1 [Source:ZFIN;Ac... [more]
mapk14a1.026e-9342.98mitogen-activated protein kinase 14a [Source:NCBI ... [more]
mapk12a2.710e-8640.95mitogen-activated protein kinase 12a [Source:NCBI ... [more]
MAPK63.873e-8343.79mitogen-activated protein kinase 6 [Source:HGNC Sy... [more]
mapk154.832e-7943.37mitogen-activated protein kinase 15 [Source:ZFIN;A... [more]
back to top
BLAST of Mitogen-activated protein kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
FUS34.204e-10545.67Mitogen-activated serine/threonine protein kinase ... [more]
HOG12.273e-10444.10Mitogen-activated protein kinase involved in osmor... [more]
KSS16.021e-10445.60Mitogen-activated protein kinase (MAPK); involved ... [more]
SLT21.288e-9946.81Serine/threonine MAP kinase; coordinates expressio... [more]
SMK12.142e-7541.69Middle sporulation-specific mitogen-activated prot... [more]
back to top
BLAST of Mitogen-activated protein kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO374352.684e-17366.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO405732.211e-10345.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO468814.346e-9744.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO456934.052e-8741.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO394216.371e-7742.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Mitogen-activated protein kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mapk34.195e-17666.48mitogen-activated protein kinase 1 [Source:NCBI ge... [more]
mapk11.368e-17466.86mitogen-activated protein kinase 1 [Source:NCBI ge... [more]
mapk71.257e-10048.98mitogen-activated protein kinase 7 [Source:NCBI ge... [more]
mapk73.252e-10048.98mitogen-activated protein kinase 7 [Source:NCBI ge... [more]
mapk14b1.184e-9744.97mitogen-activated protein kinase 14A [Source:NCBI ... [more]
back to top
BLAST of Mitogen-activated protein kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000032743.10.000e+0100.00SMESG000032743.1[more]
SMESG000012868.10.000e+068.66SMESG000012868.1[more]
SMESG000001435.14.911e-16869.35SMESG000001435.1[more]
SMESG000075533.16.007e-9242.25SMESG000075533.1[more]
SMESG000075533.12.258e-9141.94SMESG000075533.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024295 ID=SMED30024295|Name=Mitogen-activated protein kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=1315bp
ATCTATATAAATCTTATATGCTTTGAATGGCAAACAAATCTTCCAAAGAA
ATTATACGAGGGGTTGAATTTGACGTAGGTCCTCGTTATGGAAATTTTAA
ATTTATTGGCGAAGGAGCTTACGGCCAAGTTGTGTCAGCTATTGATACTA
AAGACAATTCCAACGTAGCAATTAAGCGCACGTCCCCCTTCGAGCATCAG
ACATACTGTCAAAGAACTTACCGAGAAATAAAAATTTTGATGCATTTTAA
TCACGAAAATATAATAGATATTAGAAACCTTTTGACAGCGAAAGAAATGA
TTGAAATGAAAGATTTATATATAGTTCAGGCATTAATGGAAACCGATTTA
CACAAGTTGTGCAAGAGCCAGAAATTAAGTCTAGAGCACATTTGCTACTT
TCTCTATCAGATTTTGAGAGGCCTCAAATACATCCACTCGGCCAATGTCA
TCCACCGGGACCTGAAGCCCTCCAATCTGCTTGTCAATTCCAATTGCGAT
CTAAAGATCTGCGATTTCGGCCTGTCACGAGTCAATGACCCTGAGCACGA
CCACAAGGGCATCCTGACCGAGTACGTTGCCACCCGATGGTACCGCGCAC
CAGAGATTATGCTCAATTCCAAGGGATATACCAAGGCCATCGACATTTGG
AGTGTCGGTTGCATCCTCGCGGAAATGCTCAATGGCAAGCCGATTTTCCC
TGGGAAGCATTATGTTGAACAGCTGACTCTGATCATCACAGTTCTTGGCT
ACCCATGTGAGGAAGACAAGGCGTGGATTGTAAATGAAAAGGCTCGCCAT
TTCGTCGAGAAGTTCGTCACGAAAATGAAAACTCCCTGGAAACAGCTCTA
TCCGAATGCAGACGAGCAATGCATCACCATGCTGGAGGGCCTGTTGACAT
TCAATCCCGGCAAGCGGCTCACCGTCGAGCAGGCGCTCGCCATGCCTTAT
CTCAATCAATATTACGAGCCGACGGACGAACCGGTTGCCAGCACTCCGTT
TACATTTGAGCACGAACTCGACGACCTTCCAATCGAAAAGTTGCGGGAAA
TGATCTGGGAGCGCGTTAAATATTTCCGGCAAATCGAGGGCTAACAATAT
CGTGCTGTCGGTGCACGCGCATCTGTTCTCGTTCGTGTGCTTCCATGACA
ACGCACTGCTACTGTTGCCGCTACCGCTTCTCGCCCAGATTGCAAATACA
AGATATATCTGCCTTGACTTTTTGATTCTGATGCTGTGTGTGTGTGTGTA
TGTGTGCGACAGTGACAGTGACAGTAATGAGTGCTGTAATGTACTGGAAT
GTGTAATGATTTGTC
back to top

protein sequence of SMED30024295-orf-1

>SMED30024295-orf-1 ID=SMED30024295-orf-1|Name=SMED30024295-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=263bp
QIITHSSTLQHSLLSLSLSHTYTHTHSIRIKKSRQIYLVFAIWARSGSGN
SSSALSWKHTNENRCACTDSTILLALDLPEIFNALPDHFPQLFDWKVVEF
VLKCKRSAGNRFVRRLVILIEIRHGERLLDGEPLAGIECQQALQHGDALL
VCIRIELFPGSFHFRDELLDEMASLFIYNPRLVFLTWVAKNCDDQSQLFN
IMLPRENRLAIEHFREDATDTPNVDGLGISLGIEHNLWCAVPSGGNVLGQ
DALVVVLRVIDS*
back to top

protein sequence of SMED30024295-orf-2

>SMED30024295-orf-2 ID=SMED30024295-orf-2|Name=SMED30024295-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=356bp
MANKSSKEIIRGVEFDVGPRYGNFKFIGEGAYGQVVSAIDTKDNSNVAIK
RTSPFEHQTYCQRTYREIKILMHFNHENIIDIRNLLTAKEMIEMKDLYIV
QALMETDLHKLCKSQKLSLEHICYFLYQILRGLKYIHSANVIHRDLKPSN
LLVNSNCDLKICDFGLSRVNDPEHDHKGILTEYVATRWYRAPEIMLNSKG
YTKAIDIWSVGCILAEMLNGKPIFPGKHYVEQLTLIITVLGYPCEEDKAW
IVNEKARHFVEKFVTKMKTPWKQLYPNADEQCITMLEGLLTFNPGKRLTV
EQALAMPYLNQYYEPTDEPVASTPFTFEHELDDLPIEKLREMIWERVKYF
RQIEG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR008349MAPK_ERK1/2
IPR000719Prot_kinase_dom
IPR017441Protein_kinase_ATP_BS
IPR008271Ser/Thr_kinase_AS
IPR003527MAP_kinase_CS
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0004707MAP kinase activity
GO:0005524ATP binding
GO:0004672protein kinase activity
GO:0000166nucleotide binding
GO:0004674protein serine/threonine kinase activity
GO:0016301kinase activity
GO:0016740transferase activity
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0000165MAPK cascade
GO:0016310phosphorylation
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR008349Mitogen-activated protein (MAP) kinase, ERK1/2PRINTSPR01770ERK1ERK2MAPKcoord: 169..179
score: 62.12
coord: 248..258
score: 46.21
coord: 309..319
score: 75.0
coord: 114..123
score: 61.67
coord: 227..238
score: 51.39
coord: 9..26
score: 49.54
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 21..309
e-value: 4.3E-88
score: 308.6
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 23..309
e-value: 1.3E-67
score: 227.9
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 21..309
score: 45.064
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 104..334
e-value: 5.6E-146
score: 487.6
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 15..346
e-value: 5.6E-146
score: 487.6
NoneNo IPR availablePIRSFPIRSF000654ILKcoord: 4..239
e-value: 8.1E-23
score: 78.4
NoneNo IPR availablePANTHERPTHR24055:SF203MITOGEN-ACTIVATED PROTEIN KINASE 1coord: 6..350
NoneNo IPR availablePANTHERPTHR24055MITOGEN-ACTIVATED PROTEIN KINASEcoord: 6..350
NoneNo IPR availableCDDcd07849STKc_ERK1_2_likecoord: 15..347
e-value: 0.0
score: 580.8
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 27..50
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 141..153
IPR003527Mitogen-activated protein (MAP) kinase, conserved sitePROSITEPS01351MAPKcoord: 55..157
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 16..318