SMED30024291

Overview
NameSMED30024291
Smed IDSMED30024291
Length (bp)1901
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30024291 (SMED30024291) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30024291 (SMED30024291) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30024291 (SMED30024291) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30024291 (SMED30024291) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30024291

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30024291SMESG000064314.1 SmedASXL_017257SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30024291SMESG000064314.1 dd_Smed_v4_9830_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30024291SMESG000064314.1 dd_Smed_v4_9830_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30024291SMESG000064314.1 dd_Smed_v4_9830_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30024291SMESG000064314.1 dd_Smed_v4_9830_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30024291SMESG000064314.1 dd_Smed_v4_9830_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30024291SMESG000064314.1 dd_Smed_v4_9830_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30024291SMESG000064314.1 Contig53784uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30024291SMESG000064314.1 Contig53784newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30024291SMESG000064303.1 SMESG000064314.1 Contig19558uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30024291SMESG000064303.1 SMESG000064314.1 Contig19558newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30024291SMESG000064314.1 dd_Smed_v6_9830_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30024291SMESG000064314.1 Contig53784uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30024291SMESG000064314.1 Contig53784newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30024291 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000055:298044..312244 -9450
v31.000055:309724..312610 -2077
Homology
BLAST of SMED30024291 vs. Ensembl Fly
Match: futsch (gene:FBgn0259108 transcript:FBtr0307597)

HSP 1 Score: 55.8398 bits (133), Expect = 1.197e-7
Identity = 52/183 (28.42%), Postives = 81/183 (44.26%), Query Frame = 2
Query: 1169 QWSEPLGLPMPV-MP--------DTPS--RKQVGKSDGPPTRPNSILTPKSKETPENTQG-----YYLDIAYVPVDITGNVDSSRVSDRFFSKVRANCYILPGLEHDAKVLNSIIIGKSKWNNKDKQMKTHIIVMNNTSELKKWLLENAVKLSELNIHFDITTEQENGLTNVCKHIYSVK*FR 1669
            +W +PLGLP P  +P         TP   R+ V       TR N+    + +    N  G      Y+D+ YVP +  GN   + V   FF +VRA  Y+  G E   +V ++++  K  W   DK+++  II   +T  L  W+ EN   L++  I  D++        N+  H  S   +R
Sbjct: 5322 EWGKPLGLPSPAPLPVEGGADIRTTPKKERRLVATK----TRLNNEKNLRRRSESPNKAGKKPAPVYVDLTYVPHN--GNSYYAHVD--FFKRVRARYYVFSGTEPSRQVYDALLEAKQTWE--DKELEVTIIPTYDTDVLGYWVAENEELLAKHRI--DLSPSASRCTINLQDHETSCSAYR 5492          
BLAST of SMED30024291 vs. Ensembl Fly
Match: futsch (gene:FBgn0259108 transcript:FBtr0307598)

HSP 1 Score: 55.8398 bits (133), Expect = 1.197e-7
Identity = 52/183 (28.42%), Postives = 81/183 (44.26%), Query Frame = 2
Query: 1169 QWSEPLGLPMPV-MP--------DTPS--RKQVGKSDGPPTRPNSILTPKSKETPENTQG-----YYLDIAYVPVDITGNVDSSRVSDRFFSKVRANCYILPGLEHDAKVLNSIIIGKSKWNNKDKQMKTHIIVMNNTSELKKWLLENAVKLSELNIHFDITTEQENGLTNVCKHIYSVK*FR 1669
            +W +PLGLP P  +P         TP   R+ V       TR N+    + +    N  G      Y+D+ YVP +  GN   + V   FF +VRA  Y+  G E   +V ++++  K  W   DK+++  II   +T  L  W+ EN   L++  I  D++        N+  H  S   +R
Sbjct: 5322 EWGKPLGLPSPAPLPVEGGADIRTTPKKERRLVATK----TRLNNEKNLRRRSESPNKAGKKPAPVYVDLTYVPHN--GNSYYAHVD--FFKRVRARYYVFSGTEPSRQVYDALLEAKQTWE--DKELEVTIIPTYDTDVLGYWVAENEELLAKHRI--DLSPSASRCTINLQDHETSCSAYR 5492          
BLAST of SMED30024291 vs. Ensembl Fly
Match: futsch (gene:FBgn0259108 transcript:FBtr0112628)

HSP 1 Score: 55.8398 bits (133), Expect = 1.197e-7
Identity = 52/183 (28.42%), Postives = 81/183 (44.26%), Query Frame = 2
Query: 1169 QWSEPLGLPMPV-MP--------DTPS--RKQVGKSDGPPTRPNSILTPKSKETPENTQG-----YYLDIAYVPVDITGNVDSSRVSDRFFSKVRANCYILPGLEHDAKVLNSIIIGKSKWNNKDKQMKTHIIVMNNTSELKKWLLENAVKLSELNIHFDITTEQENGLTNVCKHIYSVK*FR 1669
            +W +PLGLP P  +P         TP   R+ V       TR N+    + +    N  G      Y+D+ YVP +  GN   + V   FF +VRA  Y+  G E   +V ++++  K  W   DK+++  II   +T  L  W+ EN   L++  I  D++        N+  H  S   +R
Sbjct: 5322 EWGKPLGLPSPAPLPVEGGADIRTTPKKERRLVATK----TRLNNEKNLRRRSESPNKAGKKPAPVYVDLTYVPHN--GNSYYAHVD--FFKRVRARYYVFSGTEPSRQVYDALLEAKQTWE--DKELEVTIIPTYDTDVLGYWVAENEELLAKHRI--DLSPSASRCTINLQDHETSCSAYR 5492          
BLAST of SMED30024291 vs. Ensembl Zebrafish
Match: map1b (microtubule-associated protein 1B [Source:ZFIN;Acc:ZDB-GENE-130530-690])

HSP 1 Score: 53.1434 bits (126), Expect = 1.058e-6
Identity = 28/101 (27.72%), Postives = 55/101 (54.46%), Query Frame = 2
Query: 1304 NTQGYYLDIAYVPVDITGNVDSSRVSDRFFSKVRANCYILPGLEHDAK-----VLNSIIIGKSKWNNKDKQMKTHIIVMNNTSELKKWLLENAVKLSELNI 1591
            N    Y+D+ Y+P     + ++  V   FF ++R++ Y++ G +  A+     VL++++ GKS+W N    M+  +I  ++T  +++W  E   K  +LNI
Sbjct: 1917 NCPTMYMDLVYIP----NHCNAKNVDAEFFKRIRSSYYVVSGNDPTAQEPSKAVLDALLEGKSQWGN---NMQVTLIPTHDTEVMREWYQETHEKQQDLNI 2010          
BLAST of SMED30024291 vs. Ensembl Zebrafish
Match: map1b (microtubule-associated protein 1B [Source:ZFIN;Acc:ZDB-GENE-130530-690])

HSP 1 Score: 53.1434 bits (126), Expect = 1.058e-6
Identity = 28/101 (27.72%), Postives = 55/101 (54.46%), Query Frame = 2
Query: 1304 NTQGYYLDIAYVPVDITGNVDSSRVSDRFFSKVRANCYILPGLEHDAK-----VLNSIIIGKSKWNNKDKQMKTHIIVMNNTSELKKWLLENAVKLSELNI 1591
            N    Y+D+ Y+P     + ++  V   FF ++R++ Y++ G +  A+     VL++++ GKS+W N    M+  +I  ++T  +++W  E   K  +LNI
Sbjct: 1917 NCPTMYMDLVYIP----NHCNAKNVDAEFFKRIRSSYYVVSGNDPTAQEPSKAVLDALLEGKSQWGN---NMQVTLIPTHDTEVMREWYQETHEKQQDLNI 2010          
BLAST of SMED30024291 vs. UniProt/SwissProt
Match: sp|Q9W596|FUTSC_DROME (Microtubule-associated protein futsch OS=Drosophila melanogaster OX=7227 GN=futsch PE=1 SV=4)

HSP 1 Score: 55.8398 bits (133), Expect = 1.200e-6
Identity = 52/183 (28.42%), Postives = 81/183 (44.26%), Query Frame = 2
Query: 1169 QWSEPLGLPMPV-MP--------DTPS--RKQVGKSDGPPTRPNSILTPKSKETPENTQG-----YYLDIAYVPVDITGNVDSSRVSDRFFSKVRANCYILPGLEHDAKVLNSIIIGKSKWNNKDKQMKTHIIVMNNTSELKKWLLENAVKLSELNIHFDITTEQENGLTNVCKHIYSVK*FR 1669
            +W +PLGLP P  +P         TP   R+ V       TR N+    + +    N  G      Y+D+ YVP +  GN   + V   FF +VRA  Y+  G E   +V ++++  K  W   DK+++  II   +T  L  W+ EN   L++  I  D++        N+  H  S   +R
Sbjct: 5322 EWGKPLGLPSPAPLPVEGGADIRTTPKKERRLVATK----TRLNNEKNLRRRSESPNKAGKKPAPVYVDLTYVPHN--GNSYYAHVD--FFKRVRARYYVFSGTEPSRQVYDALLEAKQTWE--DKELEVTIIPTYDTDVLGYWVAENEELLAKHRI--DLSPSASRCTINLQDHETSCSAYR 5492          
BLAST of SMED30024291 vs. TrEMBL
Match: A0A553NNJ2 (Uncharacterized protein OS=Tigriopus californicus OX=6832 GN=TCAL_02317 PE=4 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 9.954e-14
Identity = 60/197 (30.46%), Postives = 95/197 (48.22%), Query Frame = 2
Query: 1079 ESSKEEIASDEDWIKVDEESTEKTNSNKNVQWSEPLGLPMPVMPDTPSRKQVGKSDGPPTRPNSILTPKSKETPENTQGYYLDIAYVPVDITGNVDSSRVSDRFFSKVRANCYILPGLEHDAKVLNSIIIGKSKWNNKDKQMKTHIIVMNNTSELKKWLLENAVKLSELNIHFDITTEQENGLTNVCKHIYSVK*FR 1669
            ESS    +S + ++  +EE  EK    K   W +PLGLP P+ P +P  K     +  P++P    + K +    +    Y+D+AYVP    GNV  S +   FF +VRA  Y+  G+E   +V ++++  K +W +KD  M+  II   ++  L  W+  N   L+EL  H D+         N+  H  S   +R
Sbjct:  568 ESSATTQSSAQTFVTTNEEEIEK----KLESWGKPLGLPSPIRPSSP--KGASNPNPEPSKPKESRS-KRQARSSDPAPVYMDLAYVPHH--GNVLYSDI--EFFKRVRARYYVFSGVEPSREVFDALLAAKKEWEDKD--MEVTIIPTYDSDTLGYWVAANEEALAEL--HIDLAPSASRCTINLQDHETSCAAYR 749          
BLAST of SMED30024291 vs. TrEMBL
Match: A0A162Q0D6 (Uncharacterized protein OS=Daphnia magna OX=35525 GN=APZ42_014122 PE=4 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 4.659e-10
Identity = 51/177 (28.81%), Postives = 76/177 (42.94%), Query Frame = 2
Query: 1166 VQWSEPLGLPMPVMPDTPSRKQVGKSDGPPTRPNSILTPKSKETPENTQG---------YYLDIAYVPVDITGNVDSSRVSDRFFSKVRANCYILPGLEHDAKVLNSIIIGKSKWNNKDKQMKTHIIVMNNTSELKKWLLENAVKLSELNIHFDITTEQENGLTNVCKHIYSVK*FR 1669
              W +PLGLP PV P        G +  P  RP +     +K   + T G         +Y+D+AY+P     + D       FF +VRA  Y+L  LE  A+VL++++ GK  W   DK +   II   ++  L  W+  N   L+   I  D+         N+  H  S   +R
Sbjct:  638 ASWGKPLGLPAPVAPGVVFSSN-GTNGSPLKRPTTASNNANKSAEKATNGTNAMMGATPFYVDLAYIP----HHSDPQYSDVEFFKRVRARHYVLSTLEPSAQVLDALLEGKQSWTGDDKDLDVTIIPTYDSDALAVWVSANEDVLARNRI--DLAPSASRCTINLQDHETSCSAYR 807          
BLAST of SMED30024291 vs. TrEMBL
Match: A0A4E0RIX9 (Putative microtubule-associated protein OS=Fasciola hepatica OX=6192 GN=D915_001813 PE=4 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 2.950e-9
Identity = 47/166 (28.31%), Postives = 76/166 (45.78%), Query Frame = 2
Query: 1166 VQWSEPLGLPMPVMPDTPSRKQVGKS------------DGPPTRPNSILTPKSKETP--ENTQGYYLDIAYVPVDITGNVDSSRVSDRFFSKVRANCYI----LPGLEHDAKVLNSIIIGKSKWNNKDKQMKTHIIVMNNTSELKKWLLENAVKLSELNIHFDITT 1609
            + W EP GLP+P  P   SR+Q   S             G     +  + P S + P  +  +  Y+D+A++P    G  +   V   +F +VRA  Y+    LPG    A ++ ++ +GK  W   D Q+   +I+  +T EL  WL  NA +L+    H ++T 
Sbjct:  224 IAWGEPQGLPVP--PPAASRRQTSLSVPANAKTVPIQQAGYTDASSHAVGPGSTKLPPYDKIKPVYVDVAFLP----GGGNPHLVDAEWFKRVRARYYVATDPLPG----AALMEALTVGKESWTGDDAQLSASLIIAYDTEELMIWLGRNAGRLAA--CHLELTA 377          
BLAST of SMED30024291 vs. TrEMBL
Match: E9GAY0 (Uncharacterized protein OS=Daphnia pulex OX=6669 GN=DAPPUDRAFT_100635 PE=4 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 3.231e-9
Identity = 50/175 (28.57%), Postives = 76/175 (43.43%), Query Frame = 2
Query: 1172 WSEPLGLPMPVMPDTPSRKQVGKSDGPPTRPNSILTPKSKET--------PENTQGYYLDIAYVPVDITGNVDSSRVSD-RFFSKVRANCYILPGLEHDAKVLNSIIIGKSKWNNKDKQMKTHIIVMNNTSELKKWLLENAVKLSELNIHFDITTEQENGLTNVCKHIYSVK*FR 1669
            W +PLGLP PV P        G +  P  RP +      K +           +  +Y+D+AY+P     +    R SD  FF ++RA  Y+L  LE  A+VL++++ GK  W   DK +   II   ++  L  W+  N   L+   I  D+         N+  H  S   +R
Sbjct: 3228 WGKPLGLPAPVAPGVVFSSN-GSNGSPLKRPATATNNGHKASDKAANGANNAASAPFYVDLAYIP-----HHSDPRYSDVDFFKRIRARHYVLSTLEPSAQVLDALLEGKQSWTGDDKDLDVTIIPTYDSDALATWVSANEDLLARNRI--DLAPSASRCTINLQDHETSCSAYR 3394          
BLAST of SMED30024291 vs. TrEMBL
Match: A0A5E4QF97 (Uncharacterized protein OS=Leptidea sinapis OX=189913 GN=LSINAPIS_LOCUS7565 PE=4 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 1.057e-8
Identity = 56/190 (29.47%), Postives = 86/190 (45.26%), Query Frame = 2
Query: 1139 TEKTNSNKNVQWSEPLGLPMPVMP-------DTPSRKQVGKSDGPPTRPNSILTPKSKETPEN-----TQG-YYLDIAYVPVDITGNVDSSRVSDRFFSKVRANCYILPGLEHDAKVLNSIIIGKSKWNNKDKQMKTHIIVMNNTSELKKWLLENAVKLSELNIHFDITTEQENGLTNVCKHIYSVK*FR 1669
            T +T S+    W +PLGLP P++P        TP R     +     R N   + ++K T E+     TQ   Y+D+ YVP    GN   S +   FF +VRA  Y+  G E   ++ N+++  K  W N  K+++  II   +T  L  W+ EN   L +  I  D++        N+  H  S   +R
Sbjct: 5122 TSQTQSDPIESWGKPLGLPSPILPGNQVDGKSTPKRVAQNSTISNKNRINQEKSKEAKATTESPNKKKTQSPIYMDLTYVPHH--GNSYYSAI--EFFKRVRARYYVFSGTEPSKEIYNALLDAKKTWEN--KELEVTIIPTYDTDVLGYWVAENEEALEKYKI--DLSPSASRCTINLQDHETSCAAYR 5303          
BLAST of SMED30024291 vs. Ensembl Cavefish
Match: map1ab (microtubule-associated protein 1Ab [Source:ZFIN;Acc:ZDB-GENE-100426-3])

HSP 1 Score: 51.2174 bits (121), Expect = 4.054e-6
Identity = 26/97 (26.80%), Postives = 50/97 (51.55%), Query Frame = 2
Query: 1316 YYLDIAYVPVDITGNVDSSRVSDRFFSKVRANCYILPG-----LEHDAKVLNSIIIGKSKWNNKDKQMKTHIIVMNNTSELKKWLLENAVKLSELNI 1591
            +Y+D+AY+P     +  +  V   FF +VRA+ Y++ G      E    VL++++ GK++W      ++  +I  ++T   + W  +   K  +LNI
Sbjct: 4088 FYVDLAYIP----NHCSAKNVDQEFFKRVRASYYVVSGNDPSSGEPSRAVLDALLEGKAQWGT---NLQVTLIPTHDTEVTRDWYQQTHEKQQDLNI 4177          
BLAST of SMED30024291 vs. Ensembl Cavefish
Match: map1b (microtubule associated protein 1B [Source:NCBI gene;Acc:103047754])

HSP 1 Score: 50.0618 bits (118), Expect = 8.694e-6
Identity = 28/102 (27.45%), Postives = 54/102 (52.94%), Query Frame = 2
Query: 1304 NTQGYYLDIAYVPVDITG-NVDSSRVSDRFFSKVRANCYILPGLEHDAK-----VLNSIIIGKSKWNNKDKQMKTHIIVMNNTSELKKWLLENAVKLSELNI 1591
            N    Y+D+ Y+P   +  NVD+      FF ++R++ Y++ G +  A+     VL++++ GK +W   D  M+  +I  +++  +++W  E   K   LNI
Sbjct: 2069 NCPPMYMDLVYIPNHCSAKNVDA-----EFFKRIRSSYYVVSGNDQTAQEPSKTVLDALLEGKEQW---DTNMQVTLIPTHDSEVMREWYQETHEKQQNLNI 2162          
BLAST of SMED30024291 vs. Ensembl Medaka
Match: map1b (microtubule associated protein 1B [Source:NCBI gene;Acc:101156753])

HSP 1 Score: 50.8322 bits (120), Expect = 4.672e-6
Identity = 27/96 (28.12%), Postives = 53/96 (55.21%), Query Frame = 2
Query: 1319 YLDIAYVPVDITGNVDSSRVSDRFFSKVRANCYILPG-----LEHDAKVLNSIIIGKSKWNNKDKQMKTHIIVMNNTSELKKWLLENAVKLSELNI 1591
            Y+D+ Y+P     +  +  V   FF +VR++ Y++ G      E    VL++++ GK++W+N    M+  +I  ++T  +++W  ++  K  ELNI
Sbjct: 1854 YMDLVYIP----NHCSAKNVDVEFFKRVRSSYYVVSGSDQMGQEPSRAVLDALLEGKAQWDN---SMQVTLIPTHDTDVMREWYQDSHDKQQELNI 1942          
BLAST of SMED30024291 vs. Planmine SMEST
Match: SMESG000064314.1 (SMESG000064314.1)

HSP 1 Score: 1083.55 bits (2801), Expect = 0.000e+0
Identity = 553/553 (100.00%), Postives = 553/553 (100.00%), Query Frame = 2
Query:    2 NENELVEPHIKNIVEGEKNISEESNVKELTKVFGKQHSFDQIEGNSEERNITDDVNYKDVSHVDETDHADDSNESEPAESNFXXXXXXXXXXXXXXXXXXKDNSDDPYKNELVEPLIKNFNVGEKNISGESCLKDLLKVDKTEHSVNQMKCKIEERNITDDANLRDLSQVDEIDHSVNSNERTLTGDNVIEVDKGQKNQHEPANLEEMSKVDEIHHSANPNESELDESNIYEVDEGETNQQKQVNPNESTPIECNTNEVDGGEKYQTEHVNLEEESMVDKIDNFVDPKESPFTKPDVNKVSEGEKNKAETQIVKSTDVDTIFVQNDVKENSKMYIENAQILASPNVISINDNKVDVKTNESSKEEIASDEDWIKVDEESTEKTNSNKNVQWSEPLGLPMPVMPDTPSRKQVGKSDGPPTRPNSILTPKSKETPENTQGYYLDIAYVPVDITGNVDSSRVSDRFFSKVRANCYILPGLEHDAKVLNSIIIGKSKWNNKDKQMKTHIIVMNNTSELKKWLLENAVKLSELNIHFDITTEQENGLTNVCKHIYSVK 1660
            NENELVEPHIKNIVEGEKNISEESNVKELTKVFGKQHSFDQIEGNSEERNITDDVNYKDVSHVDETDHADDSNESEPAESNFNEVDEEEGNSEEESKVDEKDNSDDPYKNELVEPLIKNFNVGEKNISGESCLKDLLKVDKTEHSVNQMKCKIEERNITDDANLRDLSQVDEIDHSVNSNERTLTGDNVIEVDKGQKNQHEPANLEEMSKVDEIHHSANPNESELDESNIYEVDEGETNQQKQVNPNESTPIECNTNEVDGGEKYQTEHVNLEEESMVDKIDNFVDPKESPFTKPDVNKVSEGEKNKAETQIVKSTDVDTIFVQNDVKENSKMYIENAQILASPNVISINDNKVDVKTNESSKEEIASDEDWIKVDEESTEKTNSNKNVQWSEPLGLPMPVMPDTPSRKQVGKSDGPPTRPNSILTPKSKETPENTQGYYLDIAYVPVDITGNVDSSRVSDRFFSKVRANCYILPGLEHDAKVLNSIIIGKSKWNNKDKQMKTHIIVMNNTSELKKWLLENAVKLSELNIHFDITTEQENGLTNVCKHIYSVK
Sbjct: 3534 NENELVEPHIKNIVEGEKNISEESNVKELTKVFGKQHSFDQIEGNSEERNITDDVNYKDVSHVDETDHADDSNESEPAESNFNEVDEEEGNSEEESKVDEKDNSDDPYKNELVEPLIKNFNVGEKNISGESCLKDLLKVDKTEHSVNQMKCKIEERNITDDANLRDLSQVDEIDHSVNSNERTLTGDNVIEVDKGQKNQHEPANLEEMSKVDEIHHSANPNESELDESNIYEVDEGETNQQKQVNPNESTPIECNTNEVDGGEKYQTEHVNLEEESMVDKIDNFVDPKESPFTKPDVNKVSEGEKNKAETQIVKSTDVDTIFVQNDVKENSKMYIENAQILASPNVISINDNKVDVKTNESSKEEIASDEDWIKVDEESTEKTNSNKNVQWSEPLGLPMPVMPDTPSRKQVGKSDGPPTRPNSILTPKSKETPENTQGYYLDIAYVPVDITGNVDSSRVSDRFFSKVRANCYILPGLEHDAKVLNSIIIGKSKWNNKDKQMKTHIIVMNNTSELKKWLLENAVKLSELNIHFDITTEQENGLTNVCKHIYSVK 4086          

HSP 2 Score: 158.303 bits (399), Expect = 5.474e-40
Identity = 142/346 (41.04%), Postives = 201/346 (58.09%), Query Frame = 2
Query:    2 NENELVEPHIKNIVEGEKNISEESNVKELTKVFGKQHSFDQIEGNSEERNITDDV-----------NYKDVSHVDETDHADDSNESEPAESNFXXXXXXXXXXXXXXXXXX------KDNSDDPYKNELVEPLIKNFNVGEKNISGESCLKDLLKVDKTEHSVNQMKCKI----------EERNITDDANLRDLSQVDEIDHSVNSNERTLTGDNVIEVDKGQKNQHEPANLEEMSKVDEIHHSANPNESELDESNIYEVDEGETNQQKQV---------------NPNESTPIECNTNEVDGGEKYQTEHVNLEEESMVDKIDNFVDPKESPFTKPDVNKVSEGE 913
            NE+E  E +I ++ EGE    E+ N +E++ V+  ++S   +  N+   +I  +V           N ++ S VDETDH+   N+SEPAESN N+VDEEE   +++   ++      K NSDDP   E ++P +KN +  EKNI  ES +K L  VD+ EHS +Q+K ++          EERNIT DANL++ S+VD+IDHSVN NE+TLT     E+DK ++ Q +    EE SK+DE ++SA+PNESE  ESNI EVD+ E  QQK++               + NES   E N  EVD GE+  +E  NLEE S V + D  VD  E+  T+ ++NKV E E
Sbjct: 1535 NESESAESNINDVDEGETKQQEQVNFEEVSNVYELENSV-ILNENTLTESIKKEVDNVENIQNVHANSEEESKVDETDHSIFPNQSEPAESNINKVDEEETKQQDQVNSEKVIEVVEKYNSDDPNYGEFIDPNMKNVDEEEKNIIEESNVKSLSNVDEKEHSTDQIKSELAEPNIRNVDEEERNITADANLKEESKVDKIDHSVNLNEKTLTEPITKEIDKNEQTQTDHVISEEKSKLDEKYYSADPNESEPAESNINEVDKAERKQQKKIDLEEVSNVDKTDHSADSNESKLAEQNIIEVDVGERNISEQDNLEEVSNVFETDPSVDLNENEPTESNINKVDEEE 1879          

HSP 3 Score: 142.124 bits (357), Expect = 9.395e-35
Identity = 150/430 (34.88%), Postives = 205/430 (47.67%), Query Frame = 2
Query:    2 NENELVEPHIKNIVEGEKNISEESNVKELTKVFGKQHSFDQIEG----------NSEERNITDDVNYKDVSHVDETDHA-----------------------------------------DDSNESEPAESNFXXXXXXXXXXXXX------XXXXXKDNSDDPYKNELVEPLIKNFNVGEKNISGESCLKDLL----------------------KVDKTEHSVNQM----KCKIEERNITDDANLRDL-----------------------SQVDEIDHSVNSNERTLTGDNVIEVDKGQKNQHEPANLEEMSKVDEIHHSANPNESELDESNIYEVDEGETNQQKQVN----------PNESTPIECNTNEVDGGEKYQTEHVNLEEESMVDKIDNFVDPKESPFTKPDVNKVSEGEKNKAETQIVK 943
            N  E ++P++KN+ E EKNI EESNVK L+ V  K+HS DQI+           + EERNIT D N K+ S VD+ DH+                                          D NESEPAESN NEVD+ E   +++      S VD+ D+S D  +++L E  I   +VGE+NIS +  L+++                       KVD+ E +  Q+      K+ E++++ D N  D                        S++DE DHSV++NE      N+IEVD G+  Q E  N EE+S VD+ +HS + NESEL   NI ++D+GE N   QVN          PN+    E N NEVD GE  Q E VN +E S VD  D  VD  ES   +P+V ++ E EKN +E   VK
Sbjct: 1658 NYGEFIDPNMKNVDEEEKNIIEESNVKSLSNVDEKEHSTDQIKSELAEPNIRNVDEEERNITADANLKEESKVDKIDHSVNLNEKTLTEPITKEIDKNEQTQTDHVISEEKSKLDEKYYSADPNESEPAESNINEVDKAERKQQKKIDLEEVSNVDKTDHSADSNESKLAEQNIIEVDVGERNISEQDNLEEVSNVFETDPSVDLNENEPTESNINKVDEEETTQEQLISEEVSKVGEKDVSVDPNESDFVEHNIKKVDEDEKKQHKQINLDVSKLDETDHSVDTNESKPVESNIIEVDDGEWTQQEQVNSEEVSNVDKTYHSVDQNESELANQNIIKIDKGEKNILDQVNVLYKTDHSVDPNKIKLAEFNINEVDNGEPKQQEQVNSDEVSKVDVKDKSVDTNESELCEPNVIEIDEVEKNISEKSNVK 2087          

HSP 4 Score: 142.124 bits (357), Expect = 1.056e-34
Identity = 142/351 (40.46%), Postives = 197/351 (56.13%), Query Frame = 2
Query:    2 NENELVEPHIKNIVEGEKNISEESNVKELTKVFGKQHSFDQ----------IEGNSEERNITDDVNYKDVSHVDETDHADDSNESEPAESNFXX------XXXXXXXXXXXXXXXXKDNSDDPYKNELVEPLIKNFN-VGEKNISGESCLKDLLK-------VDKTEHSVNQ--MKCKIE-ERNITDDANLRDLSQVDEIDHSVNSNERTLTGDNVIEVDKGQKNQHEPANLEEMSKVDEIHHSANPNESELDESNIYEVDEGETNQQKQVNP----------NESTPIEC-----NTNEVDGGEKYQTEHVNLEEESMVDKIDNFVDPKESPFTKPDVNKVSEGEKNKAE 928
            NE E+VE +I+N+ EG+ N+SEESN+ E + +     S D           IE +  E+NI+D VN  +VS V+ETD   + NESEP ESN  E        +E+ N EE SKV+E D S DP  +E   P   N N +G K    +  L+++ K       VD  E  + Q  +KC  E E NI++++N+ +LS++DEID SV  NE  L    +IE+D+ + N  +P NL E+SKVDE  HSA+ NE+E  E NI EVDEGE  QQ+QVNP          N   P EC     N  E+D GE    + VN++E S VD+  +  D KES  ++ ++N+V EGE  + E
Sbjct: 2749 NEIEIVESNIENVEEGKTNLSEESNINESSTIDEPDLSVDPNKSELSEHYIIEIDQVEKNISDPVNVDEVSKVEETDRTANLNESEPYESNIKEVDVGEPKQKEQVNLEEVSKVNENDYSRDPNGSE---PDDSNINELGGKMTHEKFNLEEVSKARENDDSVDPNEREIVQPNIKCLDEGETNISEESNVNELSKIDEIDRSVYPNESKLAEHYIIEIDQSKNNITDPVNLNEISKVDEKGHSADLNENEPSEYNINEVDEGEPKQQEQVNPEGVSKVNEKDNSYDPNECELAQHNITEIDQGENNIADSVNVDEVSKVDEKYHSADSKESEPSEDNINEVDEGEPKQQE 3096          

HSP 5 Score: 140.969 bits (354), Expect = 2.428e-34
Identity = 133/344 (38.66%), Postives = 173/344 (50.29%), Query Frame = 2
Query:    2 NENELVEPHIKNIVEGEKNISEESNVKELTKVFGKQHSFDQ----------IEGNSEERNITDDVNYKDVSHVDETDHADDSNESEPAESNFXXXXXXXXXXXXXXXXXXKDNSDDPYKNELVEPLIKNFNVGEKNISGESCLKDLLKVDKTEHSVNQMKCKIEERNITD----------DANLRDLSQVDEIDHSVNSNERTLTGDNVIEVDKGQKNQHEPANLEEMSKVDEIHHSANPNESELDESNIYEVDEGETNQQKQVN---------------PNESTPIECNTNEVDGGEKYQTEHVNLEEESMVDKIDNFVDPKESPFTKPDVNKVSEGEKNKAE 928
            NE+EL EP++  I E EKNISE+SNVKEL  V    HS DQ          IE +  E+NI D VN      VDETDH+ +SN+SEP+ES                             NE+ E   K     +K +     L  + KVDK + S+N  + ++ E NI++            N  ++S VD  DHS   NE  L   N+IEVD  ++N  E  NL+E+SKVDEI    +PNESE  ESNI +VDEGET QQ+QVN                NE+T  E    EVD  E  Q  H N EEES VD+ D+ + P +S   + ++NKV E E  + E
Sbjct: 2061 NESELCEPNVIEIDEVEKNISEKSNVKELLNVNETDHSDDQNDGELAKQIIIEIDEVEKNILDQVNV-----VDETDHSANSNKSEPSESKI---------------------------NEVDEADWK----QQKKVD----LDGVSKVDKKDRSINLNESELAESNISEVDERETKQLEQVNSEEVSNVDITDHSGEPNEHELAEQNIIEVDVDKRNISEKVNLDEVSKVDEIDQFVDPNESESAESNINDVDEGETKQQEQVNFEEVSNVFELENSVILNENTLTEPIKKEVDNVENIQNVHANSEEESKVDETDHSIFPNQSEPAESNINKVDEEETKQQE 2364          

HSP 6 Score: 120.168 bits (300), Expect = 1.233e-27
Identity = 111/339 (32.74%), Postives = 173/339 (51.03%), Query Frame = 2
Query:    2 NENELVEPHIKNIVEGEKNISEESNVKELTKVFGKQHSFDQIEG----------NSEERNITDDVNYKDVSHVDETDHADDSNESEPAESNFXXXXXXXXXXXXXXXXXXKDNSDDPYKNELVEPLIKNFNVGEKNISGESCLKDLLKVDKTEHSVNQMKCKIEERNI---------TDDANLRDLSQVDEIDHSVNSNERTLTGDNVIEVDKGQKNQHEPANLEEMSKVDEIHHSANPNESELDESNIYEVDEGETNQQK--------------QVNPNESTPIECNTNEVDGGEKYQTEHVNLEEESMVDKIDNFVDPKESPFTKPDVNKVSEGEKN 919
            N+ E VEP+IKN+ E EKNI EES +K L+ + G +HS D+ E           N +ER++  + N  +VS VDE  +                                   S+DP +N L EP+ K  +  E NI  +    + LK D+TE+SV+Q++ +  E NI          +  NL+++S+VDE DHSV+ NE   +G N+ E+ +G+KN  +  N++++SK DE  HS +PN+SE  +S I E+ EGE   +K               V+PNE   +E N   V+ G+   +E  N+ E S +D+ D  VDP +S  ++  + ++ + EKN
Sbjct: 2507 NKKEFVEPNIKNVDEVEKNIIEESYLKALSMIDGTKHSVDENEEELAELNIKNVNEKERSLIYNANLIEVSKVDEIYY-----------------------------------SEDPNENTLTEPITKEVDNIE-NIQTDYVKSEELKADETEYSVDQIERESAESNIDEVDEEEITQEKFNLKEVSKVDETDHSVDPNESEPSGSNINEIGQGEKNISDKVNVDQVSKDDESDHSVDPNKSEPGKSYINEI-EGEITHKKINLDEVPKVDENNDSVDPNEIEIVESNIENVEEGKTNLSEESNINESSTIDEPDLSVDPNKSELSEHYIIEIDQVEKN 2808          

HSP 7 Score: 115.161 bits (287), Expect = 3.880e-26
Identity = 121/350 (34.57%), Postives = 169/350 (48.29%), Query Frame = 2
Query:    2 NENELVEPHIKNIVEGEKNISEESNVKELTK-------VFGKQHSFDQ---IEGNSEERNITDDVNYKDVSHV----------DETDHADDSNESEPAESNFXXXXXXXXXXXXXXXXXXKDNSDDPYKNELVEPLIKNFNVGEKNISGESC-LKDLLKVDKTEHSVNQMKCKIEERNITD----------DANLRDLSQVDEIDHSVNSNERTLTGDNVIEVDKGQKNQHEPANLEEMSKVDEIHHSANPNESELDESNIYEVDEGETNQQKQVN---------------PNESTPIECNTNEVDGGEKYQTEHVNLEEESMVDKIDNFVDPKESPFTKPDVNKVSEGE 913
            NE+E+VEP+IKN+ EGE +ISEE NV EL+K       V+  +    +   IE +  E N+ D V   + S+           +ETDH+ D  E EPAESN NE                                      GE+ I+ E   L+DL KV + + S +  + +  E  I +            N  ++S+V+E D+S + NE  L    ++E+D+G+ N  +P NL E+SKVDE  HSA+ NE+E  ESNI EVDEGE  QQ+QVN               P+E  P E N NE  GGE    E  NL E S + + D+  DP +S   + ++N V E E
Sbjct: 3198 NESEIVEPNIKNVYEGETDISEEPNVNELSKIDEIDRSVYTNESKLAEHYIIEIDQGENNVADPVYVDEGSNFYGKDDSGDLNEETDHSADQIEREPAESNINE-------------------------------------AGEEEITQEKFNLEDLSKVYEKDDSGDSNESEPSESYINEVDEGEPKQQEQVNPEEVSKVNEKDNSYDPNESGLAEYYIVEIDQGKNNITDPVNLNEISKVDEEDHSADLNENEPSESNINEVDEGEPKQQEQVNPEGVSKVNEKDNSNDPSEIEPAESNINEF-GGE-MTNEKFNLVEASKIFEKDDSFDPNKSELAELNINGVDEEE 3508          

HSP 8 Score: 114.775 bits (286), Expect = 5.365e-26
Identity = 140/418 (33.49%), Postives = 214/418 (51.20%), Query Frame = 2
Query:    2 NENELVEPHIKNIVEGEKNISEESNVKELTKVFGKQHSFDQIEGNSEE--RNITDDV--------NYKDVSHVDETDHADDSNESEPAESNFXXXXXXXXXXXXXXXXXX------KDNSDDPYKNELVEPLIKNFNVGEKNISGESCLKDLLKVDKTEHSVNQMKCKIEERNITDDANLRDLSQVDEIDHSVNSNERTLTGDNVIEVDKGQKNQHEPANLEEMSKVDEIHHSANPNESELDESNIYEVDEGETNQQKQV---------------NPNESTPIECNTNEVDGGEKYQTEHVNLEEESMVDKIDNFVDPKESPFTKPDVNKVSEGEKNKA-ETQIVKSTDVDTIFVQNDVKENSKMYIENAQILASPNVISINDNKVDVKTNESSKEEIASDEDWIKVDEESTEKTNSN 1159
            NE+E  E +I ++ EGE    E+ N +E++ VF  ++S    E    E  +   D+V        N ++ S VDETDH+   N+SEPAESN N+VDEEE   +E+   DE      KD S +P ++EL EP               +C+ ++++VDK               NI++++N+++L +V E +HSV+ NE  L   N+IE+DK +KN  +  N++E+SKVDEI HSA+PNESE   SNI EV++ ET QQ+ V               NPN+   +E N   VD  EK   E   L+  SM+D   + VD  E    + ++  V+E E++      +++ + VD I+   D  EN+         L  P    + DN  +++T+    EE+ +DE    VD+   E   SN
Sbjct: 2261 NESESAESNINDVDEGETKQQEQVNFEEVSNVFELENSVILNENTLTEPIKKEVDNVENIQNVHANSEEESKVDETDHSIFPNQSEPAESNINKVDEEETKQQEQVNSDEVINVDVKDKSVNPDESELGEP---------------NCI-EIVEVDK---------------NISEESNVKELLKVTETNHSVDQNEGELDEQNIIEIDKSEKNISDQVNVDELSKVDEIDHSADPNESESANSNINEVNKKETKQQELVNSKELSEVYEKDNSYNPNKKEFVEPNIKNVDEVEKNIIEESYLKALSMIDGTKHSVDENEEELAELNIKNVNEKERSLIYNANLIEVSKVDEIYYSEDPNENT---------LTEPITKEV-DNIENIQTDYVKSEELKADETEYSVDQIERESAESN 2637          

HSP 9 Score: 107.842 bits (268), Expect = 7.988e-24
Identity = 124/348 (35.63%), Postives = 178/348 (51.15%), Query Frame = 2
Query:   14 LVEPHIKNIVEGEKNISEESNVKELTKVFGKQHSFDQIEGNSEERNITD---------DVNYKDVSHVDETDHADDSNESEPAESNFXXXXXXXXXXXX-----XXXXXXKDNSDDPYKNELVEPLIKN-FNVGEKNISGESCLKDLLKVDKTEHSVNQMKCKIEERNITD----------DANLRDLSQVDEIDHSVNSNERTLTGDNVIEVDKGQKNQHEPANLEEMSKVDEIHHSANPNESELDESNIYEVDEGETNQQKQVN---------------PNESTPIECNTNEVDGGEKYQTEHVNLEEESMVDKIDNFVDPKESPFTKPDVNKVSEGEKNKAETQI 937
            L E  I  + E    ++E  N+  +TK+  K +S D  E    E  I            VN ++V  VDET+   + N SE A+ N  +V+EE    E+      + VDE+D S D  +  L EP++K  +NV    I   +  ++  K+D+T+HSV+  + ++ E NI++            N  ++S VD  DHS   NE  L   N+I VD  ++N  E  NL+E+SKVDEI    +PNESE  ESNI +VDEGET QQ+QVN                NE+T  E    EVD  E  Q  H N EEES VD+ D+ + P +S   + ++NKV E E+ K + Q+
Sbjct: 1295 LNETQINKLGENVDQVNETFNLYVMTKMDQKDNSVDPYESAHIEAKINKIDEETIKQKQVNLEEVPKVDETEEFINPNRSELADHNIIKVEEETKKQEQINLEEVTNVDERDYSVDQNEITLTEPIMKEVYNVENIQIQRVNSEENS-KLDETDHSVDLNESELAESNISEVDEGETKQLEQVNSEEVSNVDITDHSGEPNEHELAEQNIIGVDVDKRNISEKVNLDEVSKVDEIDQFVDPNESESAESNINDVDEGETKQQEQVNFEEVSNVYELENSVILNENTLTESIKKEVDNVENIQNVHANSEEESKVDETDHSIFPNQSEPAESNINKVDE-EETKQQDQV 1640          

HSP 10 Score: 103.99 bits (258), Expect = 1.496e-22
Identity = 130/374 (34.76%), Postives = 190/374 (50.80%), Query Frame = 2
Query:    2 NENELVEPHIKNIVEGEKNISEESNVKELTK-------VFGKQHSFDQ---IEGNSEERNITDDVNYKDVSHVDETDHADDSNESEPAESNFXXXXXXXXXXXXX------XXXXXKDNSDDPYKNELVEPLIKNFNVGEKNIS-----------------------------------GESCLKD------LLKVDKTEHSVNQMKCKI----------EERNITDDANLRDLSQVDEIDHSVNSNERTLTGDNVIEVDKGQKNQHEPANLEEMSKVDEIHHSANPNESELDESNIYEVDEGETNQQKQVNPNESTPIE-----CNTNEVDGGEKYQTEHVNLEEESMVDKIDNFVDPKESPFTKPDVNKVSE 907
            NE E+V+P+IK + EGE NISEESNV EL+K       V+  +    +   IE +  + NITD VN  ++S VDE  H+ D NE+EP+E N NEVDE E   +E+      SKV+EKDNS DP + EL +  I   + GE NI+                                   GE   ++      +LKV+K ++S +  + ++           E NI D  N+ ++S+V+E DH+ N NE      N+ EVD+G+  Q E  N EE+SKV+E   S + NESE+ E NI  V EGET+  ++ N NE + I+       TNE    E Y  E ++  E ++ D +  +VD   + + K D   ++E
Sbjct: 2911 NEREIVQPNIKCLDEGETNISEESNVNELSKIDEIDRSVYPNESKLAEHYIIEIDQSKNNITDPVNLNEISKVDEKGHSADLNENEPSEYNINEVDEGEPKQQEQVNPEGVSKVNEKDNSYDPNECELAQHNITEIDQGENNIADSVNVDEVSKVDEKYHSADSKESEPSEDNINEVDEGEPKQQEQFNPEEVLKVNKKDNSDDPNQSELVESHIIEIDQGENNIADHVNVDEVSKVEETDHTGNLNESEPYESNIKEVDEGEPKQQEQVNPEEVSKVNEKGDSGDTNESEIVEPNIKNVYEGETDISEEPNVNELSKIDEIDRSVYTNESKLAEHYIIE-IDQGENNVADPV--YVDEGSNFYGKDDSGDLNE 3281          

HSP 11 Score: 92.0485 bits (227), Expect = 7.028e-19
Identity = 122/353 (34.56%), Postives = 173/353 (49.01%), Query Frame = 2
Query:    2 NENELVEPHIKNIVEGEKNISEESNVKELTKVFGKQHSFDQIEGNSEERNITDDVNYKDVSHVDETDHADDSNESEPAESNFXXXXXXXXXXXXXXXXXX------KDNSDDPYKNELVEPLIKNFNVGEKNISGESCLKDLLKVDKTEHSVNQMKCKIEERNITD----------DANLRDLSQVDEIDHSVNSNERTLTGDNVIEVDKGQKNQHEPANLEEMSKVDEIHHSANPNESELDESNIYEVDEGETNQQKQVN---------------PNESTPIECNTNEVDGGEKYQTEHVNLEEESMVDKIDNFVDPKESPFTKPDVNKVSEGEKN-KAETQIVKSTDVDTI 964
            NE  L EP +K +           NV+ +           QI+           VN ++ S +DETDH+ D NESE AESN +EVDE E    E+   +E       D+S +P ++EL E  I   +V ++NIS +  L ++ KVD+ +  V+  + +  E NI D            N  ++S V E+++SV  NE TLT     EVD  +  Q+  AN EE SKVDE  HS  PN+SE  ESNI +VDE ET QQ QVN               PN    I+ N   VD  EK   E  N++  S VD+ ++  D  +S   +P++  V E E+N  A+  + + + VD I
Sbjct: 1412 NEITLTEPIMKEVY----------NVENI-----------QIQR----------VNSEENSKLDETDHSVDLNESELAESNISEVDEGETKQLEQVNSEEVSNVDITDHSGEPNEHELAEQNIIGVDVDKRNISEKVNLDEVSKVDEIDQFVDPNESESAESNINDVDEGETKQQEQVNFEEVSNVYELENSVILNENTLTESIKKEVDNVENIQNVHANSEEESKVDETDHSIFPNQSEPAESNINKVDEEETKQQDQVNSEKVIEVVEKYNSDDPNYGEFIDPNMKNVDEEEKNIIEESNVKSLSNVDEKEHSTDQIKSELAEPNIRNVDEEERNITADANLKEESKVDKI 1733          

HSP 12 Score: 79.337 bits (194), Expect = 6.462e-15
Identity = 116/348 (33.33%), Postives = 170/348 (48.85%), Query Frame = 2
Query:    2 NENELVEPHIKNIVEGEKNISEESNVKELTKVFGKQHSFDQ----------IEGNSEERNITDDVNYKDVSHVDETDHADDSNESEPAESNF------XXXXXXXXXXXXXXXXXXKDNSDDPYKNELVEPLIKNFNVGE--KNISGESCLKDLLKVDKTEHSVNQMKCKIEERNIT----------DDANLRDLSQVDEIDHSVNSNERTLTGDNVIEVDKGQKNQHEPANLEEMSKVDEIHHSANPNESELDESNIYEVDEGETNQQK---------------QVNPNESTPIECNTNEVDGGEKYQTEHVNLEEESMVDKIDNFVDPKESPFTKPDVNKVSEGEK 916
            NE+EL E +I  + EGE    E+ N +E++ V    HS +           I  + ++RNI++ VN  +VS VDE D   D NESE AESN           +E+ N EE S V E +NS    +N L E + K  +  E  +N+   S  ++  KVD+T+HS+   + +  E NI           D  N   + +V E  +S + N       N+  VD+ +KN  E +N++ +S VDE  HS +  +SEL E NI  VDE E N                   VN NE T  E  T E+D  E+ QT+HV  EE+S +D+     DP ES   + ++N+V + E+
Sbjct: 1453 NESELAESNISEVDEGETKQLEQVNSEEVSNVDITDHSGEPNEHELAEQNIIGVDVDKRNISEKVNLDEVSKVDEIDQFVDPNESESAESNINDVDEGETKQQEQVNFEEVSNVYELENSVILNENTLTESIKKEVDNVENIQNVHANS--EEESKVDETDHSIFPNQSEPAESNINKVDEEETKQQDQVNSEKVIEVVEKYNSDDPNYGEFIDPNMKNVDEEEKNIIEESNVKSLSNVDEKEHSTDQIKSELAEPNIRNVDEEERNITADANLKEESKVDKIDHSVNLNEKTLTEPITKEIDKNEQTQTDHVISEEKSKLDEKYYSADPNESEPAESNINEVDKAER 1798          
BLAST of SMED30024291 vs. Planmine SMEST
Match: SMESG000014298.1 (SMESG000014298.1)

HSP 1 Score: 113.62 bits (283), Expect = 1.276e-25
Identity = 69/216 (31.94%), Postives = 97/216 (44.91%), Query Frame = 2
Query: 1148 TNSNKNVQWSEPLGLPMPVMPDT-PSRKQVGKSDG--------------PP------------------------TRPNSILTPK---------SKETP------------ENTQGYYLDIAYVPVDITGNVDSSRVSDRFFSKVRANCYILPGLEHDAKVLNSIIIGKSKWNNKDKQMKTHIIVMNNTSELKKWLLENAVKLSELNIHFDITTEQ 1615
            +NS     W+EPLGLPMP + ++ PS K     +               PP                        + P+  L PK         SK TP                 +YLD+AY+PVD  GNV  +RVS+ FF+++RA  YILPGLEH+ +VL + +  + KW   D +M+  +I +  T  L+KW  E+A +LS LNI      E 
Sbjct: 2622 SNSTSTSHWNEPLGLPMPTLLNSKPSTKPPADKNSSHITSAKLKSTHATPPKVNGTQSNNVSASAHKATDSPKGVSSPHHSLPPKPSAPKSTGISKSTPTKPAKKPEIIDQSKLPAFYLDVAYIPVDQDGNVTLTRVSEAFFTRIRARQYILPGLEHNFEVLETFLASRKKWAESDNEMEVRLIPIKMTETLRKWAGEHAAELSLLNIKIGAAVEH 2837          
The following BLAST results are available for this feature:
BLAST of SMED30024291 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30024291 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30024291 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
futsch1.197e-728.42gene:FBgn0259108 transcript:FBtr0307597[more]
futsch1.197e-728.42gene:FBgn0259108 transcript:FBtr0307598[more]
futsch1.197e-728.42gene:FBgn0259108 transcript:FBtr0112628[more]
back to top
BLAST of SMED30024291 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
map1b1.058e-627.72microtubule-associated protein 1B [Source:ZFIN;Acc... [more]
map1b1.058e-627.72microtubule-associated protein 1B [Source:ZFIN;Acc... [more]
back to top
BLAST of SMED30024291 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30024291 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30024291 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|Q9W596|FUTSC_DROME1.200e-628.42Microtubule-associated protein futsch OS=Drosophil... [more]
back to top
BLAST of SMED30024291 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A553NNJ29.954e-1430.46Uncharacterized protein OS=Tigriopus californicus ... [more]
A0A162Q0D64.659e-1028.81Uncharacterized protein OS=Daphnia magna OX=35525 ... [more]
A0A4E0RIX92.950e-928.31Putative microtubule-associated protein OS=Fasciol... [more]
E9GAY03.231e-928.57Uncharacterized protein OS=Daphnia pulex OX=6669 G... [more]
A0A5E4QF971.057e-829.47Uncharacterized protein OS=Leptidea sinapis OX=189... [more]
back to top
BLAST of SMED30024291 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
map1ab4.054e-626.80microtubule-associated protein 1Ab [Source:ZFIN;Ac... [more]
map1b8.694e-627.45microtubule associated protein 1B [Source:NCBI gen... [more]
back to top
BLAST of SMED30024291 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30024291 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30024291 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30024291 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
map1b4.672e-628.13microtubule associated protein 1B [Source:NCBI gen... [more]
back to top
BLAST of SMED30024291 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000064314.15.474e-40100.00SMESG000064314.1[more]
SMESG000014298.11.276e-2531.94SMESG000014298.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024291 ID=SMED30024291|Name=SMED30024291|organism=Schmidtea mediterranea sexual|type=transcript|length=1901bp
AAATGAAAATGAACTTGTTGAGCCTCATATCAAAAATATCGTAGAAGGTG
AAAAGAATATTTCCGAGGAATCAAATGTAAAAGAATTGACAAAGGTTTTT
GGAAAACAGCATTCTTTTGATCAAATTGAAGGGAATTCTGAGGAGAGAAA
TATAACTGATGATGTAAATTATAAAGATGTGTCACATGTTGATGAAACAG
ATCATGCTGATGATTCAAATGAAAGTGAACCTGCTGAGTCTAATTTCAAT
GAAGTTGATGAGGAAGAAGGTAATTCTGAAGAGGAATCAAAAGTTGATGA
AAAAGATAATTCTGATGATCCTTATAAAAATGAACTTGTTGAGCCTCTTA
TAAAAAACTTCAACGTAGGAGAAAAGAATATTTCCGGGGAATCTTGTTTA
AAAGATCTGTTAAAGGTTGATAAAACAGAGCATTCTGTTAATCAAATGAA
ATGCAAAATTGAGGAGAGGAATATAACTGATGATGCAAATTTAAGAGATC
TGTCACAGGTTGATGAAATAGATCATTCCGTCAATTCAAATGAAAGGACA
CTTACTGGGGATAATGTCATTGAAGTCGATAAAGGACAAAAGAACCAACA
CGAGCCAGCAAATTTAGAAGAGATGTCAAAGGTTGATGAAATACATCATT
CTGCCAATCCAAATGAAAGTGAGCTTGATGAGTCTAATATTTATGAAGTC
GATGAAGGAGAAACTAACCAACAAAAGCAAGTCAATCCAAATGAAAGTAC
ACCTATTGAGTGCAATACAAATGAAGTTGATGGCGGAGAAAAGTATCAAA
CTGAGCATGTTAATTTGGAAGAGGAGTCAATGGTTGATAAAATCGATAAT
TTTGTTGATCCGAAAGAAAGTCCATTTACTAAGCCTGACGTGAATAAAGT
CAGTGAAGGAGAAAAGAATAAAGCTGAAACACAAATTGTAAAGTCAACAG
ACGTTGATACAATATTTGTTCAAAATGATGTCAAAGAGAATTCAAAAATG
TATATTGAAAATGCTCAAATTTTAGCTTCACCAAATGTAATATCTATTAA
TGACAATAAAGTTGATGTAAAAACGAATGAAAGTTCAAAAGAAGAAATTG
CAAGCGATGAAGATTGGATAAAAGTCGACGAAGAGTCAACTGAGAAGACA
AATTCCAATAAAAACGTCCAGTGGTCTGAACCCCTTGGTTTACCAATGCC
AGTCATGCCGGATACTCCATCGCGGAAACAAGTTGGGAAATCAGATGGAC
CGCCAACTCGGCCAAATTCAATTTTGACTCCAAAATCTAAAGAAACTCCA
GAAAATACTCAAGGATATTACCTAGATATTGCATATGTTCCTGTGGATAT
TACTGGCAACGTTGACTCGTCAAGAGTTTCTGATAGATTTTTCTCAAAAG
TTCGAGCAAATTGCTACATACTTCCTGGCCTAGAACACGATGCTAAAGTT
TTAAACAGTATAATAATTGGTAAAAGCAAATGGAACAATAAAGACAAACA
AATGAAAACTCACATTATCGTCATGAACAATACCAGTGAATTGAAAAAGT
GGTTGTTAGAAAATGCTGTAAAGTTATCAGAATTGAATATACATTTCGAT
ATTACTACGGAACAAGAAAATGGCCTAACAAACGTATGCAAACATATTTA
TTCAGTAAAATGATTCAGAGGAAAATTTATTATTTATTAAGAGTTTTATT
CGATTTATTTTATATAAAAGATTGATTTTTTGCACTTTACTTGTGAGATT
TAGTTCATTTTTATTATTTTTGGTTGATATCAGAATGTAGCTCAGCAAGA
TGAATATGATTTTATTTTTCCATAACTTTTTATTACGATTGTTATTAGCA
AATGTAGAATGCGGGTGACTTTCTCATGACATTTATGAATTTATAGGGAG
G
back to top

protein sequence of SMED30024291-orf-1

>SMED30024291-orf-1 ID=SMED30024291-orf-1|Name=SMED30024291-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=554bp
NENELVEPHIKNIVEGEKNISEESNVKELTKVFGKQHSFDQIEGNSEERN
ITDDVNYKDVSHVDETDHADDSNESEPAESNFNEVDEEEGNSEEESKVDE
KDNSDDPYKNELVEPLIKNFNVGEKNISGESCLKDLLKVDKTEHSVNQMK
CKIEERNITDDANLRDLSQVDEIDHSVNSNERTLTGDNVIEVDKGQKNQH
EPANLEEMSKVDEIHHSANPNESELDESNIYEVDEGETNQQKQVNPNEST
PIECNTNEVDGGEKYQTEHVNLEEESMVDKIDNFVDPKESPFTKPDVNKV
SEGEKNKAETQIVKSTDVDTIFVQNDVKENSKMYIENAQILASPNVISIN
DNKVDVKTNESSKEEIASDEDWIKVDEESTEKTNSNKNVQWSEPLGLPMP
VMPDTPSRKQVGKSDGPPTRPNSILTPKSKETPENTQGYYLDIAYVPVDI
TGNVDSSRVSDRFFSKVRANCYILPGLEHDAKVLNSIIIGKSKWNNKDKQ
MKTHIIVMNNTSELKKWLLENAVKLSELNIHFDITTEQENGLTNVCKHIY
SVK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR026074MAP1
Vocabulary: biological process
TermDefinition
GO:0000226microtubule cytoskeleton organization
Vocabulary: cellular component
TermDefinition
GO:0005874microtubule
Vocabulary: molecular function
TermDefinition
GO:0008017microtubule binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 40..112
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 41..75
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 96..112
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 80..95
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 416..432
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 375..432
NoneNo IPR availablePANTHERPTHR13843:SF12MICROTUBULE-ASSOCIATED PROTEIN FUTSCHcoord: 306..533
IPR026074Microtubule associated protein 1PANTHERPTHR13843MICROTUBULE-ASSOCIATED PROTEINcoord: 306..533